Summary
A0A087WV53
Homolog: P05548.
Function: CAVP-target protein.
Statistics
Total GO Annotation: 685
Unique PROST Go: 2
Unique BLAST Go: 677
Total Homologs: 376
Unique PROST Homologs: 2
Unique BLAST Homologs: 371
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
P05548
(CAVP-target protein) with a FATCAT P-Value: 1.44e-11 and RMSD of 2.16 angstrom. The sequence alignment identity is 42.7%.
Structural alignment shown in left. Query protein A0A087WV53 colored as red in alignment, homolog P05548 colored as blue.
Query protein A0A087WV53 is also shown in right top, homolog P05548 showed in right bottom. They are colored based on secondary structures.
A0A087WV53 ---MSKAAPAKKPVAVAPA---P--GCTLDINDPQVQSAAIRIQASYRGHRSRKELREKGPPRVLEPLKDVVLIEGSAAKLT--CRISAFPDPFIRWSKD 90 P05548 PKPPAEAKPAAKP-AAPPAAANPFEG--VDVKDPIVISAATRIQASFRMHKNRMALKEKSIPKFSQVLKDMFVMEGSA--VTFFARVWGIPDPVIKWFKD 95 A0A087WV53 GKELRDGPKYRYVFEDPDVVALVVR--DGELADLGQYSINVTNPFGQCSDSARILVEVPTKIQKGPDN-T-KARKGTTVTLTAEILGEPAPDVGWTKDG- 185 P05548 GQEVKQGPKHEIKFDDKDGTFLIIRNADGD--DVGTYTCQATNSFGEAFDSARLALEVPAKCTKQPDNITVKA--GGNFEIKVEIAGEPEPDVIWTK-GK 190 A0A087WV53 EDIEEDDRVFFEIGSTTTTLTIRRATPQDSGKYEVYVENSLGMDQSFARVDVA 238 P05548 KEIDEGGRFSYEDSPDYSILRVEKAQAGDAGKYEIEIVNDLGKARAYCTVKVN 243
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0098632 | cell-cell adhesion mediator activity |
| 1. PB | GO:0007411 | axon guidance |
| 1. PB | GO:0070593 | dendrite self-avoidance |
| 1. PB | GO:0007155 | cell adhesion |
| 1. PB | GO:0030424 | axon |
| 1. PB | GO:0007156 | homophilic cell adhesion via plasma membrane adhesion molecules |
| 2. P | GO:0005576 | extracellular region |
| 2. P | GO:0048666 | neuron development |
| 3. B | GO:0030198 | extracellular matrix organization |
| 3. B | GO:0005017 | platelet-derived growth factor-activated receptor activity |
| 3. B | GO:0007523 | larval visceral muscle development |
| 3. B | GO:2001260 | regulation of semaphorin-plexin signaling pathway |
| 3. B | GO:0090722 | receptor-receptor interaction |
| 3. B | GO:0090141 | positive regulation of mitochondrial fission |
| 3. B | GO:0042473 | outer ear morphogenesis |
| 3. B | GO:0019226 | transmission of nerve impulse |
| 3. B | GO:0014705 | C zone |
| 3. B | GO:0035584 | calcium-mediated signaling using intracellular calcium source |
| 3. B | GO:0098797 | plasma membrane protein complex |
| 3. B | GO:0003148 | outflow tract septum morphogenesis |
| 3. B | GO:0030913 | paranodal junction assembly |
| 3. B | GO:0097350 | neutrophil clearance |
| 3. B | GO:0021891 | olfactory bulb interneuron development |
| 3. B | GO:0031549 | negative regulation of brain-derived neurotrophic factor receptor signaling pathway |
| 3. B | GO:1990782 | protein tyrosine kinase binding |
| 3. B | GO:0004687 | myosin light chain kinase activity |
| 3. B | GO:0010640 | regulation of platelet-derived growth factor receptor signaling pathway |
| 3. B | GO:0036324 | vascular endothelial growth factor receptor-2 signaling pathway |
| 3. B | GO:0001701 | in utero embryonic development |
| 3. B | GO:0005021 | vascular endothelial growth factor-activated receptor activity |
| 3. B | GO:0010966 | regulation of phosphate transport |
| 3. B | GO:0030275 | LRR domain binding |
| 3. B | GO:0030334 | regulation of cell migration |
| 3. B | GO:0060412 | ventricular septum morphogenesis |
| 3. B | GO:0060615 | mammary gland bud formation |
| 3. B | GO:0048339 | paraxial mesoderm development |
| 3. B | GO:0070372 | regulation of ERK1 and ERK2 cascade |
| 3. B | GO:2000853 | negative regulation of corticosterone secretion |
| 3. B | GO:0004725 | protein tyrosine phosphatase activity |
| 3. B | GO:0045663 | positive regulation of myoblast differentiation |
| 3. B | GO:2000573 | positive regulation of DNA biosynthetic process |
| 3. B | GO:0043552 | positive regulation of phosphatidylinositol 3-kinase activity |
| 3. B | GO:0010712 | regulation of collagen metabolic process |
| 3. B | GO:0099054 | presynapse assembly |
| 3. B | GO:0035025 | positive regulation of Rho protein signal transduction |
| 3. B | GO:0032971 | regulation of muscle filament sliding |
| 3. B | GO:0008038 | neuron recognition |
| 3. B | GO:0014722 | regulation of skeletal muscle contraction by calcium ion signaling |
| 3. B | GO:0001837 | epithelial to mesenchymal transition |
| 3. B | GO:0030240 | skeletal muscle thin filament assembly |
| 3. B | GO:0005615 | extracellular space |
| 3. B | GO:0060855 | venous endothelial cell migration involved in lymph vessel development |
| 3. B | GO:0060945 | cardiac neuron differentiation |
| 3. B | GO:0034067 | protein localization to Golgi apparatus |
| 3. B | GO:0001726 | ruffle |
| 3. B | GO:0008131 | primary amine oxidase activity |
| 3. B | GO:1900020 | positive regulation of protein kinase C activity |
| 3. B | GO:0007157 | heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules |
| 3. B | GO:0030054 | cell junction |
| 3. B | GO:0010765 | positive regulation of sodium ion transport |
| 3. B | GO:0044224 | juxtaparanode region of axon |
| 3. B | GO:0001657 | ureteric bud development |
| 3. B | GO:0022405 | hair cycle process |
| 3. B | GO:0033600 | negative regulation of mammary gland epithelial cell proliferation |
| 3. B | GO:2001214 | positive regulation of vasculogenesis |
| 3. B | GO:0060419 | heart growth |
| 3. B | GO:0055003 | cardiac myofibril assembly |
| 3. B | GO:0007417 | central nervous system development |
| 3. B | GO:0043025 | neuronal cell body |
| 3. B | GO:2001222 | regulation of neuron migration |
| 3. B | GO:0050925 | negative regulation of negative chemotaxis |
| 3. B | GO:0060449 | bud elongation involved in lung branching |
| 3. B | GO:0038083 | peptidyl-tyrosine autophosphorylation |
| 3. B | GO:0051155 | positive regulation of striated muscle cell differentiation |
| 3. B | GO:0097105 | presynaptic membrane assembly |
| 3. B | GO:0098975 | postsynapse of neuromuscular junction |
| 3. B | GO:0007520 | myoblast fusion |
| 3. B | GO:0060219 | camera-type eye photoreceptor cell differentiation |
| 3. B | GO:0014911 | positive regulation of smooth muscle cell migration |
| 3. B | GO:0016202 | regulation of striated muscle tissue development |
| 3. B | GO:0042065 | glial cell growth |
| 3. B | GO:0005161 | platelet-derived growth factor receptor binding |
| 3. B | GO:0060857 | establishment of glial blood-brain barrier |
| 3. B | GO:0030296 | protein tyrosine kinase activator activity |
| 3. B | GO:0008045 | motor neuron axon guidance |
| 3. B | GO:0099560 | synaptic membrane adhesion |
| 3. B | GO:0051057 | positive regulation of small GTPase mediated signal transduction |
| 3. B | GO:0016477 | cell migration |
| 3. B | GO:0050804 | modulation of chemical synaptic transmission |
| 3. B | GO:0016199 | axon midline choice point recognition |
| 3. B | GO:0014002 | astrocyte development |
| 3. B | GO:0099545 | trans-synaptic signaling by trans-synaptic complex |
| 3. B | GO:0007158 | neuron cell-cell adhesion |
| 3. B | GO:0048745 | smooth muscle tissue development |
| 3. B | GO:0043536 | positive regulation of blood vessel endothelial cell migration |
| 3. B | GO:0031529 | ruffle organization |
| 3. B | GO:0005887 | integral component of plasma membrane |
| 3. B | GO:0048814 | regulation of dendrite morphogenesis |
| 3. B | GO:0040017 | positive regulation of locomotion |
| 3. B | GO:0072091 | regulation of stem cell proliferation |
| 3. B | GO:0070700 | BMP receptor binding |
| 3. B | GO:0010763 | positive regulation of fibroblast migration |
| 3. B | GO:0001945 | lymph vessel development |
| 3. B | GO:0045597 | positive regulation of cell differentiation |
| 3. B | GO:0033563 | dorsal/ventral axon guidance |
| 3. B | GO:0061144 | alveolar secondary septum development |
| 3. B | GO:0005178 | integrin binding |
| 3. B | GO:0090272 | negative regulation of fibroblast growth factor production |
| 3. B | GO:0030425 | dendrite |
| 3. B | GO:0035162 | embryonic hemopoiesis |
| 3. B | GO:0005634 | nucleus |
| 3. B | GO:0031012 | extracellular matrix |
| 3. B | GO:0035385 | Roundabout signaling pathway |
| 3. B | GO:0010629 | negative regulation of gene expression |
| 3. B | GO:0050850 | positive regulation of calcium-mediated signaling |
| 3. B | GO:0044291 | cell-cell contact zone |
| 3. B | GO:0003401 | axis elongation |
| 3. B | GO:0031410 | cytoplasmic vesicle |
| 3. B | GO:0090179 | planar cell polarity pathway involved in neural tube closure |
| 3. B | GO:0060059 | embryonic retina morphogenesis in camera-type eye |
| 3. B | GO:0038129 | ERBB3 signaling pathway |
| 3. B | GO:0005516 | calmodulin binding |
| 3. B | GO:1902178 | fibroblast growth factor receptor apoptotic signaling pathway |
| 3. B | GO:0001764 | neuron migration |
| 3. B | GO:0048730 | epidermis morphogenesis |
| 3. B | GO:0030971 | receptor tyrosine kinase binding |
| 3. B | GO:0051174 | regulation of phosphorus metabolic process |
| 3. B | GO:0030055 | cell-substrate junction |
| 3. B | GO:0004672 | protein kinase activity |
| 3. B | GO:0030246 | carbohydrate binding |
| 3. B | GO:0007223 | Wnt signaling pathway, calcium modulating pathway |
| 3. B | GO:0048769 | sarcomerogenesis |
| 3. B | GO:0043410 | positive regulation of MAPK cascade |
| 3. B | GO:0002053 | positive regulation of mesenchymal cell proliferation |
| 3. B | GO:0043583 | ear development |
| 3. B | GO:0005769 | early endosome |
| 3. B | GO:0002175 | protein localization to paranode region of axon |
| 3. B | GO:0045665 | negative regulation of neuron differentiation |
| 3. B | GO:0050839 | cell adhesion molecule binding |
| 3. B | GO:0055074 | calcium ion homeostasis |
| 3. B | GO:0048762 | mesenchymal cell differentiation |
| 3. B | GO:0048699 | generation of neurons |
| 3. B | GO:1905490 | negative regulation of sensory neuron axon guidance |
| 3. B | GO:0039706 | co-receptor binding |
| 3. B | GO:0048681 | negative regulation of axon regeneration |
| 3. B | GO:0004601 | peroxidase activity |
| 3. B | GO:0060541 | respiratory system development |
| 3. B | GO:0070379 | high mobility group box 1 binding |
| 3. B | GO:0005007 | fibroblast growth factor-activated receptor activity |
| 3. B | GO:0071065 | alpha9-beta1 integrin-vascular cell adhesion molecule-1 complex |
| 3. B | GO:0035924 | cellular response to vascular endothelial growth factor stimulus |
| 3. B | GO:0030241 | skeletal muscle myosin thick filament assembly |
| 3. B | GO:0016203 | muscle attachment |
| 3. B | GO:0106096 | response to ceramide |
| 3. B | GO:0001571 | non-tyrosine kinase fibroblast growth factor receptor activity |
| 3. B | GO:0060763 | mammary duct terminal end bud growth |
| 3. B | GO:0051493 | regulation of cytoskeleton organization |
| 3. B | GO:2000379 | positive regulation of reactive oxygen species metabolic process |
| 3. B | GO:0002544 | chronic inflammatory response |
| 3. B | GO:0030133 | transport vesicle |
| 3. B | GO:0022614 | membrane to membrane docking |
| 3. B | GO:0032688 | negative regulation of interferon-beta production |
| 3. B | GO:0035791 | platelet-derived growth factor receptor-beta signaling pathway |
| 3. B | GO:0042060 | wound healing |
| 3. B | GO:0019227 | neuronal action potential propagation |
| 3. B | GO:0060669 | embryonic placenta morphogenesis |
| 3. B | GO:0060828 | regulation of canonical Wnt signaling pathway |
| 3. B | GO:0050768 | negative regulation of neurogenesis |
| 3. B | GO:0019838 | growth factor binding |
| 3. B | GO:0045211 | postsynaptic membrane |
| 3. B | GO:0010976 | positive regulation of neuron projection development |
| 3. B | GO:0030017 | sarcomere |
| 3. B | GO:0043491 | protein kinase B signaling |
| 3. B | GO:0050772 | positive regulation of axonogenesis |
| 3. B | GO:0048407 | platelet-derived growth factor binding |
| 3. B | GO:0010737 | protein kinase A signaling |
| 3. B | GO:0006942 | regulation of striated muscle contraction |
| 3. B | GO:0031290 | retinal ganglion cell axon guidance |
| 3. B | GO:0090128 | regulation of synapse maturation |
| 3. B | GO:0045177 | apical part of cell |
| 3. B | GO:0051048 | negative regulation of secretion |
| 3. B | GO:0048019 | receptor antagonist activity |
| 3. B | GO:0090090 | negative regulation of canonical Wnt signaling pathway |
| 3. B | GO:0030016 | myofibril |
| 3. B | GO:0018108 | peptidyl-tyrosine phosphorylation |
| 3. B | GO:0050803 | regulation of synapse structure or activity |
| 3. B | GO:0048568 | embryonic organ development |
| 3. B | GO:0072223 | metanephric glomerular mesangium development |
| 3. B | GO:0060174 | limb bud formation |
| 3. B | GO:0007409 | axonogenesis |
| 3. B | GO:0008366 | axon ensheathment |
| 3. B | GO:0051371 | muscle alpha-actinin binding |
| 3. B | GO:0048513 | animal organ development |
| 3. B | GO:0060523 | prostate epithelial cord elongation |
| 3. B | GO:0060595 | fibroblast growth factor receptor signaling pathway involved in mammary gland specification |
| 3. B | GO:0031430 | M band |
| 3. B | GO:0005911 | cell-cell junction |
| 3. B | GO:0038127 | ERBB signaling pathway |
| 3. B | GO:0031253 | cell projection membrane |
| 3. B | GO:0060463 | lung lobe morphogenesis |
| 3. B | GO:0042692 | muscle cell differentiation |
| 3. B | GO:0048036 | central complex development |
| 3. B | GO:0003272 | endocardial cushion formation |
| 3. B | GO:0008543 | fibroblast growth factor receptor signaling pathway |
| 3. B | GO:0033691 | sialic acid binding |
| 3. B | GO:0060981 | cell migration involved in coronary angiogenesis |
| 3. B | GO:0010715 | regulation of extracellular matrix disassembly |
| 3. B | GO:0035604 | fibroblast growth factor receptor signaling pathway involved in positive regulation of cell proliferation in bone marrow |
| 3. B | GO:0060076 | excitatory synapse |
| 3. B | GO:0009986 | cell surface |
| 3. B | GO:0032808 | lacrimal gland development |
| 3. B | GO:1903465 | positive regulation of mitotic cell cycle DNA replication |
| 3. B | GO:0022612 | gland morphogenesis |
| 3. B | GO:0035373 | chondroitin sulfate proteoglycan binding |
| 3. B | GO:0051150 | regulation of smooth muscle cell differentiation |
| 3. B | GO:0002244 | hematopoietic progenitor cell differentiation |
| 3. B | GO:0097493 | structural molecule activity conferring elasticity |
| 3. B | GO:0005737 | cytoplasm |
| 3. B | GO:0017147 | Wnt-protein binding |
| 3. B | GO:0031133 | regulation of axon diameter |
| 3. B | GO:0098978 | glutamatergic synapse |
| 3. B | GO:1904646 | cellular response to amyloid-beta |
| 3. B | GO:0007185 | transmembrane receptor protein tyrosine phosphatase signaling pathway |
| 3. B | GO:0055013 | cardiac muscle cell development |
| 3. B | GO:1904800 | negative regulation of neuron remodeling |
| 3. B | GO:0060837 | blood vessel endothelial cell differentiation |
| 3. B | GO:0048403 | brain-derived neurotrophic factor binding |
| 3. B | GO:0007420 | brain development |
| 3. B | GO:0003158 | endothelium development |
| 3. B | GO:0051250 | negative regulation of lymphocyte activation |
| 3. B | GO:0010977 | negative regulation of neuron projection development |
| 3. B | GO:0043005 | neuron projection |
| 3. B | GO:0005919 | pleated septate junction |
| 3. B | GO:0042661 | regulation of mesodermal cell fate specification |
| 3. B | GO:0001822 | kidney development |
| 3. B | GO:0038091 | positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathway |
| 3. B | GO:0048643 | positive regulation of skeletal muscle tissue development |
| 3. B | GO:0007219 | Notch signaling pathway |
| 3. B | GO:0001501 | skeletal system development |
| 3. B | GO:0038023 | signaling receptor activity |
| 3. B | GO:0051770 | positive regulation of nitric-oxide synthase biosynthetic process |
| 3. B | GO:0033631 | cell-cell adhesion mediated by integrin |
| 3. B | GO:0006470 | protein dephosphorylation |
| 3. B | GO:0070831 | basement membrane assembly |
| 3. B | GO:0003007 | heart morphogenesis |
| 3. B | GO:0030165 | PDZ domain binding |
| 3. B | GO:0031034 | myosin filament assembly |
| 3. B | GO:0048565 | digestive tract development |
| 3. B | GO:0035335 | peptidyl-tyrosine dephosphorylation |
| 3. B | GO:0002062 | chondrocyte differentiation |
| 3. B | GO:0021853 | cerebral cortex GABAergic interneuron migration |
| 3. B | GO:0000165 | MAPK cascade |
| 3. B | GO:0007568 | aging |
| 3. B | GO:0003161 | cardiac conduction system development |
| 3. B | GO:0005912 | adherens junction |
| 3. B | GO:0035474 | selective angioblast sprouting |
| 3. B | GO:0043056 | forward locomotion |
| 3. B | GO:0048168 | regulation of neuronal synaptic plasticity |
| 3. B | GO:0019806 | bromide peroxidase activity |
| 3. B | GO:0032154 | cleavage furrow |
| 3. B | GO:0022010 | central nervous system myelination |
| 3. B | GO:2000352 | negative regulation of endothelial cell apoptotic process |
| 3. B | GO:0045666 | positive regulation of neuron differentiation |
| 3. B | GO:0048608 | reproductive structure development |
| 3. B | GO:0042476 | odontogenesis |
| 3. B | GO:0045839 | negative regulation of mitotic nuclear division |
| 3. B | GO:0048598 | embryonic morphogenesis |
| 3. B | GO:2000546 | positive regulation of endothelial cell chemotaxis to fibroblast growth factor |
| 3. B | GO:0051901 | positive regulation of mitochondrial depolarization |
| 3. B | GO:0015629 | actin cytoskeleton |
| 3. B | GO:0031674 | I band |
| 3. B | GO:1903523 | negative regulation of blood circulation |
| 3. B | GO:0060539 | diaphragm development |
| 3. B | GO:0009966 | regulation of signal transduction |
| 3. B | GO:0061028 | establishment of endothelial barrier |
| 3. B | GO:0008285 | negative regulation of cell population proliferation |
| 3. B | GO:0090080 | positive regulation of MAPKKK cascade by fibroblast growth factor receptor signaling pathway |
| 3. B | GO:0036309 | protein localization to M-band |
| 3. B | GO:0045664 | regulation of neuron differentiation |
| 3. B | GO:0048557 | embryonic digestive tract morphogenesis |
| 3. B | GO:0048803 | imaginal disc-derived male genitalia morphogenesis |
| 3. B | GO:0090050 | positive regulation of cell migration involved in sprouting angiogenesis |
| 3. B | GO:0048710 | regulation of astrocyte differentiation |
| 3. B | GO:0099056 | integral component of presynaptic membrane |
| 3. B | GO:0043395 | heparan sulfate proteoglycan binding |
| 3. B | GO:0032584 | growth cone membrane |
| 3. B | GO:0110122 | myotube cell migration |
| 3. B | GO:0060670 | branching involved in labyrinthine layer morphogenesis |
| 3. B | GO:0031432 | titin binding |
| 3. B | GO:0042059 | negative regulation of epidermal growth factor receptor signaling pathway |
| 3. B | GO:0006909 | phagocytosis |
| 3. B | GO:0031433 | telethonin binding |
| 3. B | GO:0099025 | anchored component of postsynaptic membrane |
| 3. B | GO:0072359 | circulatory system development |
| 3. B | GO:0060710 | chorio-allantoic fusion |
| 3. B | GO:0060442 | branching involved in prostate gland morphogenesis |
| 3. B | GO:0099629 | postsynaptic specialization of symmetric synapse |
| 3. B | GO:0030154 | cell differentiation |
| 3. B | GO:0051963 | regulation of synapse assembly |
| 3. B | GO:0055062 | phosphate ion homeostasis |
| 3. B | GO:0005158 | insulin receptor binding |
| 3. B | GO:0050810 | regulation of steroid biosynthetic process |
| 3. B | GO:0005604 | basement membrane |
| 3. B | GO:0060664 | epithelial cell proliferation involved in salivary gland morphogenesis |
| 3. B | GO:0007159 | leukocyte cell-cell adhesion |
| 3. B | GO:0042327 | positive regulation of phosphorylation |
| 3. B | GO:0097090 | presynaptic membrane organization |
| 3. B | GO:0016331 | morphogenesis of embryonic epithelium |
| 3. B | GO:0060501 | positive regulation of epithelial cell proliferation involved in lung morphogenesis |
| 3. B | GO:0048010 | vascular endothelial growth factor receptor signaling pathway |
| 3. B | GO:0050927 | positive regulation of positive chemotaxis |
| 3. B | GO:0008284 | positive regulation of cell population proliferation |
| 3. B | GO:0036057 | slit diaphragm |
| 3. B | GO:0031175 | neuron projection development |
| 3. B | GO:0030513 | positive regulation of BMP signaling pathway |
| 3. B | GO:0042472 | inner ear morphogenesis |
| 3. B | GO:0035603 | fibroblast growth factor receptor signaling pathway involved in hemopoiesis |
| 3. B | GO:0070640 | vitamin D3 metabolic process |
| 3. B | GO:0008039 | synaptic target recognition |
| 3. B | GO:0035602 | fibroblast growth factor receptor signaling pathway involved in negative regulation of apoptotic process in bone marrow cell |
| 3. B | GO:1904881 | cellular response to hydrogen sulfide |
| 3. B | GO:0004714 | transmembrane receptor protein tyrosine kinase activity |
| 3. B | GO:0062023 | collagen-containing extracellular matrix |
| 3. B | GO:0007224 | smoothened signaling pathway |
| 3. B | GO:0002102 | podosome |
| 3. B | GO:0031643 | positive regulation of myelination |
| 3. B | GO:0045467 | R7 cell development |
| 3. B | GO:0046658 | anchored component of plasma membrane |
| 3. B | GO:0005918 | septate junction |
| 3. B | GO:0042802 | identical protein binding |
| 3. B | GO:0010769 | regulation of cell morphogenesis involved in differentiation |
| 3. B | GO:0060529 | squamous basal epithelial stem cell differentiation involved in prostate gland acinus development |
| 3. B | GO:0032474 | otolith morphogenesis |
| 3. B | GO:0045773 | positive regulation of axon extension |
| 3. B | GO:0048738 | cardiac muscle tissue development |
| 3. B | GO:0061042 | vascular wound healing |
| 3. B | GO:0030506 | ankyrin binding |
| 3. B | GO:0045766 | positive regulation of angiogenesis |
| 3. B | GO:0017134 | fibroblast growth factor binding |
| 3. B | GO:0003222 | ventricular trabecula myocardium morphogenesis |
| 3. B | GO:0021860 | pyramidal neuron development |
| 3. B | GO:0033010 | paranodal junction |
| 3. B | GO:0007522 | visceral muscle development |
| 3. B | GO:0007169 | transmembrane receptor protein tyrosine kinase signaling pathway |
| 3. B | GO:0050775 | positive regulation of dendrite morphogenesis |
| 3. B | GO:0001779 | natural killer cell differentiation |
| 3. B | GO:0045862 | positive regulation of proteolysis |
| 3. B | GO:0071476 | cellular hypotonic response |
| 3. B | GO:0035904 | aorta development |
| 3. B | GO:0060379 | cardiac muscle cell myoblast differentiation |
| 3. B | GO:0003179 | heart valve morphogenesis |
| 3. B | GO:0005201 | extracellular matrix structural constituent |
| 3. B | GO:0030901 | midbrain development |
| 3. B | GO:0014820 | tonic smooth muscle contraction |
| 3. B | GO:0045121 | membrane raft |
| 3. B | GO:0007254 | JNK cascade |
| 3. B | GO:0036332 | placental growth factor-activated receptor activity |
| 3. B | GO:0007626 | locomotory behavior |
| 3. B | GO:0035793 | positive regulation of metanephric mesenchymal cell migration by platelet-derived growth factor receptor-beta signaling pathway |
| 3. B | GO:0060026 | convergent extension |
| 3. B | GO:0010172 | embryonic body morphogenesis |
| 3. B | GO:0007605 | sensory perception of sound |
| 3. B | GO:0038007 | netrin-activated signaling pathway |
| 3. B | GO:0030426 | growth cone |
| 3. B | GO:0048514 | blood vessel morphogenesis |
| 3. B | GO:0048804 | imaginal disc-derived female genitalia morphogenesis |
| 3. B | GO:0060365 | coronal suture morphogenesis |
| 3. B | GO:2000491 | positive regulation of hepatic stellate cell activation |
| 3. B | GO:0007525 | somatic muscle development |
| 3. B | GO:0035260 | internal genitalia morphogenesis |
| 3. B | GO:0099179 | regulation of synaptic membrane adhesion |
| 3. B | GO:0032982 | myosin filament |
| 3. B | GO:0060484 | lung-associated mesenchyme development |
| 3. B | GO:0030018 | Z disc |
| 3. B | GO:0008582 | regulation of synaptic assembly at neuromuscular junction |
| 3. B | GO:0050731 | positive regulation of peptidyl-tyrosine phosphorylation |
| 3. B | GO:0001569 | branching involved in blood vessel morphogenesis |
| 3. B | GO:0001791 | IgM binding |
| 3. B | GO:0048597 | post-embryonic camera-type eye morphogenesis |
| 3. B | GO:0099061 | integral component of postsynaptic density membrane |
| 3. B | GO:0099170 | postsynaptic modulation of chemical synaptic transmission |
| 3. B | GO:0048704 | embryonic skeletal system morphogenesis |
| 3. B | GO:0050808 | synapse organization |
| 3. B | GO:0007267 | cell-cell signaling |
| 3. B | GO:0007416 | synapse assembly |
| 3. B | GO:0005154 | epidermal growth factor receptor binding |
| 3. B | GO:0005006 | epidermal growth factor-activated receptor activity |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:0019991 | septate junction assembly |
| 3. B | GO:0030175 | filopodium |
| 3. B | GO:0070062 | extracellular exosome |
| 3. B | GO:0032060 | bleb assembly |
| 3. B | GO:0048842 | positive regulation of axon extension involved in axon guidance |
| 3. B | GO:0070977 | bone maturation |
| 3. B | GO:0060048 | cardiac muscle contraction |
| 3. B | GO:0030324 | lung development |
| 3. B | GO:0010863 | positive regulation of phospholipase C activity |
| 3. B | GO:0060916 | mesenchymal cell proliferation involved in lung development |
| 3. B | GO:0045651 | positive regulation of macrophage differentiation |
| 3. B | GO:0070100 | negative regulation of chemokine-mediated signaling pathway |
| 3. B | GO:0045296 | cadherin binding |
| 3. B | GO:0005886 | plasma membrane |
| 3. B | GO:0035418 | protein localization to synapse |
| 3. B | GO:0048378 | regulation of lateral mesodermal cell fate specification |
| 3. B | GO:0006936 | muscle contraction |
| 3. B | GO:1905606 | regulation of presynapse assembly |
| 3. B | GO:0070857 | regulation of bile acid biosynthetic process |
| 3. B | GO:0014068 | positive regulation of phosphatidylinositol 3-kinase signaling |
| 3. B | GO:0010975 | regulation of neuron projection development |
| 3. B | GO:0061343 | cell adhesion involved in heart morphogenesis |
| 3. B | GO:0005863 | striated muscle myosin thick filament |
| 3. B | GO:2001239 | regulation of extrinsic apoptotic signaling pathway in absence of ligand |
| 3. B | GO:0097453 | mesaxon |
| 3. B | GO:0032940 | secretion by cell |
| 3. B | GO:0060298 | positive regulation of sarcomere organization |
| 3. B | GO:0038130 | ERBB4 signaling pathway |
| 3. B | GO:0005055 | laminin receptor activity |
| 3. B | GO:0060077 | inhibitory synapse |
| 3. B | GO:0005042 | netrin receptor activity |
| 3. B | GO:0030282 | bone mineralization |
| 3. B | GO:0060326 | cell chemotaxis |
| 3. B | GO:0022038 | corpus callosum development |
| 3. B | GO:0004713 | protein tyrosine kinase activity |
| 3. B | GO:0060667 | branch elongation involved in salivary gland morphogenesis |
| 3. B | GO:0005176 | ErbB-2 class receptor binding |
| 3. B | GO:0055001 | muscle cell development |
| 3. B | GO:0060979 | vasculogenesis involved in coronary vascular morphogenesis |
| 3. B | GO:0007160 | cell-matrix adhesion |
| 3. B | GO:0072277 | metanephric glomerular capillary formation |
| 3. B | GO:0060060 | post-embryonic retina morphogenesis in camera-type eye |
| 3. B | GO:0060269 | centripetally migrating follicle cell migration |
| 3. B | GO:0048711 | positive regulation of astrocyte differentiation |
| 3. B | GO:0098688 | parallel fiber to Purkinje cell synapse |
| 3. B | GO:0043218 | compact myelin |
| 3. B | GO:0014816 | skeletal muscle satellite cell differentiation |
| 3. B | GO:0060249 | anatomical structure homeostasis |
| 3. B | GO:0044295 | axonal growth cone |
| 3. B | GO:1901534 | positive regulation of hematopoietic progenitor cell differentiation |
| 3. B | GO:0060512 | prostate gland morphogenesis |
| 3. B | GO:0043209 | myelin sheath |
| 3. B | GO:0044294 | dendritic growth cone |
| 3. B | GO:0032036 | myosin heavy chain binding |
| 3. B | GO:2000107 | negative regulation of leukocyte apoptotic process |
| 3. B | GO:0061298 | retina vasculature development in camera-type eye |
| 3. B | GO:0010839 | negative regulation of keratinocyte proliferation |
| 3. B | GO:0097402 | neuroblast migration |
| 3. B | GO:0071206 | establishment of protein localization to juxtaparanode region of axon |
| 3. B | GO:0030285 | integral component of synaptic vesicle membrane |
| 3. B | GO:0021794 | thalamus development |
| 3. B | GO:1901532 | regulation of hematopoietic progenitor cell differentiation |
| 3. B | GO:0061000 | negative regulation of dendritic spine development |
| 3. B | GO:0043621 | protein self-association |
| 3. B | GO:0060998 | regulation of dendritic spine development |
| 3. B | GO:0070374 | positive regulation of ERK1 and ERK2 cascade |
| 3. B | GO:0050679 | positive regulation of epithelial cell proliferation |
| 3. B | GO:0016028 | rhabdomere |
| 3. B | GO:0045163 | clustering of voltage-gated potassium channels |
| 3. B | GO:0097454 | Schwann cell microvillus |
| 3. B | GO:0055008 | cardiac muscle tissue morphogenesis |
| 3. B | GO:2000403 | positive regulation of lymphocyte migration |
| 3. B | GO:0045787 | positive regulation of cell cycle |
| 3. B | GO:0021847 | ventricular zone neuroblast division |
| 3. B | GO:0098685 | Schaffer collateral - CA1 synapse |
| 3. B | GO:0034113 | heterotypic cell-cell adhesion |
| 3. B | GO:0030335 | positive regulation of cell migration |
| 3. B | GO:0097374 | sensory neuron axon guidance |
| 3. B | GO:0003300 | cardiac muscle hypertrophy |
| 3. B | GO:0007477 | notum development |
| 3. B | GO:0042803 | protein homodimerization activity |
| 3. B | GO:0031594 | neuromuscular junction |
| 3. B | GO:0097178 | ruffle assembly |
| 3. B | GO:0051015 | actin filament binding |
| 3. B | GO:0050901 | leukocyte tethering or rolling |
| 3. B | GO:0071699 | olfactory placode morphogenesis |
| 3. B | GO:0003184 | pulmonary valve morphogenesis |
| 3. B | GO:0001759 | organ induction |
| 3. B | GO:0038085 | vascular endothelial growth factor binding |
| 3. B | GO:0032224 | positive regulation of synaptic transmission, cholinergic |
| 3. B | GO:0038084 | vascular endothelial growth factor signaling pathway |
| 3. B | GO:0007422 | peripheral nervous system development |
| 3. B | GO:0038033 | positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway |
| 3. B | GO:0043220 | Schmidt-Lanterman incisure |
| 3. B | GO:0033555 | multicellular organismal response to stress |
| 3. B | GO:0140039 | cell-cell adhesion in response to extracellular stimulus |
| 3. B | GO:0021510 | spinal cord development |
| 3. B | GO:0009308 | amine metabolic process |
| 3. B | GO:0090557 | establishment of endothelial intestinal barrier |
| 3. B | GO:0071340 | skeletal muscle acetylcholine-gated channel clustering |
| 3. B | GO:0031225 | anchored component of membrane |
| 3. B | GO:0001725 | stress fiber |
| 3. B | GO:0021836 | chemorepulsion involved in postnatal olfactory bulb interneuron migration |
| 3. B | GO:0008589 | regulation of smoothened signaling pathway |
| 3. B | GO:0036062 | presynaptic periactive zone |
| 3. B | GO:0021987 | cerebral cortex development |
| 3. B | GO:0051393 | alpha-actinin binding |
| 3. B | GO:0097443 | sorting endosome |
| 3. B | GO:0007171 | activation of transmembrane receptor protein tyrosine kinase activity |
| 3. B | GO:0007162 | negative regulation of cell adhesion |
| 3. B | GO:1905812 | regulation of motor neuron axon guidance |
| 3. B | GO:0005739 | mitochondrion |
| 3. B | GO:0032809 | neuronal cell body membrane |
| 3. B | GO:0035481 | positive regulation of Notch signaling pathway involved in heart induction |
| 3. B | GO:0098609 | cell-cell adhesion |
| 3. B | GO:0007413 | axonal fasciculation |
| 3. B | GO:0043406 | positive regulation of MAP kinase activity |
| 3. B | GO:1903010 | regulation of bone development |
| 3. B | GO:0045887 | positive regulation of synaptic assembly at neuromuscular junction |
| 3. B | GO:0001818 | negative regulation of cytokine production |
| 3. B | GO:0060414 | aorta smooth muscle tissue morphogenesis |
| 3. B | GO:0008046 | axon guidance receptor activity |
| 3. B | GO:0051930 | regulation of sensory perception of pain |
| 3. B | GO:0035441 | cell migration involved in vasculogenesis |
| 3. B | GO:0035374 | chondroitin sulfate binding |
| 3. B | GO:0021837 | motogenic signaling involved in postnatal olfactory bulb interneuron migration |
| 3. B | GO:0021769 | orbitofrontal cortex development |
| 3. B | GO:0005768 | endosome |
| 3. B | GO:1990890 | netrin receptor binding |
| 3. B | GO:0060168 | positive regulation of adenosine receptor signaling pathway |
| 3. B | GO:1904395 | positive regulation of skeletal muscle acetylcholine-gated channel clustering |
| 3. B | GO:0021682 | nerve maturation |
| 3. B | GO:0048671 | negative regulation of collateral sprouting |
| 3. B | GO:0048469 | cell maturation |
| 3. B | GO:0021628 | olfactory nerve formation |
| 3. B | GO:0001934 | positive regulation of protein phosphorylation |
| 3. B | GO:0048670 | regulation of collateral sprouting |
| 3. B | GO:0021549 | cerebellum development |
| 3. B | GO:2001223 | negative regulation of neuron migration |
| 3. B | GO:0005001 | transmembrane receptor protein tyrosine phosphatase activity |
| 3. B | GO:0048705 | skeletal system morphogenesis |
| 3. B | GO:0007399 | nervous system development |
| 3. B | GO:0008307 | structural constituent of muscle |
| 3. B | GO:0043125 | ErbB-3 class receptor binding |
| 3. B | GO:0051387 | negative regulation of neurotrophin TRK receptor signaling pathway |
| 3. B | GO:0050859 | negative regulation of B cell receptor signaling pathway |
| 3. B | GO:0090263 | positive regulation of canonical Wnt signaling pathway |
| 3. B | GO:0003416 | endochondral bone growth |
| 3. B | GO:0030517 | negative regulation of axon extension |
| 3. B | GO:1905563 | negative regulation of vascular endothelial cell proliferation |
| 3. B | GO:0038062 | protein tyrosine kinase collagen receptor activity |
| 3. B | GO:0031672 | A band |
| 3. B | GO:0060601 | lateral sprouting from an epithelium |
| 3. B | GO:0045214 | sarcomere organization |
| 3. B | GO:0043194 | axon initial segment |
| 3. B | GO:1900121 | negative regulation of receptor binding |
| 3. B | GO:0010954 | positive regulation of protein processing |
| 3. B | GO:0120034 | positive regulation of plasma membrane bounded cell projection assembly |
| 3. B | GO:0099527 | postsynapse to nucleus signaling pathway |
| 3. B | GO:0003149 | membranous septum morphogenesis |
| 3. B | GO:0035633 | maintenance of blood-brain barrier |
| 3. B | GO:0046777 | protein autophosphorylation |
| 3. B | GO:0009897 | external side of plasma membrane |
| 3. B | GO:0033270 | paranode region of axon |
| 3. B | GO:0033564 | anterior/posterior axon guidance |
| 3. B | GO:0048640 | negative regulation of developmental growth |
| 3. B | GO:0071670 | smooth muscle cell chemotaxis |
| 3. B | GO:0048170 | positive regulation of long-term neuronal synaptic plasticity |
| 3. B | GO:0001960 | negative regulation of cytokine-mediated signaling pathway |
| 3. B | GO:0045446 | endothelial cell differentiation |
| 3. B | GO:0060384 | innervation |
| 3. B | GO:0072262 | metanephric glomerular mesangial cell proliferation involved in metanephros development |
| 3. B | GO:0048661 | positive regulation of smooth muscle cell proliferation |
| 3. B | GO:0034164 | negative regulation of toll-like receptor 9 signaling pathway |
| 3. B | GO:0072499 | photoreceptor cell axon guidance |
| 3. B | GO:0060437 | lung growth |
| 3. B | GO:0034109 | homotypic cell-cell adhesion |
| 3. B | GO:0070371 | ERK1 and ERK2 cascade |
| 3. B | GO:0043235 | receptor complex |
| 3. B | GO:0005520 | insulin-like growth factor binding |
| 3. B | GO:0002042 | cell migration involved in sprouting angiogenesis |
| 3. B | GO:0035265 | organ growth |
| 3. B | GO:0060956 | endocardial cell differentiation |
| 3. B | GO:0042383 | sarcolemma |
| 3. B | GO:0098742 | cell-cell adhesion via plasma-membrane adhesion molecules |
| 3. B | GO:0030888 | regulation of B cell proliferation |
| 3. B | GO:0050931 | pigment cell differentiation |
| 3. B | GO:0048813 | dendrite morphogenesis |
| 3. B | GO:0071205 | protein localization to juxtaparanode region of axon |
| 3. B | GO:0035789 | metanephric mesenchymal cell migration |
| 3. B | GO:0035310 | notum cell fate specification |
| 3. B | GO:0036379 | myofilament |
| 3. B | GO:1905576 | ganglioside GT1b binding |
| 3. B | GO:0051897 | positive regulation of protein kinase B signaling |
| 3. B | GO:0030916 | otic vesicle formation |
| 3. B | GO:0035607 | fibroblast growth factor receptor signaling pathway involved in orbitofrontal cortex development |
| 3. B | GO:0045165 | cell fate commitment |
| 3. B | GO:1903386 | negative regulation of homophilic cell adhesion |
| 3. B | GO:1905564 | positive regulation of vascular endothelial cell proliferation |
| 3. B | GO:1990384 | hyaloid vascular plexus regression |
| 3. B | GO:0060976 | coronary vasculature development |
| 3. B | GO:1990393 | 3M complex |
| 3. B | GO:0048562 | embryonic organ morphogenesis |
| 3. B | GO:0010518 | positive regulation of phospholipase activity |
| 3. B | GO:0001928 | regulation of exocyst assembly |
| 3. B | GO:0003180 | aortic valve morphogenesis |
| 3. B | GO:0060915 | mesenchymal cell differentiation involved in lung development |
| 3. B | GO:0060688 | regulation of morphogenesis of a branching structure |
| 3. B | GO:0099175 | regulation of postsynapse organization |
| 3. B | GO:0060665 | regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling |
| 3. B | GO:0003157 | endocardium development |
| 3. B | GO:0051964 | negative regulation of synapse assembly |
| 3. B | GO:0003382 | epithelial cell morphogenesis |
| 3. B | GO:0005019 | platelet-derived growth factor beta-receptor activity |
| 3. B | GO:2000541 | positive regulation of protein geranylgeranylation |
| 3. B | GO:2000830 | positive regulation of parathyroid hormone secretion |
| 3. B | GO:0060045 | positive regulation of cardiac muscle cell proliferation |
| 3. B | GO:0060527 | prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis |
| 3. B | GO:0043236 | laminin binding |
| 3. B | GO:0003334 | keratinocyte development |
| 3. B | GO:0005102 | signaling receptor binding |
| 3. B | GO:1903977 | positive regulation of glial cell migration |
| 3. B | GO:0021799 | cerebral cortex radially oriented cell migration |
| 3. B | GO:0045162 | clustering of voltage-gated sodium channels |
| 3. B | GO:0060117 | auditory receptor cell development |
| 3. B | GO:0030538 | embryonic genitalia morphogenesis |
| 3. B | GO:1905517 | macrophage migration |
| 3. B | GO:0010625 | positive regulation of Schwann cell proliferation |
| 3. B | GO:0097628 | distal tip cell migration |
| 3. B | GO:0030027 | lamellipodium |
| 3. B | GO:1902036 | regulation of hematopoietic stem cell differentiation |
| 3. B | GO:0048286 | lung alveolus development |
| 3. B | GO:0033268 | node of Ranvier |
| 3. B | GO:0035909 | aorta morphogenesis |
| 3. B | GO:0097512 | cardiac myofibril |
| 3. B | GO:0008201 | heparin binding |
| 3. B | GO:0031103 | axon regeneration |
| 3. B | GO:0072275 | metanephric glomerulus morphogenesis |
| 3. B | GO:0050807 | regulation of synapse organization |
| 3. B | GO:0099055 | integral component of postsynaptic membrane |
| 3. B | GO:0008092 | cytoskeletal protein binding |
| 3. B | GO:0043525 | positive regulation of neuron apoptotic process |
| 3. B | GO:0086080 | protein binding involved in heterotypic cell-cell adhesion |
| 3. B | GO:0032687 | negative regulation of interferon-alpha production |
| 3. B | GO:0033674 | positive regulation of kinase activity |
| 3. B | GO:1900748 | positive regulation of vascular endothelial growth factor signaling pathway |
| 3. B | GO:0002074 | extraocular skeletal muscle development |
| 3. B | GO:0035749 | myelin sheath adaxonal region |
| 3. B | GO:0036323 | vascular endothelial growth factor receptor-1 signaling pathway |
| 3. B | GO:0110011 | regulation of basement membrane organization |
| 3. B | GO:1901214 | regulation of neuron death |
| 3. B | GO:0003281 | ventricular septum development |
| 3. B | GO:0071679 | commissural neuron axon guidance |
| 3. B | GO:0090736 | MATH domain binding |
| 3. B | GO:0030673 | axolemma |
| 3. B | GO:0061564 | axon development |
| 3. B | GO:0016338 | calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules |
| 3. B | GO:0045989 | positive regulation of striated muscle contraction |
| 3. B | GO:0031345 | negative regulation of cell projection organization |
| 3. B | GO:0060349 | bone morphogenesis |
| 3. B | GO:0060445 | branching involved in salivary gland morphogenesis |
| 3. B | GO:0097482 | muscle cell postsynaptic specialization |
| 3. B | GO:0030537 | larval behavior |
| 3. B | GO:0097708 | intracellular vesicle |
| 3. B | GO:0001525 | angiogenesis |
| 3. B | GO:0050714 | positive regulation of protein secretion |
| 3. B | GO:0051894 | positive regulation of focal adhesion assembly |
| 3. B | GO:0055010 | ventricular cardiac muscle tissue morphogenesis |
| 3. B | GO:0098982 | GABA-ergic synapse |
| 3. B | GO:0005794 | Golgi apparatus |
| 3. B | GO:0060068 | vagina development |
| 3. B | GO:0005925 | focal adhesion |
| 3. B | GO:0048679 | regulation of axon regeneration |
| 3. B | GO:2000514 | regulation of CD4-positive, alpha-beta T cell activation |
| 3. B | GO:0048755 | branching morphogenesis of a nerve |
| 3. B | GO:0021965 | spinal cord ventral commissure morphogenesis |
| 3. B | GO:0031102 | neuron projection regeneration |
| 3. B | GO:0010628 | positive regulation of gene expression |
| 3. B | GO:0007088 | regulation of mitotic nuclear division |
| 3. B | GO:0046872 | metal ion binding |
| 3. B | GO:0097151 | positive regulation of inhibitory postsynaptic potential |
| 3. B | GO:0099026 | anchored component of presynaptic membrane |
| 3. B | GO:0099151 | regulation of postsynaptic density assembly |
| 3. B | GO:0045202 | synapse |
| 3. B | GO:0003779 | actin binding |
| 3. B | GO:0045213 | neurotransmitter receptor metabolic process |
| 3. B | GO:0017022 | myosin binding |
| 3. B | GO:0007528 | neuromuscular junction development |
| 3. B | GO:0021781 | glial cell fate commitment |
| 3. B | GO:0001933 | negative regulation of protein phosphorylation |
| 3. B | GO:0021842 | chemorepulsion involved in interneuron migration from the subpallium to the cortex |
| 3. B | GO:0035995 | detection of muscle stretch |
| 3. B | GO:0010842 | retina layer formation |
| 3. B | GO:0007628 | adult walking behavior |
| 3. B | GO:0070307 | lens fiber cell development |
| 3. B | GO:1905489 | regulation of sensory neuron axon guidance |
| 3. B | GO:1904929 | coreceptor activity involved in Wnt signaling pathway, planar cell polarity pathway |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | A0A087WV53 | SPEG neighbor protein | 0 | 8.67e-171 | 8.13e-176 |
| 1. PB | G5EEY6 | Zwei Ig domain protein zig-3 | 1.58e-08 | 7.79e-05 | 0.008 |
| 1. PB | P05548 | CAVP-target protein | 1.44e-11 | 7.53e-49 | 1.81e-58 |
| 2. P | G5ECB1 | Zwei Ig domain protein zig-4 | 7.89e-10 | 3.49e-04 | NA |
| 2. P | Q18066 | Disorganized muscle protein 1 | 4.91e-05 | 1.41e-03 | NA |
| 3. B | Q6UXM1 | Leucine-rich repeats and immunoglobulin-like domains protein 3 | 3.92e-04 | NA | 4.19e-15 |
| 3. B | P35968 | Vascular endothelial growth factor receptor 2 | 6.41e-03 | NA | 0.004 |
| 3. B | P70193 | Leucine-rich repeats and immunoglobulin-like domains protein 1 | 7.23e-03 | NA | 1.18e-13 |
| 3. B | Q07409 | Contactin-3 | 2.64e-03 | NA | 4.14e-10 |
| 3. B | O42414 | Neurofascin | 1.49e-02 | NA | 9.54e-10 |
| 3. B | P50895 | Basal cell adhesion molecule | 5.17e-04 | NA | 0.003 |
| 3. B | P28685 | Contactin-2 | 3.98e-04 | NA | 1.25e-04 |
| 3. B | Q8IVU1 | Immunoglobulin superfamily DCC subclass member 3 | 6.32e-05 | NA | 2.05e-13 |
| 3. B | Q52KR2 | Leucine-rich repeats and immunoglobulin-like domains protein 2 | 5.89e-04 | NA | 1.76e-15 |
| 3. B | G5EGI7 | Zwei Ig domain protein zig-1 | 9.67e-06 | NA | 0.037 |
| 3. B | Q7ZW34 | Contactin-5 | 4.39e-04 | NA | 1.10e-09 |
| 3. B | P16621 | Tyrosine-protein phosphatase Lar | 3.62e-02 | NA | 4.20e-09 |
| 3. B | P23468 | Receptor-type tyrosine-protein phosphatase delta | 1.76e-02 | NA | 4.68e-06 |
| 3. B | Q58DA5 | Neurotrimin | 1.22e-06 | NA | 0.009 |
| 3. B | Q290N5 | Tyrosine-protein kinase-like otk | 2.83e-03 | NA | 1.56e-07 |
| 3. B | Q9R069 | Basal cell adhesion molecule | 3.88e-04 | NA | 0.008 |
| 3. B | Q9P232 | Contactin-3 | 1.69e-03 | NA | 1.20e-09 |
| 3. B | B3MH43 | Tyrosine-protein kinase-like otk | 5.71e-03 | NA | 9.88e-07 |
| 3. B | Q98902 | Neural cell adhesion molecule L1 | 7.02e-03 | NA | 0.002 |
| 3. B | Q9EQS9 | Immunoglobulin superfamily DCC subclass member 4 | 3.92e-03 | NA | 5.74e-07 |
| 3. B | P20916 | Myelin-associated glycoprotein | 6.88e-05 | NA | 5.18e-04 |
| 3. B | Q5VTT5 | Myomesin-3 | 1.30e-03 | NA | 4.28e-08 |
| 3. B | Q07407 | Fibroblast growth factor receptor homolog 1 | 2.35e-03 | NA | 0.021 |
| 3. B | Q967D7 | Protein turtle | 4.09e-03 | NA | 9.08e-09 |
| 3. B | Q8QHL3 | Vascular endothelial growth factor receptor 1 | 3.65e-03 | NA | 4.01e-06 |
| 3. B | Q8N6G6 | ADAMTS-like protein 1 | 7.77e-02 | NA | 0.009 |
| 3. B | Q62407 | Striated muscle-specific serine/threonine-protein kinase | NA | NA | 4.13e-13 |
| 3. B | O88599 | Myosin-binding protein H | 1.92e-05 | NA | 9.66e-06 |
| 3. B | P36335 | Neural cell adhesion molecule 1-B | 1.58e-03 | NA | 2.67e-09 |
| 3. B | B4MR28 | Tyrosine-protein kinase-like otk | 2.77e-03 | NA | 1.89e-08 |
| 3. B | Q0WYX8 | MAM domain-containing glycosylphosphatidylinositol anchor protein 1 | 1.05e-04 | NA | 0.002 |
| 3. B | Q9Z2J4 | Nexilin | 5.92e-03 | NA | 0.004 |
| 3. B | Q3UQ28 | Peroxidasin homolog | 7.42e-04 | NA | 1.69e-11 |
| 3. B | Q6P1C6 | Leucine-rich repeats and immunoglobulin-like domains protein 3 | 6.98e-04 | NA | 1.25e-14 |
| 3. B | Q96NZ8 | WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 | 3.70e-02 | NA | 0.013 |
| 3. B | Q6MZW2 | Follistatin-related protein 4 | 1.47e-05 | NA | 4.81e-05 |
| 3. B | Q7TQM3 | Fibroblast growth factor receptor-like 1 | 5.10e-05 | NA | 1.61e-10 |
| 3. B | Q589G5 | Protogenin | 2.72e-04 | NA | 3.31e-07 |
| 3. B | P22607 | Fibroblast growth factor receptor 3 | 7.59e-03 | NA | 9.01e-07 |
| 3. B | Q61851 | Fibroblast growth factor receptor 3 | 3.70e-03 | NA | 4.81e-07 |
| 3. B | Q6AZB0 | Brother of CDO | 1.67e-04 | NA | 5.12e-08 |
| 3. B | Q63198 | Contactin-1 | 1.82e-03 | NA | 3.44e-06 |
| 3. B | Q3V1M1 | Immunoglobulin superfamily member 10 | 6.70e-02 | NA | 4.39e-09 |
| 3. B | Q9UPX0 | Protein turtle homolog B | 8.96e-04 | NA | 7.29e-07 |
| 3. B | Q9Z2I4 | Roundabout homolog 3 | 2.41e-04 | NA | 1.06e-07 |
| 3. B | Q90W79 | Contactin-5 | 5.98e-04 | NA | 1.11e-09 |
| 3. B | Q9I8X3 | Fibroblast growth factor receptor 3 | 1.95e-03 | NA | 3.94e-05 |
| 3. B | P16170 | Neural cell adhesion molecule 1-A | 1.57e-03 | NA | 2.62e-08 |
| 3. B | P18460 | Fibroblast growth factor receptor 3 | 1.74e-03 | NA | 1.76e-05 |
| 3. B | A4IGL7 | Peroxidasin | 9.38e-03 | NA | 6.36e-11 |
| 3. B | Q1WIM2 | Cell adhesion molecule 2 | 3.90e-04 | NA | 1.23e-06 |
| 3. B | O15146 | Muscle, skeletal receptor tyrosine-protein kinase | 1.46e-08 | NA | 1.10e-11 |
| 3. B | P56974 | Pro-neuregulin-2, membrane-bound isoform | 3.88e-02 | NA | 0.012 |
| 3. B | Q9VN14 | Contactin | 1.90e-02 | NA | 2.08e-05 |
| 3. B | O00533 | Neural cell adhesion molecule L1-like protein | 1.74e-03 | NA | 1.36e-08 |
| 3. B | Q62845 | Contactin-4 | 8.94e-04 | NA | 2.77e-09 |
| 3. B | Q02246 | Contactin-2 | 1.27e-03 | NA | 1.06e-05 |
| 3. B | Q8N441 | Fibroblast growth factor receptor-like 1 | 1.48e-06 | NA | 3.73e-11 |
| 3. B | Q6X936 | Kin of IRRE-like protein 1 | 2.01e-03 | NA | 8.76e-06 |
| 3. B | Q05030 | Platelet-derived growth factor receptor beta | 4.74e-05 | NA | 0.001 |
| 3. B | Q91V87 | Fibroblast growth factor receptor-like 1 | 1.11e-04 | NA | 1.25e-10 |
| 3. B | P13590 | Neural cell adhesion molecule 1 | 2.39e-03 | NA | 5.80e-10 |
| 3. B | Q8BLQ9 | Cell adhesion molecule 2 | 2.21e-05 | NA | 1.08e-06 |
| 3. B | P53767 | Vascular endothelial growth factor receptor 1 | 2.05e-02 | NA | 6.49e-08 |
| 3. B | Q91287 | Fibroblast growth factor receptor 3 | 4.50e-03 | NA | 8.66e-04 |
| 3. B | P97603 | Neogenin (Fragment) | 4.11e-04 | NA | 4.39e-11 |
| 3. B | D3YXG0 | Hemicentin-1 | NA | NA | 5.33e-15 |
| 3. B | Q64604 | Receptor-type tyrosine-protein phosphatase F | 2.71e-02 | NA | 3.41e-07 |
| 3. B | P20241 | Neuroglian | 1.72e-03 | NA | 2.44e-11 |
| 3. B | B4HNW4 | Tyrosine-protein kinase-like otk | 1.93e-02 | NA | 5.45e-08 |
| 3. B | B3NS99 | Tyrosine-protein kinase-like otk | 3.31e-03 | NA | 1.17e-07 |
| 3. B | Q8WX93 | Palladin | 3.81e-03 | NA | 8.60e-18 |
| 3. B | Q61006 | Muscle, skeletal receptor tyrosine-protein kinase | 3.24e-08 | NA | 1.90e-11 |
| 3. B | Q8AV58 | Protein sidekick-1 | 5.93e-02 | NA | 8.75e-11 |
| 3. B | Q90Z04 | Cell adhesion molecule-related/down-regulated by oncogenes | 1.25e-03 | NA | 1.39e-06 |
| 3. B | Q8BLK3 | Limbic system-associated membrane protein | 2.23e-07 | NA | 9.43e-07 |
| 3. B | P35918 | Vascular endothelial growth factor receptor 2 | 7.19e-03 | NA | 3.06e-05 |
| 3. B | Q9ERC8 | Down syndrome cell adhesion molecule homolog | 1.96e-02 | NA | 5.45e-11 |
| 3. B | P22063 | Contactin-2 | 2.06e-03 | NA | 4.84e-06 |
| 3. B | P0C5E3 | Palladin (Fragment) | 1.05e-07 | NA | 8.29e-17 |
| 3. B | P21802 | Fibroblast growth factor receptor 2 | 2.95e-04 | NA | 2.72e-05 |
| 3. B | P35331 | Neuronal cell adhesion molecule | 8.15e-03 | NA | 5.24e-09 |
| 3. B | Q02173 | M-protein, striated muscle | 1.38e-03 | NA | 5.55e-08 |
| 3. B | Q8AXY6 | Muscle, skeletal receptor tyrosine protein kinase | 6.65e-06 | NA | 1.44e-09 |
| 3. B | Q98892 | Opioid-binding protein/cell adhesion molecule homolog | 5.09e-08 | NA | 0.001 |
| 3. B | O35136 | Neural cell adhesion molecule 2 | 1.35e-04 | NA | 1.23e-13 |
| 3. B | Q7T2H2 | Fibroblast growth factor receptor-like 1 | 1.00e-06 | NA | 1.88e-09 |
| 3. B | Q90773 | Protein CEPU-1 | 2.32e-06 | NA | 5.02e-05 |
| 3. B | P70211 | Netrin receptor DCC | 3.52e-04 | NA | 1.02e-11 |
| 3. B | Q7Z553 | MAM domain-containing glycosylphosphatidylinositol anchor protein 2 | 2.10e-03 | NA | 4.21e-05 |
| 3. B | Q8N475 | Follistatin-related protein 5 | 1.03e-05 | NA | 9.12e-05 |
| 3. B | Q810U3 | Neurofascin | 3.86e-05 | NA | 1.57e-12 |
| 3. B | Q2VWP7 | Protogenin | 2.11e-04 | NA | 1.65e-07 |
| 3. B | Q8NDA2 | Hemicentin-2 | NA | NA | 7.72e-16 |
| 3. B | Q13332 | Receptor-type tyrosine-protein phosphatase S | 2.49e-02 | NA | 1.73e-07 |
| 3. B | P21803 | Fibroblast growth factor receptor 2 | 2.90e-04 | NA | 8.91e-05 |
| 3. B | Q32MD9 | Cell adhesion molecule-related/down-regulated by oncogenes | 5.38e-05 | NA | 5.35e-14 |
| 3. B | Q99PJ0 | Neurotrimin | 1.61e-06 | NA | 0.003 |
| 3. B | A0JM20 | Tyrosine-protein kinase receptor TYRO3 | 3.65e-04 | NA | 0.017 |
| 3. B | D3ZB51 | Protein turtle homolog B | 7.53e-04 | NA | 1.03e-06 |
| 3. B | G4SLH0 | Titin homolog | NA | NA | 2.22e-14 |
| 3. B | Q13449 | Limbic system-associated membrane protein | 2.07e-07 | NA | 5.51e-07 |
| 3. B | Q69Z26 | Contactin-4 | 3.27e-04 | NA | 2.57e-09 |
| 3. B | Q04589 | Fibroblast growth factor receptor 1 | 6.27e-04 | NA | 1.67e-09 |
| 3. B | Q9JIF9 | Myotilin | 1.57e-09 | NA | 5.34e-11 |
| 3. B | F1NWE3 | Receptor-type tyrosine-protein phosphatase S | 2.88e-03 | NA | 6.68e-06 |
| 3. B | G5EG78 | Peroxidasin homolog pxn-2 | 1.14e-02 | NA | 4.00e-07 |
| 3. B | B8VIW9 | Fibronectin type III domain-containing protein | 3.44e-03 | NA | 4.07e-06 |
| 3. B | Q5MD89 | Vascular endothelial growth factor receptor 3 | 5.67e-03 | NA | 4.18e-05 |
| 3. B | G5EF96 | Netrin receptor unc-40 | 1.33e-03 | NA | 5.27e-05 |
| 3. B | Q7TPD3 | Roundabout homolog 2 | 7.11e-03 | NA | 3.63e-08 |
| 3. B | Q62813 | Limbic system-associated membrane protein | 4.68e-07 | NA | 9.81e-07 |
| 3. B | A2A8L5 | Receptor-type tyrosine-protein phosphatase F | 7.19e-02 | NA | 2.92e-07 |
| 3. B | Q9Y753 | Squalene synthase | 9.95e-01 | NA | 0.025 |
| 3. B | Q0PMG2 | MAM domain-containing glycosylphosphatidylinositol anchor protein 1 | 1.01e-04 | NA | 0.005 |
| 3. B | O35569 | Pro-neuregulin-2, membrane-bound isoform | 2.66e-02 | NA | 0.009 |
| 3. B | Q6UWL6 | Kin of IRRE-like protein 2 | 8.94e-05 | NA | 0.001 |
| 3. B | Q91147 | Fibroblast growth factor receptor 2 | 6.28e-04 | NA | 1.30e-05 |
| 3. B | Q92154 | Schwann cell myelin protein | 5.18e-06 | NA | 0.003 |
| 3. B | Q80Z24 | Neuronal growth regulator 1 | 9.80e-07 | NA | 5.34e-04 |
| 3. B | Q7TSU7 | Kin of IRRE-like protein 2 | 2.61e-03 | NA | 2.40e-05 |
| 3. B | D3YYU8 | Obscurin-like protein 1 | 2.44e-04 | NA | 5.36e-08 |
| 3. B | E1C8P7 | Down syndrome cell adhesion molecule-like protein 1 homolog | 1.26e-02 | NA | 3.32e-13 |
| 3. B | Q92626 | Peroxidasin homolog | 7.07e-03 | NA | 1.10e-12 |
| 3. B | Q5DTJ9 | Myopalladin | 3.44e-04 | NA | 6.37e-16 |
| 3. B | P11362 | Fibroblast growth factor receptor 1 | 3.50e-03 | NA | 5.55e-10 |
| 3. B | Q91288 | Fibroblast growth factor receptor 4 | 1.18e-03 | NA | 9.18e-08 |
| 3. B | O01761 | Muscle M-line assembly protein unc-89 | NA | NA | 5.46e-18 |
| 3. B | Q1HLC0 | Hemolin | 1.63e-06 | NA | 1.67e-06 |
| 3. B | Q80W87 | Roundabout homolog 4 | 1.37e-03 | NA | 9.34e-09 |
| 3. B | Q95YM9 | Fibroblast growth factor receptor | 2.04e-03 | NA | 1.11e-04 |
| 3. B | Q8WZ42 | Titin | NA | NA | 4.78e-21 |
| 3. B | Q08E66 | WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2 | 4.85e-02 | NA | 0.040 |
| 3. B | P22455 | Fibroblast growth factor receptor 4 | 4.72e-04 | NA | 6.54e-08 |
| 3. B | A2AAJ9 | Obscurin | NA | NA | 1.97e-20 |
| 3. B | Q965M2 | Leucine-rich repeats and immunoglobulin-like domains protein sma-10 | 8.80e-07 | NA | 0.001 |
| 3. B | Q12860 | Contactin-1 | 4.46e-05 | NA | 3.53e-06 |
| 3. B | B0V2N1 | Receptor-type tyrosine-protein phosphatase S | 3.38e-03 | NA | 1.82e-06 |
| 3. B | O02827 | Myosin light chain kinase, smooth muscle (Fragment) | NA | NA | 2.96e-09 |
| 3. B | Q1ENI8 | Peroxidasin homolog pxn-1 | 5.10e-03 | NA | 1.25e-10 |
| 3. B | Q60ZN5 | Protein sidekick homolog | 1.51e-01 | NA | 0.005 |
| 3. B | Q01974 | Tyrosine-protein kinase transmembrane receptor ROR2 | 1.09e-01 | NA | 0.003 |
| 3. B | Q8VHZ8 | Down syndrome cell adhesion molecule homolog | 2.29e-02 | NA | 5.55e-11 |
| 3. B | O94779 | Contactin-5 | 5.62e-04 | NA | 4.23e-10 |
| 3. B | B4GBH0 | Tyrosine-protein kinase-like otk | 3.38e-03 | NA | 1.28e-07 |
| 3. B | Q6PDN3 | Myosin light chain kinase, smooth muscle | 5.14e-03 | NA | 1.11e-16 |
| 3. B | Q3UH53 | Protein sidekick-1 | 1.23e-02 | NA | 7.18e-05 |
| 3. B | P52179 | Myomesin-1 | 3.44e-02 | NA | 7.00e-06 |
| 3. B | Q90688 | Myosin-binding protein C, cardiac-type | 1.13e-03 | NA | 7.04e-07 |
| 3. B | G5EBF1 | Protein sax-3 | 6.07e-05 | NA | 2.70e-11 |
| 3. B | P16419 | Myosin-binding protein C, fast-type | 2.56e-03 | NA | 9.39e-07 |
| 3. B | P56741 | Myosin-binding protein C, cardiac-type | 7.86e-04 | NA | 2.02e-05 |
| 3. B | P22648 | Fasciclin-2 | 3.49e-03 | NA | 2.52e-05 |
| 3. B | Q90233 | Myosin-binding protein C, cardiac-type (Fragment) | 8.07e-05 | NA | 0.001 |
| 3. B | P60756 | MAM domain-containing glycosylphosphatidylinositol anchor protein 2 | 2.04e-03 | NA | 2.90e-05 |
| 3. B | Q5R412 | Neuronal growth regulator 1 | 1.70e-05 | NA | 0.003 |
| 3. B | P97528 | Contactin-6 | 6.03e-04 | NA | 1.91e-07 |
| 3. B | P22182 | Fibroblast growth factor receptor 1 | 1.73e-03 | NA | 5.45e-08 |
| 3. B | Q9Y6N7 | Roundabout homolog 1 | 1.71e-03 | NA | 3.15e-09 |
| 3. B | Q90413 | Fibroblast growth factor receptor 4 | 8.85e-03 | NA | 6.11e-07 |
| 3. B | Q9NR99 | Matrix-remodeling-associated protein 5 | NA | NA | 8.71e-07 |
| 3. B | P52583 | Vascular endothelial growth factor receptor 2 | 3.62e-02 | NA | 1.36e-04 |
| 3. B | Q2EY13 | Protogenin B (Fragment) | 1.30e-03 | NA | 8.43e-06 |
| 3. B | P16092 | Fibroblast growth factor receptor 1 | 4.94e-04 | NA | 5.76e-10 |
| 3. B | Q9N1E4 | B-cell receptor CD22 (Fragment) | 4.04e-04 | NA | 0.041 |
| 3. B | Q28260 | Vascular cell adhesion protein 1 | 2.81e-03 | NA | 0.008 |
| 3. B | Q96MS0 | Roundabout homolog 3 | 1.79e-04 | NA | 1.96e-08 |
| 3. B | A2AJ76 | Hemicentin-2 | NA | NA | 3.82e-15 |
| 3. B | A2ASS6 | Titin | NA | NA | 9.77e-20 |
| 3. B | Q28824 | Myosin light chain kinase, smooth muscle | 2.70e-04 | NA | 3.39e-10 |
| 3. B | P31836 | Neural cell adhesion molecule 1 | 3.13e-04 | NA | 2.45e-12 |
| 3. B | Q62682 | Contactin-3 | 1.02e-03 | NA | 2.75e-09 |
| 3. B | Q9BWV1 | Brother of CDO | 6.58e-04 | NA | 2.20e-06 |
| 3. B | Q8N9C0 | Immunoglobulin superfamily member 22 | 2.39e-04 | NA | 1.72e-05 |
| 3. B | Q91285 | Fibroblast growth factor receptor 1 | 4.72e-04 | NA | 3.83e-06 |
| 3. B | P21804 | Fibroblast growth factor receptor 1 | 3.40e-04 | NA | 2.58e-09 |
| 3. B | Q8C310 | Roundabout homolog 4 | 2.94e-04 | NA | 2.13e-10 |
| 3. B | A4IFW2 | Receptor-type tyrosine-protein phosphatase F | 6.07e-03 | NA | 2.38e-07 |
| 3. B | Q14324 | Myosin-binding protein C, fast-type | 8.74e-03 | NA | 1.46e-07 |
| 3. B | B4QC63 | Tyrosine-protein kinase-like otk | 3.04e-03 | NA | 4.65e-08 |
| 3. B | O95428 | Papilin | 3.50e-03 | NA | 0.003 |
| 3. B | Q5XKE0 | Myosin-binding protein C, fast-type | 1.02e-02 | NA | 6.87e-07 |
| 3. B | Q90478 | Neural cell adhesion molecule L1.1 (Fragment) | 8.91e-03 | NA | 0.008 |
| 3. B | B4KPU0 | Tyrosine-protein kinase-like otk | 5.92e-03 | NA | 5.74e-09 |
| 3. B | Q92859 | Neogenin | 1.45e-03 | NA | 6.56e-08 |
| 3. B | Q9HCK4 | Roundabout homolog 2 | 5.43e-03 | NA | 2.81e-09 |
| 3. B | Q5GIT4 | Vascular endothelial growth factor receptor 2 | 1.59e-02 | NA | 2.80e-05 |
| 3. B | P85171 | MAM domain-containing glycosylphosphatidylinositol anchor protein 1 | 1.05e-04 | NA | 0.005 |
| 3. B | A7MBJ4 | Receptor-type tyrosine-protein phosphatase F | 2.10e-02 | NA | 2.53e-06 |
| 3. B | Q9ESS6 | Basal cell adhesion molecule | 1.02e-03 | NA | 0.007 |
| 3. B | O42127 | Fibroblast growth factor receptor 3 | 1.91e-03 | NA | 2.13e-05 |
| 3. B | Q6WRH9 | Immunoglobulin superfamily member 10 | 7.97e-02 | NA | 1.59e-08 |
| 3. B | P56276 | Telokin | 6.94e-08 | NA | 1.49e-08 |
| 3. B | Q8TDY8 | Immunoglobulin superfamily DCC subclass member 4 | 8.72e-04 | NA | 4.83e-08 |
| 3. B | Q2EY14 | Protogenin A | 9.80e-05 | NA | 2.15e-09 |
| 3. B | Q9Z138 | Tyrosine-protein kinase transmembrane receptor ROR2 | 1.32e-01 | NA | 0.002 |
| 3. B | P0C5H6 | Protein turtle homolog A | 2.67e-04 | NA | 6.43e-05 |
| 3. B | Q3KNY0 | Immunoglobulin-like and fibronectin type III domain-containing protein 1 | NA | NA | 2.67e-06 |
| 3. B | Q60805 | Tyrosine-protein kinase Mer | 2.31e-02 | NA | 0.031 |
| 3. B | O89026 | Roundabout homolog 1 | 9.31e-04 | NA | 7.24e-09 |
| 3. B | Q28106 | Contactin-1 | 2.66e-03 | NA | 7.77e-06 |
| 3. B | P43146 | Netrin receptor DCC | 2.89e-04 | NA | 1.42e-11 |
| 3. B | Q1WIM3 | Cell adhesion molecule 3 | 2.74e-04 | NA | 0.043 |
| 3. B | Q8WZ75 | Roundabout homolog 4 | 3.13e-02 | NA | 2.54e-07 |
| 3. B | Q98919 | Limbic system-associated membrane protein | 3.80e-07 | NA | 2.46e-06 |
| 3. B | Q86TC9 | Myopalladin | 5.42e-04 | NA | 1.61e-15 |
| 3. B | P70402 | Myosin-binding protein H | 1.62e-05 | NA | 3.14e-06 |
| 3. B | Q23551 | Twitchin | NA | NA | 5.85e-20 |
| 3. B | Q98949 | Tyrosine-protein kinase receptor TYRO3 | 7.82e-03 | NA | 0.023 |
| 3. B | O97394 | Protein sidekick | 8.23e-03 | NA | 4.08e-07 |
| 3. B | P05622 | Platelet-derived growth factor receptor beta | 4.16e-05 | NA | 0.006 |
| 3. B | P11799 | Myosin light chain kinase, smooth muscle | 4.19e-03 | NA | 1.53e-14 |
| 3. B | P35969 | Vascular endothelial growth factor receptor 1 | 1.31e-02 | NA | 1.76e-06 |
| 3. B | Q8N3J6 | Cell adhesion molecule 2 | 2.25e-04 | NA | 1.37e-06 |
| 3. B | A8WQH2 | Peroxidasin homolog | NA | NA | 1.29e-10 |
| 3. B | B3N666 | Interference hedgehog | 5.35e-04 | NA | 0.022 |
| 3. B | G5ED00 | Zwei Ig domain protein zig-8 | 1.85e-06 | NA | 6.45e-04 |
| 3. B | Q9U3P2 | Synaptogenesis protein syg-2 | 5.67e-04 | NA | 4.89e-05 |
| 3. B | Q8BLI0 | ADAMTS-like protein 1 | 6.28e-02 | NA | 0.013 |
| 3. B | P29534 | Vascular cell adhesion protein 1 | 6.95e-03 | NA | 0.013 |
| 3. B | P57087 | Junctional adhesion molecule B | 3.13e-07 | NA | 0.044 |
| 3. B | A1KZ92 | Peroxidasin-like protein | 7.26e-04 | NA | 2.89e-12 |
| 3. B | Q696W0 | Striated muscle preferentially expressed protein kinase | NA | NA | 2.09e-06 |
| 3. B | Q6AWJ9 | Tyrosine-protein kinase-like otk | 2.85e-03 | NA | 2.46e-08 |
| 3. B | O55005 | Roundabout homolog 1 | 9.31e-04 | NA | 3.42e-09 |
| 3. B | Q63518 | Myosin-binding protein C, slow-type (Fragment) | 4.39e-06 | NA | 1.96e-05 |
| 3. B | Q9UBF9 | Myotilin | 5.36e-08 | NA | 3.42e-12 |
| 3. B | Q12866 | Tyrosine-protein kinase Mer | 1.79e-02 | NA | 3.87e-04 |
| 3. B | Q8HW98 | IgLON family member 5 | 5.69e-06 | NA | 7.70e-05 |
| 3. B | Q13203 | Myosin-binding protein H | 7.90e-06 | NA | 1.11e-06 |
| 3. B | P32736 | Opioid-binding protein/cell adhesion molecule | 2.08e-06 | NA | 5.67e-04 |
| 3. B | Q03142 | Fibroblast growth factor receptor 4 | 2.60e-03 | NA | 3.79e-08 |
| 3. B | P29294 | Myosin light chain kinase, smooth muscle | 3.08e-05 | NA | 2.93e-09 |
| 3. B | Q08180 | Irregular chiasm C-roughest protein | 2.59e-03 | NA | 0.004 |
| 3. B | Q4H3K6 | Fibroblast growth factor receptor | 7.28e-03 | NA | 0.019 |
| 3. B | Q15772 | Striated muscle preferentially expressed protein kinase | NA | NA | 5.89e-12 |
| 3. B | Q61330 | Contactin-2 | 2.62e-03 | NA | 4.84e-06 |
| 3. B | Q03364 | Fibroblast growth factor receptor 2 | 1.39e-03 | NA | 0.002 |
| 3. B | Q05BQ1 | Protein turtle homolog A | 5.14e-03 | NA | 2.32e-04 |
| 3. B | Q90Z00 | Fibroblast growth factor receptor 1-A | 6.13e-04 | NA | 1.92e-06 |
| 3. B | Q8QFP9 | Tyrosine-protein kinase receptor TYRO3 | 7.12e-03 | NA | 0.012 |
| 3. B | P13595 | Neural cell adhesion molecule 1 | 4.09e-05 | NA | 7.53e-11 |
| 3. B | Q8JG38 | Fibroblast growth factor receptor 2 | 3.78e-03 | NA | 0.001 |
| 3. B | P19320 | Vascular cell adhesion protein 1 | 5.72e-04 | NA | 0.001 |
| 3. B | Q58EX2 | Protein sidekick-2 | 1.05e-01 | NA | 7.66e-08 |
| 3. B | Q62718 | Neurotrimin | 5.44e-08 | NA | 0.016 |
| 3. B | Q05793 | Basement membrane-specific heparan sulfate proteoglycan core protein | NA | NA | 1.69e-10 |
| 3. B | Q4VA61 | Down syndrome cell adhesion molecule-like protein 1 homolog | 2.46e-02 | NA | 2.13e-13 |
| 3. B | F1NY98 | Down syndrome cell adhesion molecule homolog | 3.02e-02 | NA | 5.16e-11 |
| 3. B | Q9P2J2 | Protein turtle homolog A | 2.05e-04 | NA | 3.39e-06 |
| 3. B | Q96RW7 | Hemicentin-1 | NA | NA | 1.75e-15 |
| 3. B | Q5PQM4 | Myosin-binding protein H-like | 9.32e-07 | NA | 1.86e-07 |
| 3. B | E9PZ19 | Protein turtle homolog B | 2.81e-03 | NA | 1.11e-06 |
| 3. B | P79701 | Vascular endothelial growth factor receptor 3 | 6.70e-03 | NA | 0.003 |
| 3. B | P32004 | Neural cell adhesion molecule L1 | 9.92e-03 | NA | 4.52e-10 |
| 3. B | P97798 | Neogenin | 4.63e-04 | NA | 3.87e-10 |
| 3. B | P12960 | Contactin-1 | 7.39e-04 | NA | 2.47e-06 |
| 3. B | Q63638 | Striated muscle-specific serine/threonine-protein kinase | NA | NA | 1.98e-12 |
| 3. B | Q868Z9 | Papilin | NA | NA | 0.039 |
| 3. B | Q4KMG0 | Cell adhesion molecule-related/down-regulated by oncogenes | 4.42e-04 | NA | 1.29e-09 |
| 3. B | Q6NUX0 | WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein | 1.39e-02 | NA | 0.010 |
| 3. B | Q90330 | Fibroblast growth factor receptor 4 | 1.82e-04 | NA | 8.38e-10 |
| 3. B | O08775 | Vascular endothelial growth factor receptor 2 | 6.98e-03 | NA | 2.39e-04 |
| 3. B | Q14982 | Opioid-binding protein/cell adhesion molecule | 5.59e-08 | NA | 5.42e-05 |
| 3. B | Q13308 | Inactive tyrosine-protein kinase 7 | 1.79e-03 | NA | 5.63e-06 |
| 3. B | P57097 | Tyrosine-protein kinase Mer | 1.39e-02 | NA | 0.008 |
| 3. B | Q9QZS7 | Nephrin | 2.30e-04 | NA | 1.12e-05 |
| 3. B | P20917 | Myelin-associated glycoprotein | 5.34e-05 | NA | 5.98e-05 |
| 3. B | A2ABU4 | Myomesin-3 | 2.24e-03 | NA | 1.23e-09 |
| 3. B | A8DYP0 | Obscurin | NA | NA | 4.24e-19 |
| 3. B | Q8IWV2 | Contactin-4 | 1.07e-03 | NA | 1.06e-07 |
| 3. B | P14781 | Contactin-1 | 6.48e-04 | NA | 9.07e-06 |
| 3. B | Q94918 | Protein vein | 4.11e-02 | NA | 0.005 |
| 3. B | P25033 | Hemolin | 3.97e-07 | NA | 0.008 |
| 3. B | Q8AV57 | Protein sidekick-2 | 6.80e-03 | NA | 4.28e-10 |
| 3. B | P13591 | Neural cell adhesion molecule 1 | 1.86e-04 | NA | 1.94e-08 |
| 3. B | O94856 | Neurofascin | 1.03e-04 | NA | 5.41e-14 |
| 3. B | Q64487 | Receptor-type tyrosine-protein phosphatase delta | 2.53e-02 | NA | 4.90e-06 |
| 3. B | P97686 | Neuronal cell adhesion molecule | 1.79e-02 | NA | 8.12e-06 |
| 3. B | O35158 | Cell adhesion molecule-related/down-regulated by oncogenes | 5.69e-05 | NA | 9.19e-13 |
| 3. B | Q00872 | Myosin-binding protein C, slow-type | 2.92e-05 | NA | 4.64e-08 |
| 3. B | Q6GMZ9 | V-set and immunoglobulin domain-containing protein 10 | 2.54e-03 | NA | 0.010 |
| 3. B | Q9Z0J8 | Neuronal growth regulator 1 | 2.32e-09 | NA | 0.001 |
| 3. B | P97527 | Contactin-5 | 6.25e-04 | NA | 4.23e-07 |
| 3. B | Q8TD84 | Down syndrome cell adhesion molecule-like protein 1 | 2.27e-02 | NA | 8.10e-15 |
| 3. B | Q26614 | Fibroblast growth factor receptor | 7.61e-03 | NA | 1.14e-05 |
| 3. B | Q62838 | Muscle, skeletal receptor tyrosine protein kinase | 2.47e-06 | NA | 1.04e-11 |
| 3. B | P07722 | Myelin-associated glycoprotein | 5.88e-05 | NA | 2.17e-05 |
| 3. B | Q6V4S5 | Protein sidekick-2 | 1.75e-02 | NA | 3.73e-08 |
| 3. B | Q02297 | Pro-neuregulin-1, membrane-bound isoform | 2.68e-02 | NA | 0.008 |
| 3. B | Q16270 | Insulin-like growth factor-binding protein 7 | 1.97e-03 | NA | 4.98e-04 |
| 3. B | O75147 | Obscurin-like protein 1 | 2.46e-02 | NA | 8.42e-14 |
| 3. B | Q61581 | Insulin-like growth factor-binding protein 7 | 1.71e-03 | NA | 0.001 |
| 3. B | P29533 | Vascular cell adhesion protein 1 | 2.50e-03 | NA | 0.050 |
| 3. B | Q80W68 | Kin of IRRE-like protein 1 | 1.96e-03 | NA | 9.34e-06 |
| 3. B | Q810U4 | Neuronal cell adhesion molecule | 2.15e-04 | NA | 4.21e-06 |
| 3. B | Q5STE3 | Follistatin-related protein 4 | 9.79e-06 | NA | 2.22e-04 |
| 3. B | Q8BKG3 | Inactive tyrosine-protein kinase 7 | 1.91e-03 | NA | 1.96e-06 |
| 3. B | Q10656 | Myoblast growth factor receptor egl-15 | 1.74e-03 | NA | 5.61e-05 |
| 3. B | Q7Z5N4 | Protein sidekick-1 | 6.68e-02 | NA | 6.95e-06 |
| 3. B | O94898 | Leucine-rich repeats and immunoglobulin-like domains protein 2 | 3.37e-04 | NA | 1.01e-15 |
| 3. B | Q9JMB8 | Contactin-6 | 1.16e-03 | NA | 8.57e-08 |
| 3. B | Q5IS61 | Opioid-binding protein/cell adhesion molecule | 4.46e-08 | NA | 5.42e-05 |
| 3. B | P11627 | Neural cell adhesion molecule L1 | 2.57e-03 | NA | 1.35e-08 |
| 3. B | Q91048 | Inactive tyrosine-protein kinase 7 | 6.89e-03 | NA | 2.57e-04 |
| 3. B | P98160 | Basement membrane-specific heparan sulfate proteoglycan core protein | NA | NA | 1.30e-11 |
| 3. B | P10586 | Receptor-type tyrosine-protein phosphatase F | 2.02e-02 | NA | 2.99e-06 |
| 3. B | P15364 | Protein amalgam | 4.60e-06 | NA | 1.11e-06 |
| 3. B | Q05695 | Neural cell adhesion molecule L1 | 2.58e-03 | NA | 4.72e-09 |
| 3. B | P18461 | Fibroblast growth factor receptor 2 | 1.83e-03 | NA | 1.37e-06 |
| 3. B | P17948 | Vascular endothelial growth factor receptor 1 | 2.19e-02 | NA | 7.48e-05 |
| 3. B | Q86VF2 | Immunoglobulin-like and fibronectin type III domain-containing protein 1 | 1.17e-02 | NA | 2.21e-04 |
| 3. B | P70232 | Neural cell adhesion molecule L1-like protein | 1.74e-03 | NA | 5.01e-13 |
| 3. B | P54296 | Myomesin-2 | 5.31e-03 | NA | 6.96e-07 |
| 3. B | P60755 | MAM domain-containing glycosylphosphatidylinositol anchor protein 2 | 3.02e-03 | NA | 2.74e-05 |
| 3. B | P97685 | Neurofascin | 1.02e-04 | NA | 1.31e-13 |
| 3. B | Q62151 | Advanced glycosylation end product-specific receptor | 1.09e-04 | NA | 0.012 |
| 3. B | Q9I7U4 | Titin | NA | NA | 9.37e-16 |
| 3. B | Q7TPW1 | Nexilin | 2.09e-03 | NA | 0.003 |
| 3. B | Q9VZZ4 | Peroxidasin | 1.11e-03 | NA | 1.22e-05 |
| 3. B | Q91286 | Fibroblast growth factor receptor 2 | 1.31e-03 | NA | 5.38e-06 |
| 3. B | O60469 | Down syndrome cell adhesion molecule | 2.02e-02 | NA | 3.07e-10 |
| 3. B | Q9N3X8 | Protein sidekick homolog | 1.17e-01 | NA | 0.023 |
| 3. B | Q92823 | Neuronal cell adhesion molecule | 1.62e-02 | NA | 1.02e-06 |
| 3. B | Q9BMN8 | Tyrosine-protein phosphatase Lar-like | 2.43e-02 | NA | 0.001 |
| 3. B | Q15746 | Myosin light chain kinase, smooth muscle | 3.84e-03 | NA | 1.45e-16 |
| 3. B | P68500 | Contactin-5 | 5.18e-04 | NA | 1.38e-06 |
| 3. B | O14511 | Pro-neuregulin-2, membrane-bound isoform | 8.23e-02 | NA | 0.012 |
| 3. B | Q8BJ66 | Kazal-type serine protease inhibitor domain-containing protein 1 | 4.13e-03 | NA | 0.004 |
| 3. B | Q8BQC3 | Immunoglobulin superfamily DCC subclass member 3 | 2.98e-03 | NA | 1.52e-12 |
| 3. B | O70468 | Myosin-binding protein C, cardiac-type | 2.38e-03 | NA | 8.78e-06 |
| 3. B | P43322 | Pro-neuregulin-1, membrane-bound isoform | 2.49e-02 | NA | 0.012 |
| 3. B | Q5VST9 | Obscurin | NA | NA | 1.06e-20 |
| 3. B | Q2EY15 | Protogenin | 8.60e-04 | NA | 6.22e-08 |
| 3. B | Q2VWP9 | Protogenin | 7.10e-04 | NA | 4.42e-08 |
| 3. B | Q03696 | Neuronal-glial cell adhesion molecule | 8.06e-03 | NA | 1.80e-06 |
| 3. B | Q8AXZ4 | Contactin-1a | 2.22e-05 | NA | 2.83e-05 |
| 3. B | Q14896 | Myosin-binding protein C, cardiac-type | 1.98e-03 | NA | 4.54e-06 |
| 3. B | Q9P121 | Neurotrimin | 1.30e-06 | NA | 0.005 |
| 3. B | P31398 | Hemolin | 2.78e-06 | NA | 4.06e-05 |
| 3. B | Q9VS29 | Down syndrome cell adhesion molecule-like protein Dscam2 | 2.00e-02 | NA | 1.01e-08 |
| 3. B | Q64605 | Receptor-type tyrosine-protein phosphatase S | 1.88e-02 | NA | 1.68e-06 |
| 3. B | P11834 | Opioid-binding protein/cell adhesion molecule | 3.20e-07 | NA | 2.77e-05 |
| 3. B | Q91743 | Fibroblast growth factor receptor 4 | 9.62e-04 | NA | 1.57e-08 |
| 3. B | Q7Z3B1 | Neuronal growth regulator 1 | 7.02e-07 | NA | 0.005 |
| 3. B | Q9N1E3 | B-cell receptor CD22 (Fragment) | 4.17e-04 | NA | 0.036 |
| 3. B | Q6WRI0 | Immunoglobulin superfamily member 10 | 4.76e-02 | NA | 1.44e-07 |
| 3. B | Q05623 | Myosin-binding protein H | 2.51e-05 | NA | 1.13e-10 |
| 3. B | Q0ZGT2 | Nexilin | 7.41e-03 | NA | 0.004 |
| 3. B | Q63155 | Netrin receptor DCC | 6.13e-04 | NA | 1.06e-11 |
| 3. B | Q96J84 | Kin of IRRE-like protein 1 | 4.50e-06 | NA | 2.35e-05 |
| 3. B | A6NGN9 | IgLON family member 5 | 9.42e-08 | NA | 8.76e-05 |
| 3. B | P34082 | Fasciclin-2 | 1.33e-03 | NA | 1.97e-06 |
| 3. B | Q80W15 | Insulin-like growth factor-binding protein-like 1 | 1.92e-03 | NA | 0.041 |
| 3. B | Q6DJ83 | Cell adhesion molecule 2 | 1.69e-03 | NA | 8.18e-06 |
| 3. B | Q9ET54 | Palladin | 1.43e-03 | NA | 4.32e-16 |
| 3. B | O15394 | Neural cell adhesion molecule 2 | 1.86e-04 | NA | 1.94e-10 |
| 3. B | P20273 | B-cell receptor CD22 | 4.94e-02 | NA | 0.003 |
| 3. B | Q62234 | Myomesin-1 | 1.24e-02 | NA | 1.22e-05 |
| 3. B | Q5FW53 | Myosin-binding protein H-like | 7.01e-07 | NA | 2.60e-07 |
| 3. B | B4P5Q9 | Tyrosine-protein kinase-like otk | 1.48e-02 | NA | 2.98e-07 |
| 3. B | D3ZZ80 | Obscurin-like protein 1 | 2.48e-04 | NA | 1.34e-08 |
| 3. B | Q9UQ52 | Contactin-6 | 8.95e-04 | NA | 5.04e-07 |
| 3. B | Q9EPX2 | Papilin | 6.55e-03 | NA | 1.64e-06 |
| 3. B | Q96JA1 | Leucine-rich repeats and immunoglobulin-like domains protein 1 | 1.24e-03 | NA | 1.23e-11 |
| 3. B | P13596 | Neural cell adhesion molecule 1 | 3.32e-04 | NA | 8.93e-10 |
| 3. B | Q9W6V2 | Neuronal growth regulator 1 | 2.72e-09 | NA | 0.010 |
| 3. B | Q498D6 | Fibroblast growth factor receptor 4 | 1.87e-03 | NA | 5.75e-08 |
| 3. B | Q8BFR2 | Follistatin-related protein 5 | 2.19e-03 | NA | 5.72e-04 |
| 3. B | A2RUH7 | Myosin-binding protein H-like | 7.56e-07 | NA | 3.92e-08 |
| 3. B | Q90610 | Neogenin (Fragment) | 4.76e-04 | NA | 1.84e-14 |