Summary
A0A0A6YYL3
Homolog: Q54HW1.
Function: 26S proteasome non-ATPase regulatory subunit 10.
Statistics
Total GO Annotation: 815
Unique PROST Go: 46
Unique BLAST Go: 695
Total Homologs: 812
Unique PROST Homologs: 14
Unique BLAST Homologs: 725
Structures and Sequence Alignment
The best structural homolog that predicted by 3. B was
Q54HW1
(26S proteasome non-ATPase regulatory subunit 10) with a FATCAT P-Value: 1.11e-16 and RMSD of 2.10 angstrom. The sequence alignment identity is 14.2%.
Structural alignment shown in left. Query protein A0A0A6YYL3 colored as red in alignment, homolog Q54HW1 colored as blue.
Query protein A0A0A6YYL3 is also shown in right top, homolog Q54HW1 showed in right bottom. They are colored based on secondary structures.
A0A0A6YYL3 MVAEVCSMPAASAVKKPFDLRSKMGKWCHHRFPCCRGSGTSNVGTSGDHDDSFMKTLRSKMGKWCCHCFPCCRGSG-KSNVGTWGDYDDSAFMEPRYHVR 99 Q54HW1 -------------------------------------------------------------------------MSGTKFRTG--GTKED----------- 14 A0A0A6YYL3 RED-LD--KLHRAAWWGK-VPRKDLIVM--LRDTDMNKRDKQKRTALHLASANGNSEVVQLLLDR-RCQLNVLDNKKRTALIKAVQCQEDECVLMLLEHG 192 Q54HW1 --DLLEFVKV------GKLLEVKDLIENQGVK-ADC--KDEDERTPLHWAAAKGQISVAQYLMDNCKCSPNTNDDGGWTPLTSATSAGHTHMVKLLLEFG 103 A0A0A6YYL3 ADGN-IQDEYGNTALHYAIY--NEDKLMAKALLLYGADIESKNK---CGLTPLLLGVHEQKQ----EVVKFLIKKKANLNALDRYGRTALILAVCCGSAS 282 Q54HW1 ADPNTVND-SKRTPLHYASSKGRSD--IVDLLLTHGA----KNRKDDTGSAP----IHRASSNGSVATVERLLKGEANINSTNNEGDTPLHIAAEYNHED 192 A0A0A6YYL3 IVNLLLEQNVD--VSSQDLSGQTAREYAVSSHHHVICELLSDYKEKQMLKISSENSNPEQDLKLTSEEESQRLKVSENSQPEKMSQEPEINKDCDREVEE 380 Q54HW1 VVECLLKHGADTTIENKD--SKTPIDMS-SS--QTIKYLIKEFK-K------------------------------------------------------ 232 A0A0A6YYL3 EIKKHGSNPVGLPENLTNGASAGNGDDGLIPQRKSRKPENQQFPDTENEEYHSDEQNDTQKQLSEEQNTGISQDEILTNKQKQIEVAEKEMNSELSLSHK 480 Q54HW1 ---------------------------------------------------------------------------------------------------- 232 A0A0A6YYL3 KEEDLLRENSMLREEIAKLRLELDETKHQNQLRENKILEEIESVKEKLLKTIQLNEEALTKTSI 544 Q54HW1 ---------------------------------------------------------------- 232
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0051489 | regulation of filopodium assembly |
| 1. PB | GO:0048471 | perinuclear region of cytoplasm |
| 1. PB | GO:0016055 | Wnt signaling pathway |
| 1. PB | GO:0002455 | humoral immune response mediated by circulating immunoglobulin |
| 1. PB | GO:1901222 | regulation of NIK/NF-kappaB signaling |
| 1. PB | GO:0033257 | Bcl3/NF-kappaB2 complex |
| 1. PB | GO:1904743 | negative regulation of telomeric DNA binding |
| 1. PB | GO:0000151 | ubiquitin ligase complex |
| 1. PB | GO:0006471 | protein ADP-ribosylation |
| 1. PB | GO:0034587 | piRNA metabolic process |
| 1. PB | GO:0030154 | cell differentiation |
| 1. PB | GO:0070213 | protein auto-ADP-ribosylation |
| 1. PB | GO:0032695 | negative regulation of interleukin-12 production |
| 1. PB | GO:1904385 | cellular response to angiotensin |
| 1. PB | GO:1900127 | positive regulation of hyaluronan biosynthetic process |
| 1. PB | GO:0035304 | regulation of protein dephosphorylation |
| 1. PB | GO:0071359 | cellular response to dsRNA |
| 1. PB | GO:0042995 | cell projection |
| 1. PB | GO:1904908 | negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric |
| 1. PB | GO:0071546 | pi-body |
| 1. PB | GO:0071316 | cellular response to nicotine |
| 1. PB | GO:0002315 | marginal zone B cell differentiation |
| 1. PB | GO:0010225 | response to UV-C |
| 1. PB | GO:0031670 | cellular response to nutrient |
| 1. PB | GO:0003713 | transcription coactivator activity |
| 1. PB | GO:0019208 | phosphatase regulator activity |
| 1. PB | GO:0030907 | MBF transcription complex |
| 1. PB | GO:0007283 | spermatogenesis |
| 1. PB | GO:0007249 | I-kappaB kinase/NF-kappaB signaling |
| 1. PB | GO:0051101 | regulation of DNA binding |
| 1. PB | GO:0061028 | establishment of endothelial barrier |
| 1. PB | GO:0010956 | negative regulation of calcidiol 1-monooxygenase activity |
| 1. PB | GO:0048536 | spleen development |
| 1. PB | GO:0035994 | response to muscle stretch |
| 1. PB | GO:0090263 | positive regulation of canonical Wnt signaling pathway |
| 1. PB | GO:0042088 | T-helper 1 type immune response |
| 1. PB | GO:0042826 | histone deacetylase binding |
| 1. PB | GO:1904632 | cellular response to glucoside |
| 1. PB | GO:0016567 | protein ubiquitination |
| 1. PB | GO:1903670 | regulation of sprouting angiogenesis |
| 1. PB | GO:1990404 | protein ADP-ribosylase activity |
| 1. PB | GO:0071322 | cellular response to carbohydrate stimulus |
| 1. PB | GO:0043046 | DNA methylation involved in gamete generation |
| 1. PB | GO:1990416 | cellular response to brain-derived neurotrophic factor stimulus |
| 1. PB | GO:1904630 | cellular response to diterpene |
| 1. PB | GO:0070198 | protein localization to chromosome, telomeric region |
| 1. PB | GO:0032212 | positive regulation of telomere maintenance via telomerase |
| 1. PB | GO:0006606 | protein import into nucleus |
| 1. PB | GO:0017020 | myosin phosphatase regulator activity |
| 1. PB | GO:0014066 | regulation of phosphatidylinositol 3-kinase signaling |
| 1. PB | GO:2000630 | positive regulation of miRNA metabolic process |
| 1. PB | GO:0002268 | follicular dendritic cell differentiation |
| 1. PB | GO:0019888 | protein phosphatase regulator activity |
| 1. PB | GO:0045064 | T-helper 2 cell differentiation |
| 1. PB | GO:1904357 | negative regulation of telomere maintenance via telomere lengthening |
| 1. PB | GO:0031047 | gene silencing by RNA |
| 1. PB | GO:0060236 | regulation of mitotic spindle organization |
| 1. PB | GO:0035556 | intracellular signal transduction |
| 1. PB | GO:1903589 | positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis |
| 1. PB | GO:0045944 | positive regulation of transcription by RNA polymerase II |
| 1. PB | GO:0007140 | male meiotic nuclear division |
| 1. PB | GO:0071354 | cellular response to interleukin-6 |
| 1. PB | GO:0008157 | protein phosphatase 1 binding |
| 1. PB | GO:0033309 | SBF transcription complex |
| 1. PB | GO:0002467 | germinal center formation |
| 1. PB | GO:1902309 | negative regulation of peptidyl-serine dephosphorylation |
| 1. PB | GO:0003950 | NAD+ ADP-ribosyltransferase activity |
| 1. PB | GO:0032996 | Bcl3-Bcl10 complex |
| 1. PB | GO:0019730 | antimicrobial humoral response |
| 1. PB | GO:0043066 | negative regulation of apoptotic process |
| 1. PB | GO:1902412 | regulation of mitotic cytokinesis |
| 1. PB | GO:1904355 | positive regulation of telomere capping |
| 1. PB | GO:0070212 | protein poly-ADP-ribosylation |
| 1. PB | GO:0032088 | negative regulation of NF-kappaB transcription factor activity |
| 2. P | GO:0030198 | extracellular matrix organization |
| 2. P | GO:0001938 | positive regulation of endothelial cell proliferation |
| 2. P | GO:0071346 | cellular response to interferon-gamma |
| 2. P | GO:0031116 | positive regulation of microtubule polymerization |
| 2. P | GO:0042771 | intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator |
| 2. P | GO:0007080 | mitotic metaphase plate congression |
| 2. P | GO:0051973 | positive regulation of telomerase activity |
| 2. P | GO:0018107 | peptidyl-threonine phosphorylation |
| 2. P | GO:0032717 | negative regulation of interleukin-8 production |
| 2. P | GO:0005643 | nuclear pore |
| 2. P | GO:0032720 | negative regulation of tumor necrosis factor production |
| 2. P | GO:0061408 | positive regulation of transcription from RNA polymerase II promoter in response to heat stress |
| 2. P | GO:0005819 | spindle |
| 2. P | GO:0007084 | mitotic nuclear membrane reassembly |
| 2. P | GO:0000922 | spindle pole |
| 2. P | GO:2000637 | positive regulation of gene silencing by miRNA |
| 2. P | GO:2000678 | negative regulation of transcription regulatory region DNA binding |
| 2. P | GO:0035307 | positive regulation of protein dephosphorylation |
| 2. P | GO:0007417 | central nervous system development |
| 2. P | GO:0030539 | male genitalia development |
| 2. P | GO:0051721 | protein phosphatase 2A binding |
| 2. P | GO:0031965 | nuclear membrane |
| 2. P | GO:0071931 | positive regulation of transcription involved in G1/S transition of mitotic cell cycle |
| 2. P | GO:0032733 | positive regulation of interleukin-10 production |
| 2. P | GO:0035308 | negative regulation of protein dephosphorylation |
| 2. P | GO:0032729 | positive regulation of interferon-gamma production |
| 2. P | GO:0030330 | DNA damage response, signal transduction by p53 class mediator |
| 2. P | GO:0033391 | chromatoid body |
| 2. P | GO:0009615 | response to virus |
| 2. P | GO:0001818 | negative regulation of cytokine production |
| 2. P | GO:0042832 | defense response to protozoan |
| 2. P | GO:0020005 | symbiont-containing vacuole membrane |
| 2. P | GO:0051445 | regulation of meiotic cell cycle |
| 2. P | GO:2000060 | positive regulation of ubiquitin-dependent protein catabolic process |
| 2. P | GO:0140297 | DNA-binding transcription factor binding |
| 2. P | GO:0042326 | negative regulation of phosphorylation |
| 2. P | GO:0044406 | adhesion of symbiont to host |
| 2. P | GO:1901653 | cellular response to peptide |
| 2. P | GO:0046426 | negative regulation of receptor signaling pathway via JAK-STAT |
| 2. P | GO:0097431 | mitotic spindle pole |
| 2. P | GO:0032210 | regulation of telomere maintenance via telomerase |
| 2. P | GO:0090083 | regulation of inclusion body assembly |
| 2. P | GO:0010845 | positive regulation of reciprocal meiotic recombination |
| 2. P | GO:0051225 | spindle assembly |
| 2. P | GO:0002523 | leukocyte migration involved in inflammatory response |
| 2. P | GO:0000083 | regulation of transcription involved in G1/S transition of mitotic cell cycle |
| 3. B | GO:0005770 | late endosome |
| 3. B | GO:0034765 | regulation of ion transmembrane transport |
| 3. B | GO:0071625 | vocalization behavior |
| 3. B | GO:0042994 | cytoplasmic sequestering of transcription factor |
| 3. B | GO:0000122 | negative regulation of transcription by RNA polymerase II |
| 3. B | GO:0050729 | positive regulation of inflammatory response |
| 3. B | GO:0048337 | positive regulation of mesodermal cell fate specification |
| 3. B | GO:0090037 | positive regulation of protein kinase C signaling |
| 3. B | GO:0051835 | positive regulation of synapse structural plasticity |
| 3. B | GO:0006511 | ubiquitin-dependent protein catabolic process |
| 3. B | GO:0043011 | myeloid dendritic cell differentiation |
| 3. B | GO:0035148 | tube formation |
| 3. B | GO:0007507 | heart development |
| 3. B | GO:0001701 | in utero embryonic development |
| 3. B | GO:0072104 | glomerular capillary formation |
| 3. B | GO:1903779 | regulation of cardiac conduction |
| 3. B | GO:0070563 | negative regulation of vitamin D receptor signaling pathway |
| 3. B | GO:0030334 | regulation of cell migration |
| 3. B | GO:0032421 | stereocilium bundle |
| 3. B | GO:0003270 | Notch signaling pathway involved in regulation of secondary heart field cardioblast proliferation |
| 3. B | GO:0010812 | negative regulation of cell-substrate adhesion |
| 3. B | GO:0001756 | somitogenesis |
| 3. B | GO:2001259 | positive regulation of cation channel activity |
| 3. B | GO:0051247 | positive regulation of protein metabolic process |
| 3. B | GO:0021514 | ventral spinal cord interneuron differentiation |
| 3. B | GO:1903522 | regulation of blood circulation |
| 3. B | GO:0070372 | regulation of ERK1 and ERK2 cascade |
| 3. B | GO:0014044 | Schwann cell development |
| 3. B | GO:0006306 | DNA methylation |
| 3. B | GO:0097190 | apoptotic signaling pathway |
| 3. B | GO:0106310 | protein serine kinase activity |
| 3. B | GO:0019903 | protein phosphatase binding |
| 3. B | GO:0003252 | negative regulation of cell proliferation involved in heart valve morphogenesis |
| 3. B | GO:0085020 | protein K6-linked ubiquitination |
| 3. B | GO:0006959 | humoral immune response |
| 3. B | GO:0004842 | ubiquitin-protein transferase activity |
| 3. B | GO:0047499 | calcium-independent phospholipase A2 activity |
| 3. B | GO:0043403 | skeletal muscle tissue regeneration |
| 3. B | GO:0090543 | Flemming body |
| 3. B | GO:0001837 | epithelial to mesenchymal transition |
| 3. B | GO:0051494 | negative regulation of cytoskeleton organization |
| 3. B | GO:0048259 | regulation of receptor-mediated endocytosis |
| 3. B | GO:0045070 | positive regulation of viral genome replication |
| 3. B | GO:0035264 | multicellular organism growth |
| 3. B | GO:0021519 | spinal cord association neuron specification |
| 3. B | GO:0050885 | neuromuscular process controlling balance |
| 3. B | GO:0015095 | magnesium ion transmembrane transporter activity |
| 3. B | GO:0045611 | negative regulation of hemocyte differentiation |
| 3. B | GO:0035622 | intrahepatic bile duct development |
| 3. B | GO:2000822 | regulation of behavioral fear response |
| 3. B | GO:0045737 | positive regulation of cyclin-dependent protein serine/threonine kinase activity |
| 3. B | GO:0045036 | protein targeting to chloroplast |
| 3. B | GO:0016571 | histone methylation |
| 3. B | GO:0043254 | regulation of protein-containing complex assembly |
| 3. B | GO:0070588 | calcium ion transmembrane transport |
| 3. B | GO:0010765 | positive regulation of sodium ion transport |
| 3. B | GO:0010557 | positive regulation of macromolecule biosynthetic process |
| 3. B | GO:0003162 | atrioventricular node development |
| 3. B | GO:0035690 | |
| 3. B | GO:0007492 | endoderm development |
| 3. B | GO:0048549 | positive regulation of pinocytosis |
| 3. B | GO:2001214 | positive regulation of vasculogenesis |
| 3. B | GO:0030534 | adult behavior |
| 3. B | GO:0086015 | SA node cell action potential |
| 3. B | GO:0032466 | negative regulation of cytokinesis |
| 3. B | GO:0110156 | methylguanosine-cap decapping |
| 3. B | GO:0097107 | postsynaptic density assembly |
| 3. B | GO:0061073 | ciliary body morphogenesis |
| 3. B | GO:0051092 | positive regulation of NF-kappaB transcription factor activity |
| 3. B | GO:0036464 | cytoplasmic ribonucleoprotein granule |
| 3. B | GO:0003151 | outflow tract morphogenesis |
| 3. B | GO:1902807 | negative regulation of cell cycle G1/S phase transition |
| 3. B | GO:0007520 | myoblast fusion |
| 3. B | GO:0006913 | nucleocytoplasmic transport |
| 3. B | GO:0072014 | proximal tubule development |
| 3. B | GO:0002437 | inflammatory response to antigenic stimulus |
| 3. B | GO:0002039 | p53 binding |
| 3. B | GO:0002052 | positive regulation of neuroblast proliferation |
| 3. B | GO:0080173 | male-female gamete recognition during double fertilization forming a zygote and endosperm |
| 3. B | GO:0042734 | presynaptic membrane |
| 3. B | GO:0070417 | cellular response to cold |
| 3. B | GO:0031462 | Cul2-RING ubiquitin ligase complex |
| 3. B | GO:0048715 | negative regulation of oligodendrocyte differentiation |
| 3. B | GO:0034142 | toll-like receptor 4 signaling pathway |
| 3. B | GO:0006742 | NADP catabolic process |
| 3. B | GO:1990433 | CSL-Notch-Mastermind transcription factor complex |
| 3. B | GO:0005123 | death receptor binding |
| 3. B | GO:0032426 | stereocilium tip |
| 3. B | GO:0008608 | attachment of spindle microtubules to kinetochore |
| 3. B | GO:0043409 | negative regulation of MAPK cascade |
| 3. B | GO:1900273 | positive regulation of long-term synaptic potentiation |
| 3. B | GO:0001886 | endothelial cell morphogenesis |
| 3. B | GO:0043008 | ATP-dependent protein binding |
| 3. B | GO:0048056 | R3/R4 cell differentiation |
| 3. B | GO:0003160 | endocardium morphogenesis |
| 3. B | GO:0043086 | negative regulation of catalytic activity |
| 3. B | GO:0022011 | myelination in peripheral nervous system |
| 3. B | GO:0033601 | positive regulation of mammary gland epithelial cell proliferation |
| 3. B | GO:0010313 | phytochrome binding |
| 3. B | GO:0050894 | determination of affect |
| 3. B | GO:0045638 | negative regulation of myeloid cell differentiation |
| 3. B | GO:0001709 | cell fate determination |
| 3. B | GO:0099562 | maintenance of postsynaptic density structure |
| 3. B | GO:0000209 | protein polyubiquitination |
| 3. B | GO:0001947 | heart looping |
| 3. B | GO:0016197 | endosomal transport |
| 3. B | GO:0097546 | ciliary base |
| 3. B | GO:0002027 | regulation of heart rate |
| 3. B | GO:0090201 | negative regulation of release of cytochrome c from mitochondria |
| 3. B | GO:0035116 | embryonic hindlimb morphogenesis |
| 3. B | GO:2000178 | negative regulation of neural precursor cell proliferation |
| 3. B | GO:0044325 | transmembrane transporter binding |
| 3. B | GO:0008593 | regulation of Notch signaling pathway |
| 3. B | GO:0030496 | midbody |
| 3. B | GO:0005634 | nucleus |
| 3. B | GO:0072116 | pronephros formation |
| 3. B | GO:0072574 | hepatocyte proliferation |
| 3. B | GO:1990760 | osmolarity-sensing cation channel activity |
| 3. B | GO:0010629 | negative regulation of gene expression |
| 3. B | GO:0046875 | ephrin receptor binding |
| 3. B | GO:0010366 | negative regulation of ethylene biosynthetic process |
| 3. B | GO:0001763 | morphogenesis of a branching structure |
| 3. B | GO:0030660 | Golgi-associated vesicle membrane |
| 3. B | GO:0002789 | negative regulation of antifungal peptide production |
| 3. B | GO:0072044 | collecting duct development |
| 3. B | GO:0046826 | negative regulation of protein export from nucleus |
| 3. B | GO:1900246 | positive regulation of RIG-I signaling pathway |
| 3. B | GO:1904901 | positive regulation of myosin II filament organization |
| 3. B | GO:0070528 | protein kinase C signaling |
| 3. B | GO:0097129 | cyclin D2-CDK4 complex |
| 3. B | GO:0007253 | cytoplasmic sequestering of NF-kappaB |
| 3. B | GO:0060999 | positive regulation of dendritic spine development |
| 3. B | GO:0005516 | calmodulin binding |
| 3. B | GO:0045603 | positive regulation of endothelial cell differentiation |
| 3. B | GO:0110153 | RNA NAD-cap (NMN-forming) hydrolase activity |
| 3. B | GO:0010875 | positive regulation of cholesterol efflux |
| 3. B | GO:0045746 | negative regulation of Notch signaling pathway |
| 3. B | GO:0035774 | positive regulation of insulin secretion involved in cellular response to glucose stimulus |
| 3. B | GO:0051289 | protein homotetramerization |
| 3. B | GO:0097604 | temperature-gated cation channel activity |
| 3. B | GO:0004672 | protein kinase activity |
| 3. B | GO:0046427 | positive regulation of receptor signaling pathway via JAK-STAT |
| 3. B | GO:0043330 | response to exogenous dsRNA |
| 3. B | GO:0055016 | hypochord development |
| 3. B | GO:0031877 | somatostatin receptor binding |
| 3. B | GO:0048812 | neuron projection morphogenesis |
| 3. B | GO:0005769 | early endosome |
| 3. B | GO:0033292 | T-tubule organization |
| 3. B | GO:0071356 | cellular response to tumor necrosis factor |
| 3. B | GO:0045665 | negative regulation of neuron differentiation |
| 3. B | GO:0055074 | calcium ion homeostasis |
| 3. B | GO:0002043 | blood vessel endothelial cell proliferation involved in sprouting angiogenesis |
| 3. B | GO:0006816 | calcium ion transport |
| 3. B | GO:0071372 | cellular response to follicle-stimulating hormone stimulus |
| 3. B | GO:0061629 | RNA polymerase II-specific DNA-binding transcription factor binding |
| 3. B | GO:1904108 | protein localization to ciliary inversin compartment |
| 3. B | GO:0009950 | dorsal/ventral axis specification |
| 3. B | GO:1900245 | positive regulation of MDA-5 signaling pathway |
| 3. B | GO:0045747 | positive regulation of Notch signaling pathway |
| 3. B | GO:0006915 | apoptotic process |
| 3. B | GO:0035898 | parathyroid hormone secretion |
| 3. B | GO:0035924 | cellular response to vascular endothelial growth factor stimulus |
| 3. B | GO:0097114 | NMDA glutamate receptor clustering |
| 3. B | GO:0106311 | |
| 3. B | GO:0014832 | urinary bladder smooth muscle contraction |
| 3. B | GO:0071889 | 14-3-3 protein binding |
| 3. B | GO:0009644 | response to high light intensity |
| 3. B | GO:0040028 | regulation of vulval development |
| 3. B | GO:0090521 | glomerular visceral epithelial cell migration |
| 3. B | GO:0031436 | BRCA1-BARD1 complex |
| 3. B | GO:0050768 | negative regulation of neurogenesis |
| 3. B | GO:0030307 | positive regulation of cell growth |
| 3. B | GO:0099092 | postsynaptic density, intracellular component |
| 3. B | GO:0045893 | positive regulation of transcription, DNA-templated |
| 3. B | GO:0005249 | voltage-gated potassium channel activity |
| 3. B | GO:0045211 | postsynaptic membrane |
| 3. B | GO:0010838 | positive regulation of keratinocyte proliferation |
| 3. B | GO:0014070 | response to organic cyclic compound |
| 3. B | GO:0010976 | positive regulation of neuron projection development |
| 3. B | GO:0030017 | sarcomere |
| 3. B | GO:0032270 | positive regulation of cellular protein metabolic process |
| 3. B | GO:0043491 | protein kinase B signaling |
| 3. B | GO:0036336 | dendritic cell migration |
| 3. B | GO:0048873 | homeostasis of number of cells within a tissue |
| 3. B | GO:0051967 | negative regulation of synaptic transmission, glutamatergic |
| 3. B | GO:0061195 | taste bud formation |
| 3. B | GO:0018345 | protein palmitoylation |
| 3. B | GO:0032288 | myelin assembly |
| 3. B | GO:0021515 | cell differentiation in spinal cord |
| 3. B | GO:0002011 | morphogenesis of an epithelial sheet |
| 3. B | GO:0006537 | glutamate biosynthetic process |
| 3. B | GO:0071212 | subsynaptic reticulum |
| 3. B | GO:0014807 | regulation of somitogenesis |
| 3. B | GO:0090090 | negative regulation of canonical Wnt signaling pathway |
| 3. B | GO:0030279 | negative regulation of ossification |
| 3. B | GO:0048663 | neuron fate commitment |
| 3. B | GO:0030016 | myofibril |
| 3. B | GO:0006584 | catecholamine metabolic process |
| 3. B | GO:0060743 | epithelial cell maturation involved in prostate gland development |
| 3. B | GO:0003182 | coronary sinus valve morphogenesis |
| 3. B | GO:0055117 | regulation of cardiac muscle contraction |
| 3. B | GO:1902339 | positive regulation of apoptotic process involved in morphogenesis |
| 3. B | GO:0044605 | phosphocholine transferase activity |
| 3. B | GO:0006929 | substrate-dependent cell migration |
| 3. B | GO:0071345 | cellular response to cytokine stimulus |
| 3. B | GO:0030424 | axon |
| 3. B | GO:0007409 | axonogenesis |
| 3. B | GO:0051146 | striated muscle cell differentiation |
| 3. B | GO:0045171 | intercellular bridge |
| 3. B | GO:0110155 | NAD-cap decapping |
| 3. B | GO:0035255 | ionotropic glutamate receptor binding |
| 3. B | GO:0003714 | transcription corepressor activity |
| 3. B | GO:0043069 | negative regulation of programmed cell death |
| 3. B | GO:1902260 | negative regulation of delayed rectifier potassium channel activity |
| 3. B | GO:0031013 | troponin I binding |
| 3. B | GO:0031430 | M band |
| 3. B | GO:0090238 | positive regulation of arachidonic acid secretion |
| 3. B | GO:0045751 | negative regulation of Toll signaling pathway |
| 3. B | GO:0072576 | liver morphogenesis |
| 3. B | GO:0007030 | Golgi organization |
| 3. B | GO:0045838 | positive regulation of membrane potential |
| 3. B | GO:0005929 | cilium |
| 3. B | GO:1902263 | apoptotic process involved in embryonic digit morphogenesis |
| 3. B | GO:0036371 | protein localization to T-tubule |
| 3. B | GO:0035172 | hemocyte proliferation |
| 3. B | GO:0003344 | pericardium morphogenesis |
| 3. B | GO:0006543 | glutamine catabolic process |
| 3. B | GO:0044030 | regulation of DNA methylation |
| 3. B | GO:0060076 | excitatory synapse |
| 3. B | GO:0070742 | C2H2 zinc finger domain binding |
| 3. B | GO:0140627 | ubiquitin-dependent protein catabolic process via the C-end degron rule pathway |
| 3. B | GO:0003208 | cardiac ventricle morphogenesis |
| 3. B | GO:0003214 | cardiac left ventricle morphogenesis |
| 3. B | GO:0007613 | memory |
| 3. B | GO:2000812 | regulation of barbed-end actin filament capping |
| 3. B | GO:0010424 | DNA methylation on cytosine within a CG sequence |
| 3. B | GO:0014731 | spectrin-associated cytoskeleton |
| 3. B | GO:0044309 | neuron spine |
| 3. B | GO:0005737 | cytoplasm |
| 3. B | GO:0098978 | glutamatergic synapse |
| 3. B | GO:2000001 | regulation of DNA damage checkpoint |
| 3. B | GO:0055013 | cardiac muscle cell development |
| 3. B | GO:0072114 | pronephros morphogenesis |
| 3. B | GO:0061630 | ubiquitin protein ligase activity |
| 3. B | GO:0010882 | regulation of cardiac muscle contraction by calcium ion signaling |
| 3. B | GO:0043005 | neuron projection |
| 3. B | GO:0098871 | postsynaptic actin cytoskeleton |
| 3. B | GO:0097435 | supramolecular fiber organization |
| 3. B | GO:0035153 | epithelial cell type specification, open tracheal system |
| 3. B | GO:0046331 | lateral inhibition |
| 3. B | GO:0014704 | intercalated disc |
| 3. B | GO:0097113 | AMPA glutamate receptor clustering |
| 3. B | GO:2000321 | positive regulation of T-helper 17 cell differentiation |
| 3. B | GO:0019901 | protein kinase binding |
| 3. B | GO:0046959 | habituation |
| 3. B | GO:0001955 | blood vessel maturation |
| 3. B | GO:0099519 | dense core granule cytoskeletal transport |
| 3. B | GO:0007219 | Notch signaling pathway |
| 3. B | GO:0038023 | signaling receptor activity |
| 3. B | GO:0060354 | negative regulation of cell adhesion molecule production |
| 3. B | GO:0031441 | negative regulation of mRNA 3'-end processing |
| 3. B | GO:0032232 | negative regulation of actin filament bundle assembly |
| 3. B | GO:0034638 | phosphatidylcholine catabolic process |
| 3. B | GO:0021546 | rhombomere development |
| 3. B | GO:0003332 | negative regulation of extracellular matrix constituent secretion |
| 3. B | GO:0033280 | response to vitamin D |
| 3. B | GO:0046976 | histone methyltransferase activity (H3-K27 specific) |
| 3. B | GO:1905274 | regulation of modification of postsynaptic actin cytoskeleton |
| 3. B | GO:0045794 | negative regulation of cell volume |
| 3. B | GO:0005856 | cytoskeleton |
| 3. B | GO:1904717 | regulation of AMPA glutamate receptor clustering |
| 3. B | GO:0042048 | olfactory behavior |
| 3. B | GO:0071222 | cellular response to lipopolysaccharide |
| 3. B | GO:0071447 | cellular response to hydroperoxide |
| 3. B | GO:0032580 | Golgi cisterna membrane |
| 3. B | GO:0035914 | skeletal muscle cell differentiation |
| 3. B | GO:0000731 | DNA synthesis involved in DNA repair |
| 3. B | GO:0016529 | sarcoplasmic reticulum |
| 3. B | GO:0071800 | podosome assembly |
| 3. B | GO:0060288 | formation of a compartment boundary |
| 3. B | GO:0051497 | negative regulation of stress fiber assembly |
| 3. B | GO:0005096 | GTPase activator activity |
| 3. B | GO:0030034 | microvillar actin bundle assembly |
| 3. B | GO:0071347 | cellular response to interleukin-1 |
| 3. B | GO:1900383 | regulation of synaptic plasticity by receptor localization to synapse |
| 3. B | GO:0003241 | growth involved in heart morphogenesis |
| 3. B | GO:0072660 | maintenance of protein location in plasma membrane |
| 3. B | GO:0015629 | actin cytoskeleton |
| 3. B | GO:0009967 | positive regulation of signal transduction |
| 3. B | GO:0055007 | cardiac muscle cell differentiation |
| 3. B | GO:0060289 | compartment boundary maintenance |
| 3. B | GO:0031674 | I band |
| 3. B | GO:2000134 | negative regulation of G1/S transition of mitotic cell cycle |
| 3. B | GO:0043197 | dendritic spine |
| 3. B | GO:0005112 | Notch binding |
| 3. B | GO:0003198 | epithelial to mesenchymal transition involved in endocardial cushion formation |
| 3. B | GO:0102991 | myristoyl-CoA hydrolase activity |
| 3. B | GO:1901187 | regulation of ephrin receptor signaling pathway |
| 3. B | GO:0008285 | negative regulation of cell population proliferation |
| 3. B | GO:0001889 | liver development |
| 3. B | GO:0045197 | establishment or maintenance of epithelial cell apical/basal polarity |
| 3. B | GO:0060674 | placenta blood vessel development |
| 3. B | GO:0039529 | RIG-I signaling pathway |
| 3. B | GO:0033209 | tumor necrosis factor-mediated signaling pathway |
| 3. B | GO:0036309 | protein localization to M-band |
| 3. B | GO:0065001 | specification of axis polarity |
| 3. B | GO:0035809 | regulation of urine volume |
| 3. B | GO:0000287 | magnesium ion binding |
| 3. B | GO:0060317 | cardiac epithelial to mesenchymal transition |
| 3. B | GO:0097117 | guanylate kinase-associated protein clustering |
| 3. B | GO:0086069 | bundle of His cell to Purkinje myocyte communication |
| 3. B | GO:0060948 | cardiac vascular smooth muscle cell development |
| 3. B | GO:0045732 | positive regulation of protein catabolic process |
| 3. B | GO:0098919 | structural constituent of postsynaptic density |
| 3. B | GO:0034446 | substrate adhesion-dependent cell spreading |
| 3. B | GO:0002357 | defense response to tumor cell |
| 3. B | GO:0002070 | epithelial cell maturation |
| 3. B | GO:0031432 | titin binding |
| 3. B | GO:0034112 | positive regulation of homotypic cell-cell adhesion |
| 3. B | GO:0001967 | suckling behavior |
| 3. B | GO:0060442 | branching involved in prostate gland morphogenesis |
| 3. B | GO:0070531 | BRCA1-A complex |
| 3. B | GO:0060582 | cell fate determination involved in pattern specification |
| 3. B | GO:0060842 | arterial endothelial cell differentiation |
| 3. B | GO:0086070 | SA node cell to atrial cardiac muscle cell communication |
| 3. B | GO:1900452 | regulation of long-term synaptic depression |
| 3. B | GO:0009411 | response to UV |
| 3. B | GO:0045955 | negative regulation of calcium ion-dependent exocytosis |
| 3. B | GO:0070972 | protein localization to endoplasmic reticulum |
| 3. B | GO:0090160 | Golgi to lysosome transport |
| 3. B | GO:2001027 | negative regulation of endothelial cell chemotaxis |
| 3. B | GO:0043268 | positive regulation of potassium ion transport |
| 3. B | GO:0042981 | regulation of apoptotic process |
| 3. B | GO:0016021 | integral component of membrane |
| 3. B | GO:0031267 | small GTPase binding |
| 3. B | GO:0060035 | notochord cell development |
| 3. B | GO:0002193 | MAML1-RBP-Jkappa- ICN1 complex |
| 3. B | GO:0046579 | positive regulation of Ras protein signal transduction |
| 3. B | GO:0045685 | regulation of glial cell differentiation |
| 3. B | GO:0030513 | positive regulation of BMP signaling pathway |
| 3. B | GO:2000737 | negative regulation of stem cell differentiation |
| 3. B | GO:0048754 | branching morphogenesis of an epithelial tube |
| 3. B | GO:0004861 | cyclin-dependent protein serine/threonine kinase inhibitor activity |
| 3. B | GO:0010001 | glial cell differentiation |
| 3. B | GO:1902531 | regulation of intracellular signal transduction |
| 3. B | GO:0000062 | fatty-acyl-CoA binding |
| 3. B | GO:1900827 | positive regulation of membrane depolarization during cardiac muscle cell action potential |
| 3. B | GO:0031960 | response to corticosteroid |
| 3. B | GO:0060074 | synapse maturation |
| 3. B | GO:0003256 | regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation |
| 3. B | GO:1901201 | regulation of extracellular matrix assembly |
| 3. B | GO:0048892 | lateral line nerve development |
| 3. B | GO:0032049 | cardiolipin biosynthetic process |
| 3. B | GO:0008093 | cytoskeletal anchor activity |
| 3. B | GO:0010667 | negative regulation of cardiac muscle cell apoptotic process |
| 3. B | GO:0038061 | NIK/NF-kappaB signaling |
| 3. B | GO:0005938 | cell cortex |
| 3. B | GO:0042802 | identical protein binding |
| 3. B | GO:0005654 | nucleoplasm |
| 3. B | GO:0048708 | astrocyte differentiation |
| 3. B | GO:0030674 | protein-macromolecule adaptor activity |
| 3. B | GO:0001708 | cell fate specification |
| 3. B | GO:0034058 | endosomal vesicle fusion |
| 3. B | GO:0003222 | ventricular trabecula myocardium morphogenesis |
| 3. B | GO:0030326 | embryonic limb morphogenesis |
| 3. B | GO:0060740 | prostate gland epithelium morphogenesis |
| 3. B | GO:0030837 | negative regulation of actin filament polymerization |
| 3. B | GO:0071286 | cellular response to magnesium ion |
| 3. B | GO:0090309 | positive regulation of DNA methylation-dependent heterochromatin assembly |
| 3. B | GO:0060411 | cardiac septum morphogenesis |
| 3. B | GO:1905938 | positive regulation of germ cell proliferation |
| 3. B | GO:0050775 | positive regulation of dendrite morphogenesis |
| 3. B | GO:0045967 | negative regulation of growth rate |
| 3. B | GO:0043034 | costamere |
| 3. B | GO:0021986 | habenula development |
| 3. B | GO:0018230 | peptidyl-L-cysteine S-palmitoylation |
| 3. B | GO:0032791 | lead ion binding |
| 3. B | GO:0031297 | replication fork processing |
| 3. B | GO:0030046 | parallel actin filament bundle assembly |
| 3. B | GO:0046843 | dorsal appendage formation |
| 3. B | GO:0051059 | NF-kappaB binding |
| 3. B | GO:0036166 | phenotypic switching |
| 3. B | GO:0046469 | platelet activating factor metabolic process |
| 3. B | GO:0007605 | sensory perception of sound |
| 3. B | GO:0044877 | protein-containing complex binding |
| 3. B | GO:0070986 | left/right axis specification |
| 3. B | GO:0005576 | extracellular region |
| 3. B | GO:0002087 | regulation of respiratory gaseous exchange by nervous system process |
| 3. B | GO:0019887 | protein kinase regulator activity |
| 3. B | GO:0046974 | histone methyltransferase activity (H3-K9 specific) |
| 3. B | GO:0098908 | regulation of neuronal action potential |
| 3. B | GO:0018024 | histone-lysine N-methyltransferase activity |
| 3. B | GO:0010468 | regulation of gene expression |
| 3. B | GO:0045814 | negative regulation of gene expression, epigenetic |
| 3. B | GO:0030018 | Z disc |
| 3. B | GO:0042805 | actinin binding |
| 3. B | GO:0001569 | branching involved in blood vessel morphogenesis |
| 3. B | GO:0036377 | arbuscular mycorrhizal association |
| 3. B | GO:0043063 | intercellular bridge organization |
| 3. B | GO:0046473 | phosphatidic acid metabolic process |
| 3. B | GO:0007221 | positive regulation of transcription of Notch receptor target |
| 3. B | GO:0099612 | protein localization to axon |
| 3. B | GO:0098703 | calcium ion import across plasma membrane |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:0061419 | positive regulation of transcription from RNA polymerase II promoter in response to hypoxia |
| 3. B | GO:1902041 | regulation of extrinsic apoptotic signaling pathway via death domain receptors |
| 3. B | GO:0045669 | positive regulation of osteoblast differentiation |
| 3. B | GO:0042686 | regulation of cardioblast cell fate specification |
| 3. B | GO:0046338 | phosphatidylethanolamine catabolic process |
| 3. B | GO:0071260 | cellular response to mechanical stimulus |
| 3. B | GO:0097422 | tubular endosome |
| 3. B | GO:0090216 | positive regulation of 1-phosphatidylinositol-4-phosphate 5-kinase activity |
| 3. B | GO:0018027 | peptidyl-lysine dimethylation |
| 3. B | GO:0035176 | social behavior |
| 3. B | GO:0010960 | magnesium ion homeostasis |
| 3. B | GO:0080085 | signal recognition particle, chloroplast targeting |
| 3. B | GO:0005216 | ion channel activity |
| 3. B | GO:2001204 | regulation of osteoclast development |
| 3. B | GO:0001650 | fibrillar center |
| 3. B | GO:2000114 | regulation of establishment of cell polarity |
| 3. B | GO:0140261 | BCOR complex |
| 3. B | GO:0035418 | protein localization to synapse |
| 3. B | GO:0005886 | plasma membrane |
| 3. B | GO:0042325 | regulation of phosphorylation |
| 3. B | GO:0010614 | negative regulation of cardiac muscle hypertrophy |
| 3. B | GO:0021675 | nerve development |
| 3. B | GO:0035646 | endosome to melanosome transport |
| 3. B | GO:0044232 | organelle membrane contact site |
| 3. B | GO:0048899 | anterior lateral line development |
| 3. B | GO:0033147 | negative regulation of intracellular estrogen receptor signaling pathway |
| 3. B | GO:0062043 | positive regulation of cardiac epithelial to mesenchymal transition |
| 3. B | GO:0070208 | protein heterotrimerization |
| 3. B | GO:0001222 | transcription corepressor binding |
| 3. B | GO:0045316 | negative regulation of compound eye photoreceptor development |
| 3. B | GO:0007009 | plasma membrane organization |
| 3. B | GO:0045607 | regulation of inner ear auditory receptor cell differentiation |
| 3. B | GO:0043292 | contractile fiber |
| 3. B | GO:0043517 | positive regulation of DNA damage response, signal transduction by p53 class mediator |
| 3. B | GO:0019843 | rRNA binding |
| 3. B | GO:1900271 | regulation of long-term synaptic potentiation |
| 3. B | GO:2000048 | negative regulation of cell-cell adhesion mediated by cadherin |
| 3. B | GO:1904058 | positive regulation of sensory perception of pain |
| 3. B | GO:0060979 | vasculogenesis involved in coronary vascular morphogenesis |
| 3. B | GO:0009066 | aspartate family amino acid metabolic process |
| 3. B | GO:0030160 | synaptic receptor adaptor activity |
| 3. B | GO:0045662 | negative regulation of myoblast differentiation |
| 3. B | GO:0072017 | distal tubule development |
| 3. B | GO:0042659 | regulation of cell fate specification |
| 3. B | GO:0007440 | foregut morphogenesis |
| 3. B | GO:0048711 | positive regulation of astrocyte differentiation |
| 3. B | GO:0072073 | kidney epithelium development |
| 3. B | GO:0045859 | regulation of protein kinase activity |
| 3. B | GO:0004622 | lysophospholipase activity |
| 3. B | GO:0035023 | regulation of Rho protein signal transduction |
| 3. B | GO:0072357 | PTW/PP1 phosphatase complex |
| 3. B | GO:0007386 | compartment pattern specification |
| 3. B | GO:0008022 | protein C-terminus binding |
| 3. B | GO:0010650 | positive regulation of cell communication by electrical coupling |
| 3. B | GO:0003181 | atrioventricular valve morphogenesis |
| 3. B | GO:0090051 | negative regulation of cell migration involved in sprouting angiogenesis |
| 3. B | GO:0021773 | striatal medium spiny neuron differentiation |
| 3. B | GO:0010638 | positive regulation of organelle organization |
| 3. B | GO:0060768 | regulation of epithelial cell proliferation involved in prostate gland development |
| 3. B | GO:0060998 | regulation of dendritic spine development |
| 3. B | GO:2000811 | negative regulation of anoikis |
| 3. B | GO:0048102 | autophagic cell death |
| 3. B | GO:0006897 | endocytosis |
| 3. B | GO:0045608 | negative regulation of inner ear auditory receptor cell differentiation |
| 3. B | GO:0055008 | cardiac muscle tissue morphogenesis |
| 3. B | GO:1901339 | regulation of store-operated calcium channel activity |
| 3. B | GO:0071314 | cellular response to cocaine |
| 3. B | GO:0000242 | pericentriolar material |
| 3. B | GO:2000096 | positive regulation of Wnt signaling pathway, planar cell polarity pathway |
| 3. B | GO:0003197 | endocardial cushion development |
| 3. B | GO:0016604 | nuclear body |
| 3. B | GO:0003723 | RNA binding |
| 3. B | GO:0098685 | Schaffer collateral - CA1 synapse |
| 3. B | GO:0042665 | regulation of ectodermal cell fate specification |
| 3. B | GO:0098907 | regulation of SA node cell action potential |
| 3. B | GO:0003203 | endocardial cushion morphogenesis |
| 3. B | GO:1900026 | positive regulation of substrate adhesion-dependent cell spreading |
| 3. B | GO:0035965 | cardiolipin acyl-chain remodeling |
| 3. B | GO:0003677 | DNA binding |
| 3. B | GO:0030155 | regulation of cell adhesion |
| 3. B | GO:0086014 | atrial cardiac muscle cell action potential |
| 3. B | GO:0016409 | palmitoyltransferase activity |
| 3. B | GO:0008270 | zinc ion binding |
| 3. B | GO:0003184 | pulmonary valve morphogenesis |
| 3. B | GO:0090461 | glutamate homeostasis |
| 3. B | GO:0030507 | spectrin binding |
| 3. B | GO:0003169 | coronary vein morphogenesis |
| 3. B | GO:0043518 | negative regulation of DNA damage response, signal transduction by p53 class mediator |
| 3. B | GO:0060528 | secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development |
| 3. B | GO:0047389 | glycerophosphocholine phosphodiesterase activity |
| 3. B | GO:0010832 | negative regulation of myotube differentiation |
| 3. B | GO:0071532 | ankyrin repeat binding |
| 3. B | GO:0070682 | proteasome regulatory particle assembly |
| 3. B | GO:0070936 | protein K48-linked ubiquitination |
| 3. B | GO:0070412 | R-SMAD binding |
| 3. B | GO:0140439 | protein-cysteine S-stearoyltransferase activity |
| 3. B | GO:0051438 | regulation of ubiquitin-protein transferase activity |
| 3. B | GO:0000210 | NAD+ diphosphatase activity |
| 3. B | GO:0045648 | positive regulation of erythrocyte differentiation |
| 3. B | GO:0031143 | pseudopodium |
| 3. B | GO:0051017 | actin filament bundle assembly |
| 3. B | GO:0032495 | response to muramyl dipeptide |
| 3. B | GO:0007368 | determination of left/right symmetry |
| 3. B | GO:0071244 | cellular response to carbon dioxide |
| 3. B | GO:0060982 | coronary artery morphogenesis |
| 3. B | GO:0014069 | postsynaptic density |
| 3. B | GO:0007616 | long-term memory |
| 3. B | GO:0045687 | positive regulation of glial cell differentiation |
| 3. B | GO:0070431 | nucleotide-binding oligomerization domain containing 2 signaling pathway |
| 3. B | GO:0001954 | positive regulation of cell-matrix adhesion |
| 3. B | GO:0051726 | regulation of cell cycle |
| 3. B | GO:0014912 | negative regulation of smooth muscle cell migration |
| 3. B | GO:0031359 | integral component of chloroplast outer membrane |
| 3. B | GO:0010780 | meiotic DNA double-strand break formation involved in reciprocal meiotic recombination |
| 3. B | GO:0071407 | cellular response to organic cyclic compound |
| 3. B | GO:0031867 | EP4 subtype prostaglandin E2 receptor binding |
| 3. B | GO:0015248 | sterol transporter activity |
| 3. B | GO:0048103 | somatic stem cell division |
| 3. B | GO:0043266 | regulation of potassium ion transport |
| 3. B | GO:0050955 | thermoception |
| 3. B | GO:0060843 | venous endothelial cell differentiation |
| 3. B | GO:0001838 | embryonic epithelial tube formation |
| 3. B | GO:2000651 | positive regulation of sodium ion transmembrane transporter activity |
| 3. B | GO:0006528 | asparagine metabolic process |
| 3. B | GO:0032496 | response to lipopolysaccharide |
| 3. B | GO:0061399 | positive regulation of transcription from RNA polymerase II promoter in response to cobalt ion |
| 3. B | GO:0140031 | phosphorylation-dependent protein binding |
| 3. B | GO:0051306 | mitotic sister chromatid separation |
| 3. B | GO:0003207 | cardiac chamber formation |
| 3. B | GO:0061384 | heart trabecula morphogenesis |
| 3. B | GO:0048060 | negative gravitaxis |
| 3. B | GO:0072015 | glomerular visceral epithelial cell development |
| 3. B | GO:2000304 | positive regulation of ceramide biosynthetic process |
| 3. B | GO:0070171 | negative regulation of tooth mineralization |
| 3. B | GO:0035014 | phosphatidylinositol 3-kinase regulator activity |
| 3. B | GO:0030315 | T-tubule |
| 3. B | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process |
| 3. B | GO:0043280 | positive regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| 3. B | GO:1905936 | regulation of germ cell proliferation |
| 3. B | GO:0003209 | cardiac atrium morphogenesis |
| 3. B | GO:0048052 | R1/R6 cell differentiation |
| 3. B | GO:0021531 | spinal cord radial glial cell differentiation |
| 3. B | GO:0010888 | negative regulation of lipid storage |
| 3. B | GO:0002091 | negative regulation of receptor internalization |
| 3. B | GO:0005262 | calcium channel activity |
| 3. B | GO:0010761 | fibroblast migration |
| 3. B | GO:2000969 | positive regulation of AMPA receptor activity |
| 3. B | GO:0008290 | F-actin capping protein complex |
| 3. B | GO:0102545 | phosphatidyl phospholipase B activity |
| 3. B | GO:0097062 | dendritic spine maintenance |
| 3. B | GO:0031901 | early endosome membrane |
| 3. B | GO:0031672 | A band |
| 3. B | GO:0003213 | cardiac right atrium morphogenesis |
| 3. B | GO:0045602 | negative regulation of endothelial cell differentiation |
| 3. B | GO:0045869 | negative regulation of single stranded viral RNA replication via double stranded DNA intermediate |
| 3. B | GO:0050793 | regulation of developmental process |
| 3. B | GO:0098910 | regulation of atrial cardiac muscle cell action potential |
| 3. B | GO:0043194 | axon initial segment |
| 3. B | GO:0009912 | auditory receptor cell fate commitment |
| 3. B | GO:0030941 | chloroplast targeting sequence binding |
| 3. B | GO:0099527 | postsynapse to nucleus signaling pathway |
| 3. B | GO:0046849 | bone remodeling |
| 3. B | GO:2000249 | regulation of actin cytoskeleton reorganization |
| 3. B | GO:0048265 | response to pain |
| 3. B | GO:0016279 | protein-lysine N-methyltransferase activity |
| 3. B | GO:0007165 | signal transduction |
| 3. B | GO:0010745 | negative regulation of macrophage derived foam cell differentiation |
| 3. B | GO:0001895 | retina homeostasis |
| 3. B | GO:0031466 | Cul5-RING ubiquitin ligase complex |
| 3. B | GO:1901223 | negative regulation of NIK/NF-kappaB signaling |
| 3. B | GO:0097543 | ciliary inversin compartment |
| 3. B | GO:0017124 | SH3 domain binding |
| 3. B | GO:0003847 | 1-alkyl-2-acetylglycerophosphocholine esterase activity |
| 3. B | GO:0046822 | regulation of nucleocytoplasmic transport |
| 3. B | GO:0048170 | positive regulation of long-term neuronal synaptic plasticity |
| 3. B | GO:0048854 | brain morphogenesis |
| 3. B | GO:0003219 | cardiac right ventricle formation |
| 3. B | GO:0043235 | receptor complex |
| 3. B | GO:0001658 | branching involved in ureteric bud morphogenesis |
| 3. B | GO:0017171 | serine hydrolase activity |
| 3. B | GO:0072144 | glomerular mesangial cell development |
| 3. B | GO:2000031 | regulation of salicylic acid mediated signaling pathway |
| 3. B | GO:0016235 | aggresome |
| 3. B | GO:0060956 | endocardial cell differentiation |
| 3. B | GO:1902230 | negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage |
| 3. B | GO:0042383 | sarcolemma |
| 3. B | GO:0140036 | ubiquitin-dependent protein binding |
| 3. B | GO:1901189 | positive regulation of ephrin receptor signaling pathway |
| 3. B | GO:0070427 | nucleotide-binding oligomerization domain containing 1 signaling pathway |
| 3. B | GO:0050931 | pigment cell differentiation |
| 3. B | GO:0034704 | calcium channel complex |
| 3. B | GO:0060402 | calcium ion transport into cytosol |
| 3. B | GO:0060038 | cardiac muscle cell proliferation |
| 3. B | GO:0042297 | vocal learning |
| 3. B | GO:0002040 | sprouting angiogenesis |
| 3. B | GO:0061001 | regulation of dendritic spine morphogenesis |
| 3. B | GO:2000279 | negative regulation of DNA biosynthetic process |
| 3. B | GO:0045596 | negative regulation of cell differentiation |
| 3. B | GO:0061025 | membrane fusion |
| 3. B | GO:0051386 | regulation of neurotrophin TRK receptor signaling pathway |
| 3. B | GO:0097110 | scaffold protein binding |
| 3. B | GO:1990393 | 3M complex |
| 3. B | GO:0060803 | BMP signaling pathway involved in mesodermal cell fate specification |
| 3. B | GO:0045618 | positive regulation of keratinocyte differentiation |
| 3. B | GO:0003180 | aortic valve morphogenesis |
| 3. B | GO:1990705 | cholangiocyte proliferation |
| 3. B | GO:0060013 | righting reflex |
| 3. B | GO:0007411 | axon guidance |
| 3. B | GO:0050968 | detection of chemical stimulus involved in sensory perception of pain |
| 3. B | GO:0042246 | tissue regeneration |
| 3. B | GO:0003157 | endocardium development |
| 3. B | GO:0007229 | integrin-mediated signaling pathway |
| 3. B | GO:1900451 | positive regulation of glutamate receptor signaling pathway |
| 3. B | GO:1903343 | positive regulation of meiotic DNA double-strand break formation |
| 3. B | GO:0090029 | negative regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion |
| 3. B | GO:0046533 | negative regulation of photoreceptor cell differentiation |
| 3. B | GO:0097150 | neuronal stem cell population maintenance |
| 3. B | GO:0060045 | positive regulation of cardiac muscle cell proliferation |
| 3. B | GO:0048013 | ephrin receptor signaling pathway |
| 3. B | GO:1901019 | regulation of calcium ion transmembrane transporter activity |
| 3. B | GO:0035171 | lamellocyte differentiation |
| 3. B | GO:0004067 | asparaginase activity |
| 3. B | GO:1903849 | positive regulation of aorta morphogenesis |
| 3. B | GO:0045162 | clustering of voltage-gated sodium channels |
| 3. B | GO:0060413 | atrial septum morphogenesis |
| 3. B | GO:0050728 | negative regulation of inflammatory response |
| 3. B | GO:0003192 | mitral valve formation |
| 3. B | GO:0043065 | positive regulation of apoptotic process |
| 3. B | GO:0008139 | nuclear localization sequence binding |
| 3. B | GO:0030027 | lamellipodium |
| 3. B | GO:0000415 | negative regulation of histone H3-K36 methylation |
| 3. B | GO:0033268 | node of Ranvier |
| 3. B | GO:0048665 | neuron fate specification |
| 3. B | GO:0090200 | positive regulation of release of cytochrome c from mitochondria |
| 3. B | GO:0050852 | T cell receptor signaling pathway |
| 3. B | GO:0003264 | regulation of cardioblast proliferation |
| 3. B | GO:0019705 | protein-cysteine S-myristoyltransferase activity |
| 3. B | GO:0010613 | positive regulation of cardiac muscle hypertrophy |
| 3. B | GO:0043596 | nuclear replication fork |
| 3. B | GO:0001835 | blastocyst hatching |
| 3. B | GO:0050807 | regulation of synapse organization |
| 3. B | GO:0061314 | Notch signaling involved in heart development |
| 3. B | GO:0008361 | regulation of cell size |
| 3. B | GO:0071709 | membrane assembly |
| 3. B | GO:0015278 | calcium-release channel activity |
| 3. B | GO:1990756 | ubiquitin ligase-substrate adaptor activity |
| 3. B | GO:0060992 | response to fungicide |
| 3. B | GO:2000463 | positive regulation of excitatory postsynaptic potential |
| 3. B | GO:0016290 | palmitoyl-CoA hydrolase activity |
| 3. B | GO:0014732 | skeletal muscle atrophy |
| 3. B | GO:0019899 | enzyme binding |
| 3. B | GO:1902647 | negative regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process |
| 3. B | GO:0099173 | postsynapse organization |
| 3. B | GO:0051570 | regulation of histone H3-K9 methylation |
| 3. B | GO:0004857 | enzyme inhibitor activity |
| 3. B | GO:2000974 | negative regulation of pro-B cell differentiation |
| 3. B | GO:0060997 | dendritic spine morphogenesis |
| 3. B | GO:0048845 | venous blood vessel morphogenesis |
| 3. B | GO:1901018 | positive regulation of potassium ion transmembrane transporter activity |
| 3. B | GO:0050714 | positive regulation of protein secretion |
| 3. B | GO:0060135 | maternal process involved in female pregnancy |
| 3. B | GO:0031663 | lipopolysaccharide-mediated signaling pathway |
| 3. B | GO:2000311 | regulation of AMPA receptor activity |
| 3. B | GO:0043055 | maintenance of dauer |
| 3. B | GO:0086066 | atrial cardiac muscle cell to AV node cell communication |
| 3. B | GO:1901021 | positive regulation of calcium ion transmembrane transporter activity |
| 3. B | GO:1901224 | positive regulation of NIK/NF-kappaB signaling |
| 3. B | GO:0060253 | negative regulation of glial cell proliferation |
| 3. B | GO:0005925 | focal adhesion |
| 3. B | GO:0050966 | detection of mechanical stimulus involved in sensory perception of pain |
| 3. B | GO:0021707 | cerebellar granule cell differentiation |
| 3. B | GO:0033256 | I-kappaB/NF-kappaB complex |
| 3. B | GO:0014031 | mesenchymal cell development |
| 3. B | GO:0051151 | negative regulation of smooth muscle cell differentiation |
| 3. B | GO:0032991 | protein-containing complex |
| 3. B | GO:0005829 | cytosol |
| 3. B | GO:0046872 | metal ion binding |
| 3. B | GO:0035544 | negative regulation of SNARE complex assembly |
| 3. B | GO:0035508 | positive regulation of myosin-light-chain-phosphatase activity |
| 3. B | GO:0097553 | calcium ion transmembrane import into cytosol |
| 3. B | GO:2000821 | regulation of grooming behavior |
| 3. B | GO:0000139 | Golgi membrane |
| 3. B | GO:0019706 | protein-cysteine S-palmitoyltransferase activity |
| 3. B | GO:0003273 | cell migration involved in endocardial cushion formation |
| 3. B | GO:0051572 | negative regulation of histone H3-K4 methylation |
| 3. B | GO:0030900 | forebrain development |
| 3. B | GO:1903793 | positive regulation of anion transport |
| 3. B | GO:0070168 | negative regulation of biomineral tissue development |
| 3. B | GO:0044354 | macropinosome |
| 3. B | GO:0035507 | regulation of myosin-light-chain-phosphatase activity |
| 3. B | GO:0061344 | regulation of cell adhesion involved in heart morphogenesis |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q2QLC6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 6.39e-07 | 6.44e-04 | 2.33e-05 |
| 1. PB | Q2IBB4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.88e-06 | 4.79e-05 | 7.99e-07 |
| 1. PB | Q8WXI3 | Ankyrin repeat and SOCS box protein 10 | 1.86e-05 | 8.47e-04 | 7.22e-05 |
| 1. PB | P14360 | Putative ankyrin repeat protein FPV240 | NA | 5.97e-03 | 3.77e-08 |
| 1. PB | Q8N9V6 | Ankyrin repeat domain-containing protein 53 | 1.59e-03 | 1.79e-04 | 1.63e-05 |
| 1. PB | Q8VHQ3 | Protein phosphatase 1 regulatory inhibitor subunit 16B | 6.88e-05 | 4.16e-05 | 1.14e-04 |
| 1. PB | Q3U0L2 | Ankyrin repeat domain-containing protein 33B | 7.50e-04 | 1.13e-10 | 0.001 |
| 1. PB | Q09YK6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.80e-07 | 2.61e-04 | 1.45e-06 |
| 1. PB | Q09YN0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 8.20e-05 | 1.31e-03 | 2.26e-07 |
| 1. PB | Q8WMX6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 6.78e-06 | 8.14e-03 | 4.35e-06 |
| 1. PB | Q6S5H5 | POTE ankyrin domain family member G | 3.90e-10 | 9.39e-13 | 0.0 |
| 1. PB | A6NI47 | Putative POTE ankyrin domain family member M | 1.25e-09 | 4.21e-11 | 0.0 |
| 1. PB | Q07DY6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.44e-05 | 2.93e-03 | 6.66e-06 |
| 1. PB | Q8WWH4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 8.21e-06 | 3.65e-03 | 8.07e-06 |
| 1. PB | Q96I34 | Protein phosphatase 1 regulatory subunit 16A | 1.36e-04 | 4.82e-09 | 0.002 |
| 1. PB | Q1RJN6 | Putative ankyrin repeat protein RBE_0347 | 4.49e-05 | 1.08e-02 | 3.24e-06 |
| 1. PB | Q2QL84 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.22e-05 | 5.91e-03 | 4.02e-06 |
| 1. PB | Q07DX6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 6.31e-06 | 1.20e-02 | 3.56e-06 |
| 1. PB | Q14DN9 | Ankyrin repeat and death domain-containing protein 1B | 3.57e-04 | 1.68e-02 | 2.84e-11 |
| 1. PB | O95271 | Poly [ADP-ribose] polymerase tankyrase-1 | 4.20e-02 | 3.89e-03 | 7.52e-13 |
| 1. PB | H3BUK9 | POTE ankyrin domain family member B2 | 2.49e-12 | 2.68e-169 | 0.0 |
| 1. PB | Q2QLG0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 8.56e-06 | 2.15e-04 | 8.18e-07 |
| 1. PB | Q07DV3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.26e-06 | 6.95e-04 | 6.23e-06 |
| 1. PB | Q2QLB5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.79e-07 | 5.16e-04 | 5.19e-07 |
| 1. PB | Q9Z2F6 | B-cell lymphoma 3 protein homolog | 7.01e-06 | 8.93e-03 | 4.55e-08 |
| 1. PB | Q09YI3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.31e-06 | 2.49e-03 | 5.90e-07 |
| 1. PB | Q9WV74 | Ankyrin repeat and SOCS box protein 1 | 1.34e-07 | 9.11e-03 | 2.70e-05 |
| 1. PB | Q8WMX8 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 6.89e-07 | 2.10e-03 | 5.90e-07 |
| 1. PB | Q07E43 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.10e-07 | 1.01e-03 | 3.66e-07 |
| 1. PB | Q07DZ7 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.45e-06 | 1.34e-02 | 6.95e-06 |
| 1. PB | A0A0A6YYL3 | POTE ankyrin domain family member B | 0 | 2.68e-169 | 0.0 |
| 1. PB | Q8WMX7 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 9.08e-07 | 6.03e-03 | 4.31e-06 |
| 1. PB | Q09YH1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 6.70e-06 | 6.12e-05 | 3.48e-07 |
| 1. PB | Q6PFX9 | Poly [ADP-ribose] polymerase tankyrase-1 | 7.01e-04 | 2.02e-03 | 7.98e-13 |
| 1. PB | Q2IBG0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 6.14e-05 | 2.04e-03 | 1.56e-05 |
| 1. PB | Q07E30 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.13e-05 | 7.51e-04 | 4.74e-07 |
| 1. PB | Q96T49 | Protein phosphatase 1 regulatory inhibitor subunit 16B | 5.41e-06 | 6.65e-05 | 6.52e-05 |
| 1. PB | Q6S8J7 | POTE ankyrin domain family member A | 2.43e-10 | 5.12e-33 | 0.0 |
| 1. PB | Q2QLA4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 7.52e-07 | 9.35e-04 | 8.81e-07 |
| 1. PB | Q3KP44 | Ankyrin repeat domain-containing protein 55 | 8.53e-06 | 1.97e-03 | 1.02e-11 |
| 1. PB | Q91ZT7 | Ankyrin repeat and SOCS box protein 10 | 2.88e-05 | 1.52e-03 | 2.95e-08 |
| 1. PB | Q09YJ5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 4.42e-08 | 2.80e-03 | 3.74e-06 |
| 1. PB | A6NHY2 | Ankyrin repeat and death domain-containing protein 1B | 3.67e-05 | 1.47e-02 | 4.31e-10 |
| 1. PB | Q9Y576 | Ankyrin repeat and SOCS box protein 1 | 1.73e-07 | 3.60e-02 | 1.05e-05 |
| 1. PB | Q00PJ3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.48e-07 | 6.02e-04 | 9.94e-06 |
| 1. PB | Q6S545 | POTE ankyrin domain family member H | 1.74e-09 | 1.11e-04 | 0.0 |
| 1. PB | A6NCL7 | Ankyrin repeat domain-containing protein 33B | 3.32e-03 | 2.02e-07 | 3.72e-04 |
| 1. PB | A1X154 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.96e-05 | 2.99e-02 | 4.44e-07 |
| 1. PB | Q95N27 | Protein phosphatase 1 regulatory inhibitor subunit 16B | 1.81e-05 | 2.65e-05 | 1.14e-04 |
| 1. PB | Q3UMT1 | Protein phosphatase 1 regulatory subunit 12C | 3.20e-04 | 2.58e-02 | 1.47e-04 |
| 1. PB | Q71S21 | Inversin-B | 4.79e-05 | 4.65e-02 | 1.81e-16 |
| 1. PB | P20749 | B-cell lymphoma 3 protein | 1.48e-05 | 5.49e-03 | 1.04e-15 |
| 1. PB | Q8BLD6 | Ankyrin repeat domain-containing protein 55 | 5.92e-04 | 4.05e-02 | 4.96e-11 |
| 1. PB | Q2QLH1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.38e-07 | 2.88e-04 | 6.27e-06 |
| 1. PB | Q3V096 | Ankyrin repeat domain-containing protein 42 | 6.48e-08 | 3.85e-13 | 1.64e-05 |
| 1. PB | B2RU33 | POTE ankyrin domain family member C | 2.09e-11 | 4.24e-47 | 0.0 |
| 1. PB | Q4R739 | Ankyrin repeat domain-containing protein 53 | 8.05e-03 | 1.89e-02 | 5.85e-04 |
| 1. PB | Q07E17 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 4.37e-07 | 3.46e-03 | 1.53e-06 |
| 1. PB | Q3V0J4 | Ankyrin repeat domain-containing protein 53 | 9.32e-04 | 2.20e-02 | 6.30e-06 |
| 1. PB | Q2IBF5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.89e-06 | 1.18e-02 | 2.79e-06 |
| 1. PB | Q6NSI1 | Putative ankyrin repeat domain-containing protein 26-like protein | 8.98e-06 | 1.92e-17 | 6.94e-65 |
| 1. PB | Q63369 | Nuclear factor NF-kappa-B p105 subunit (Fragment) | 5.16e-04 | 1.62e-07 | 1.76e-07 |
| 1. PB | Q108U1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.07e-06 | 1.02e-04 | 7.59e-06 |
| 1. PB | Q2IBE3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.33e-06 | 1.61e-02 | 3.32e-06 |
| 1. PB | Q9VBP3 | Poly [ADP-ribose] polymerase tankyrase | 2.14e-03 | 1.34e-02 | 1.62e-10 |
| 1. PB | A0M8T3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.92e-06 | 8.38e-04 | 5.69e-06 |
| 1. PB | A4D7T3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.86e-05 | 1.64e-02 | 1.14e-06 |
| 1. PB | A0JP26 | POTE ankyrin domain family member B3 | 1.29e-12 | 7.45e-68 | 0.0 |
| 1. PB | P41412 | Cell division cycle-related protein res2/pct1 | 2.13e-03 | 1.28e-03 | 0.005 |
| 1. PB | Q86YR6 | POTE ankyrin domain family member D | 8.88e-16 | 4.01e-69 | 0.0 |
| 1. PB | Q8VD46 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.59e-07 | 5.32e-05 | 4.09e-06 |
| 1. PB | Q2IBB1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.04e-04 | 5.00e-03 | 4.02e-06 |
| 1. PB | Q923M0 | Protein phosphatase 1 regulatory subunit 16A | 2.51e-05 | 2.55e-11 | 4.97e-04 |
| 2. P | B4E2M5 | Ankyrin repeat domain-containing protein 66 | 1.44e-03 | 4.60e-02 | NA |
| 2. P | Q6ZN66 | Guanylate-binding protein 6 | 2.29e-01 | 3.20e-02 | NA |
| 2. P | Q6P1H6 | Ankyrin repeat and LEM domain-containing protein 2 | 2.15e-01 | 3.23e-02 | NA |
| 2. P | P09959 | Regulatory protein SWI6 | 1.04e-03 | 4.80e-03 | NA |
| 2. P | Q61107 | Guanylate-binding protein 4 | 7.48e-02 | 1.66e-02 | NA |
| 2. P | Q5TZF3 | Ankyrin repeat domain-containing protein 45 | 1.73e-04 | 9.49e-03 | NA |
| 2. P | Q7Z3H0 | Photoreceptor ankyrin repeat protein | 9.05e-04 | 3.31e-10 | NA |
| 2. P | Q1RJ94 | Putative ankyrin repeat protein RBE_0489 | 7.64e-05 | 2.06e-03 | NA |
| 2. P | H2KZB2 | Ankyrin repeat and LEM domain-containing protein 2 homolog | 7.66e-02 | 4.78e-02 | NA |
| 2. P | Q810N6 | Ankyrin repeat domain-containing protein 45 | 3.65e-05 | 1.16e-02 | NA |
| 2. P | Q86XL3 | Ankyrin repeat and LEM domain-containing protein 2 | 6.89e-02 | 5.55e-03 | NA |
| 2. P | P33520 | Cell division cycle-related protein res1/sct1 | 6.52e-04 | 4.79e-05 | NA |
| 2. P | Q99ME3 | Synphilin-1 | 2.65e-03 | 7.12e-03 | NA |
| 2. P | Q83DF6 | Putative ankyrin repeat protein CBU_0781 | 1.59e-05 | 3.28e-07 | NA |
| 3. B | Q9H560 | Putative ankyrin repeat domain-containing protein 19 | 2.70e-14 | NA | 2.51e-69 |
| 3. B | Q8VHS6 | Ankyrin repeat and SOCS box protein 15 | 5.69e-04 | NA | 4.73e-10 |
| 3. B | Q8BX02 | KN motif and ankyrin repeat domain-containing protein 2 | 6.75e-04 | NA | 3.19e-08 |
| 3. B | P20632 | Interferon antagonist K1L | NA | NA | 0.007 |
| 3. B | Q1RGM2 | Putative ankyrin repeat protein RBE_1411 | 1.21e-03 | NA | 0.044 |
| 3. B | Q9J5H9 | Putative ankyrin repeat protein FPV022 | NA | NA | 1.24e-06 |
| 3. B | Q8IUH5 | Palmitoyltransferase ZDHHC17 | 4.20e-05 | NA | 1.71e-11 |
| 3. B | Q54KA7 | Ankyrin repeat, PH and SEC7 domain containing protein secG | 8.02e-05 | NA | 3.37e-25 |
| 3. B | Q0V8G2 | GA-binding protein subunit beta-2 | 9.61e-06 | NA | 3.52e-06 |
| 3. B | Q3MJ40 | Coiled-coil domain-containing protein 144B | 1.36e-02 | NA | 9.22e-08 |
| 3. B | P59672 | Ankyrin repeat and SAM domain-containing protein 1A | 1.59e-03 | NA | 1.81e-08 |
| 3. B | Q6AFL2 | Putative ankyrin-containing lipoprotein Lxx09580 | 2.48e-07 | NA | 1.28e-06 |
| 3. B | O14974 | Protein phosphatase 1 regulatory subunit 12A | 1.02e-03 | NA | 1.11e-04 |
| 3. B | Q99NH0 | Ankyrin repeat domain-containing protein 17 | 2.33e-02 | NA | 6.46e-14 |
| 3. B | A9JR78 | Tonsoku-like protein | 5.57e-02 | NA | 2.26e-05 |
| 3. B | P57078 | Receptor-interacting serine/threonine-protein kinase 4 | 2.50e-03 | NA | 3.72e-13 |
| 3. B | Q6P9J5 | KN motif and ankyrin repeat domain-containing protein 4 | 3.49e-04 | NA | 3.84e-09 |
| 3. B | Q499M5 | Ankyrin repeat domain-containing protein 16 | 5.99e-12 | NA | 6.50e-08 |
| 3. B | Q9Y575 | Ankyrin repeat and SOCS box protein 3 | 9.01e-05 | NA | 7.50e-13 |
| 3. B | Q1LZC5 | Ankyrin repeat domain-containing protein 54 | 1.37e-04 | NA | 3.99e-10 |
| 3. B | P0C6P7 | Protein fem-1 homolog B | 7.63e-06 | NA | 8.93e-10 |
| 3. B | Q8CEF1 | Protein fem-1 homolog C | 1.26e-05 | NA | 6.57e-07 |
| 3. B | Q4FE45 | E3 ubiquitin-protein ligase XBAT33 | 1.07e-05 | NA | 2.41e-05 |
| 3. B | Q9J5H8 | Putative ankyrin repeat protein FPV023 | NA | NA | 4.71e-10 |
| 3. B | D3J162 | Protein VAPYRIN | 6.29e-06 | NA | 6.39e-11 |
| 3. B | Q0P5B9 | Ankyrin repeat domain-containing protein 39 | 2.74e-07 | NA | 2.82e-06 |
| 3. B | Q4UJ75 | Putative ankyrin repeat domain-containing protein 20A4 | 7.28e-09 | NA | 6.28e-62 |
| 3. B | Q06527 | Ankyrin homolog | 5.86e-08 | NA | 1.09e-17 |
| 3. B | Q9UM47 | Neurogenic locus notch homolog protein 3 | 1.15e-01 | NA | 8.47e-08 |
| 3. B | Q8N7Z5 | Ankyrin repeat domain-containing protein 31 | 8.32e-02 | NA | 2.01e-05 |
| 3. B | Q01317 | Ankyrin repeat protein nuc-2 | 6.31e-04 | NA | 1.55e-08 |
| 3. B | Q566C8 | Ankyrin repeat domain-containing protein 54 | 2.03e-03 | NA | 5.65e-10 |
| 3. B | Q641X1 | Ankyrin repeat domain-containing protein 61 | 2.41e-06 | NA | 7.10e-09 |
| 3. B | P14585 | Protein lin-12 | 6.28e-03 | NA | 5.95e-08 |
| 3. B | O14593 | DNA-binding protein RFXANK | 9.61e-06 | NA | 6.58e-10 |
| 3. B | Q8LSQ2 | Probable signal recognition particle 43 kDa protein, chloroplastic | 4.08e-03 | NA | 0.008 |
| 3. B | Q9H1D0 | Transient receptor potential cation channel subfamily V member 6 | 1.14e-03 | NA | 3.49e-05 |
| 3. B | Q9UPQ3 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 | 2.06e-01 | NA | 0.007 |
| 3. B | Q99466 | Neurogenic locus notch homolog protein 4 | 2.46e-02 | NA | 3.88e-08 |
| 3. B | P13264 | Glutaminase kidney isoform, mitochondrial | 2.29e-01 | NA | 0.017 |
| 3. B | Q8K4M9 | Oxysterol-binding protein-related protein 1 | 3.59e-04 | NA | 3.07e-07 |
| 3. B | Q07E41 | Cortactin-binding protein 2 | 6.82e-02 | NA | 2.49e-09 |
| 3. B | P62774 | Myotrophin | 5.46e-09 | NA | 2.57e-04 |
| 3. B | Q9Z2X2 | 26S proteasome non-ATPase regulatory subunit 10 | 2.22e-16 | NA | 6.34e-13 |
| 3. B | P97819 | 85/88 kDa calcium-independent phospholipase A2 | 3.50e-04 | NA | 3.31e-14 |
| 3. B | Q9WV06 | Ankyrin repeat domain-containing protein 2 | 2.13e-06 | NA | 1.21e-10 |
| 3. B | Q02357 | Ankyrin-1 | 1.54e-02 | NA | 2.78e-14 |
| 3. B | O44997 | Death-associated protein kinase dapk-1 | 3.19e-03 | NA | 4.51e-07 |
| 3. B | Q14161 | ARF GTPase-activating protein GIT2 | 7.27e-02 | NA | 0.032 |
| 3. B | Q4ULZ2 | Putative ankyrin repeat protein RF_0580 | 1.04e-07 | NA | 3.78e-09 |
| 3. B | Q8N8A2 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 8.88e-04 | NA | 1.41e-19 |
| 3. B | Q9D504 | Ankyrin repeat domain-containing protein 7 | 1.52e-13 | NA | 4.69e-59 |
| 3. B | Q9NU02 | Ankyrin repeat and EF-hand domain-containing protein 1 | 2.17e-04 | NA | 1.47e-08 |
| 3. B | Q29RM5 | Protein fem-1 homolog A | 2.47e-05 | NA | 6.57e-04 |
| 3. B | Q5TYM7 | CARD- and ANK-domain containing inflammasome adapter protein | 1.36e-04 | NA | 1.84e-11 |
| 3. B | B2FKA7 | Actin-binding protein Smlt3054 | 1.07e-03 | NA | 9.00e-04 |
| 3. B | Q5U312 | Ankycorbin | 2.94e-07 | NA | 2.64e-17 |
| 3. B | Q21920 | Ankyrin repeat and KH domain-containing protein mask-1 | 4.66e-02 | NA | 5.02e-12 |
| 3. B | Q65XV2 | E3 ubiquitin-protein ligase XB3 | 1.66e-06 | NA | 7.95e-11 |
| 3. B | Q5R6D7 | Ankyrin repeat and SOCS box protein 8 | 5.41e-08 | NA | 2.51e-10 |
| 3. B | S0DPL8 | Apicidin F cluster transcription factor apf2 | 1.51e-03 | NA | 1.73e-07 |
| 3. B | Q8IV38 | Ankyrin repeat and MYND domain-containing protein 2 | 3.51e-05 | NA | 0.004 |
| 3. B | A1ZBY1 | Protein fem-1 homolog B | 4.22e-04 | NA | 1.70e-07 |
| 3. B | Q08353 | NF-kappa-B inhibitor alpha | 1.09e-07 | NA | 4.91e-05 |
| 3. B | Q554E7 | Putative ZDHHC-type palmitoyltransferase 5 | 3.67e-04 | NA | 1.44e-06 |
| 3. B | A6QL64 | Ankyrin repeat domain-containing protein 36A | 3.75e-04 | NA | 9.11e-62 |
| 3. B | Q9VUX2 | E3 ubiquitin-protein ligase mind-bomb | 2.11e-04 | NA | 2.99e-13 |
| 3. B | A2RT91 | Ankyrin and armadillo repeat-containing protein | 2.28e-02 | NA | 0.008 |
| 3. B | P53356 | Tyrosine-protein kinase HTK16 | 3.33e-02 | NA | 0.003 |
| 3. B | Q4JHE0 | Probable E3 ubiquitin-protein ligase XBOS36 | 9.32e-06 | NA | 0.015 |
| 3. B | Q9SQK3 | Ankyrin repeat domain-containing protein EMB506, chloroplastic | 3.49e-06 | NA | 4.91e-10 |
| 3. B | Q7T0Q1 | Myotrophin | 1.65e-08 | NA | 2.30e-05 |
| 3. B | Q8LPS2 | Protein ACCELERATED CELL DEATH 6 | 1.92e-04 | NA | 0.021 |
| 3. B | Q6P6B7 | Ankyrin repeat domain-containing protein 16 | 7.55e-09 | NA | 9.61e-08 |
| 3. B | A2AQH4 | BCL-6 corepressor-like protein 1 | 2.58e-01 | NA | 0.002 |
| 3. B | O70511 | Ankyrin-3 | 1.10e-02 | NA | 6.17e-18 |
| 3. B | Q90623 | Protein phosphatase 1 regulatory subunit 12A | 2.08e-03 | NA | 3.20e-05 |
| 3. B | Q3U0D9 | E3 ubiquitin-protein ligase HACE1 | 8.59e-03 | NA | 8.88e-13 |
| 3. B | Q5R8C8 | Ankyrin repeat domain-containing protein 46 | 8.88e-06 | NA | 0.007 |
| 3. B | Q9Z2X3 | 26S proteasome non-ATPase regulatory subunit 10 | 2.22e-16 | NA | 9.70e-13 |
| 3. B | P24769 | Ankyrin repeat protein B4 | NA | NA | 2.06e-05 |
| 3. B | Q9TXQ1 | Poly [ADP-ribose] polymerase tankyrase | 4.07e-02 | NA | 3.72e-07 |
| 3. B | Q7Z8U2 | Palmitoyltransferase akr1 | 1.03e-05 | NA | 2.35e-09 |
| 3. B | Q5UPE2 | Putative ankyrin repeat protein L63 | NA | NA | 0.013 |
| 3. B | Q7T163 | Kinase D-interacting substrate of 220 kDa B | 8.99e-04 | NA | 7.12e-17 |
| 3. B | Q9NQA5 | Transient receptor potential cation channel subfamily V member 5 | 1.40e-04 | NA | 3.94e-05 |
| 3. B | Q68DC2 | Ankyrin repeat and SAM domain-containing protein 6 | 2.06e-04 | NA | 1.91e-11 |
| 3. B | Q9J505 | Putative ankyrin repeat protein FPV230 | NA | NA | 1.05e-07 |
| 3. B | Q7XUW4 | Potassium channel KOR2 | 6.23e-04 | NA | 5.77e-12 |
| 3. B | Q6RI86 | Transient receptor potential cation channel subfamily A member 1 | 4.76e-03 | NA | 8.76e-10 |
| 3. B | Q1RMI3 | GA-binding protein subunit beta-1 | 7.32e-08 | NA | 4.52e-09 |
| 3. B | Q9WV48 | SH3 and multiple ankyrin repeat domains protein 1 | 3.05e-02 | NA | 2.65e-07 |
| 3. B | Q8N2N9 | Ankyrin repeat domain-containing protein 36B | 1.56e-04 | NA | 3.12e-64 |
| 3. B | Q6BP80 | Palmitoyltransferase AKR1 | 8.21e-04 | NA | 1.30e-05 |
| 3. B | D3J163 | Protein VAPYRIN-LIKE | 3.61e-03 | NA | 3.41e-04 |
| 3. B | Q10311 | Ankyrin repeat-containing protein C6C3.08 | 3.17e-13 | NA | 5.01e-08 |
| 3. B | A2A690 | Protein TANC2 | 1.40e-02 | NA | 6.70e-12 |
| 3. B | A5A3E0 | POTE ankyrin domain family member F | 1.29e-06 | NA | 0.0 |
| 3. B | Q07DW4 | Cortactin-binding protein 2 | 1.74e-02 | NA | 3.74e-10 |
| 3. B | Q6KAE5 | Probable E3 ubiquitin-protein ligase XBOS32 | 1.68e-05 | NA | 5.52e-09 |
| 3. B | Q4R3S3 | Ankyrin repeat domain-containing protein 7 | 4.51e-12 | NA | 3.45e-57 |
| 3. B | Q6FJ70 | Palmitoyltransferase AKR1 | 1.10e-05 | NA | 9.63e-05 |
| 3. B | Q38898 | Potassium channel AKT2/3 | 1.07e-02 | NA | 8.74e-08 |
| 3. B | Q8VHH5 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 | 2.78e-01 | NA | 1.41e-05 |
| 3. B | Q8CGN4 | BCL-6 corepressor | 7.34e-01 | NA | 0.001 |
| 3. B | Q61982 | Neurogenic locus notch homolog protein 3 | 2.21e-02 | NA | 6.66e-08 |
| 3. B | Q7T3P8 | Protein fem-1 homolog C | 2.42e-06 | NA | 1.79e-06 |
| 3. B | Q5UPX1 | Putative ankyrin repeat protein L289 | NA | NA | 2.26e-05 |
| 3. B | P17221 | Sex-determining protein fem-1 | 1.55e-05 | NA | 1.82e-07 |
| 3. B | Q8BXP5 | Photoreceptor ankyrin repeat protein | 1.31e-04 | NA | 1.39e-06 |
| 3. B | O83515 | Putative ankyrin repeat-containing protein TP_0502 | 3.11e-05 | NA | 4.61e-05 |
| 3. B | A7MB89 | Protein fem-1 homolog C | 4.62e-04 | NA | 6.13e-07 |
| 3. B | Q9WTT2 | Caseinolytic peptidase B protein homolog | 1.06e-01 | NA | 1.71e-04 |
| 3. B | Q9D2J7 | Ankyrin repeat and EF-hand domain-containing protein 1 | 1.19e-04 | NA | 4.15e-07 |
| 3. B | Q9D119 | Protein phosphatase 1 regulatory subunit 27 | 8.98e-05 | NA | 6.23e-04 |
| 3. B | Q5UQF1 | Putative ankyrin repeat protein L483 | NA | NA | 0.034 |
| 3. B | Q9H2K2 | Poly [ADP-ribose] polymerase tankyrase-2 | 3.53e-02 | NA | 3.26e-12 |
| 3. B | Q9D061 | Acyl-CoA-binding domain-containing protein 6 | 6.78e-04 | NA | 1.75e-06 |
| 3. B | Q2TB02 | NF-kappa-B inhibitor delta | 1.26e-07 | NA | 3.27e-04 |
| 3. B | Q8VHA6 | Ankyrin repeat and SOCS box protein 18 | 6.39e-05 | NA | 4.72e-04 |
| 3. B | Q9BXX2 | Ankyrin repeat domain-containing protein 30B | 3.56e-04 | NA | 8.64e-63 |
| 3. B | Q06547 | GA-binding protein subunit beta-1 | 6.46e-07 | NA | 2.55e-08 |
| 3. B | P55273 | Cyclin-dependent kinase 4 inhibitor D | 1.56e-09 | NA | 3.71e-04 |
| 3. B | Q5RCK5 | Ankyrin repeat and SOCS box protein 7 | 9.07e-08 | NA | 4.70e-14 |
| 3. B | Q8UVC1 | Inversin | 1.59e-05 | NA | 5.02e-17 |
| 3. B | Q5SQ80 | Putative ankyrin repeat domain-containing protein 20A2 | 1.36e-08 | NA | 1.96e-62 |
| 3. B | Q8GSP8 | Zygote-specific protein 3 | 3.46e-02 | NA | 0.001 |
| 3. B | Q2IBD4 | Cortactin-binding protein 2 | 8.80e-02 | NA | 9.73e-07 |
| 3. B | P0CG39 | POTE ankyrin domain family member J | 7.17e-07 | NA | 0.0 |
| 3. B | P46530 | Neurogenic locus notch homolog protein 1 | 1.95e-01 | NA | 1.11e-06 |
| 3. B | Q6ZVZ8 | Ankyrin repeat and SOCS box protein 18 | 1.78e-05 | NA | 1.23e-05 |
| 3. B | Q6TGW5 | Osteoclast-stimulating factor 1 | 4.81e-07 | NA | 0.004 |
| 3. B | Q63618 | Espin | 1.62e-05 | NA | 1.14e-08 |
| 3. B | P69744 | Transient receptor potential cation channel subfamily V member 5 | 9.01e-05 | NA | 0.004 |
| 3. B | Q1RIZ4 | Putative ankyrin repeat protein RBE_0589 | 2.78e-05 | NA | 2.21e-04 |
| 3. B | B9EJA2 | Cortactin-binding protein 2 | 3.93e-02 | NA | 8.38e-08 |
| 3. B | Q8MJ50 | Osteoclast-stimulating factor 1 | 7.82e-04 | NA | 0.040 |
| 3. B | Q8CGB3 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 5.06e-05 | NA | 2.71e-16 |
| 3. B | Q8IWB6 | Inactive serine/threonine-protein kinase TEX14 | 3.45e-01 | NA | 0.006 |
| 3. B | Q3UES3 | Poly [ADP-ribose] polymerase tankyrase-2 | 1.03e-04 | NA | 7.75e-12 |
| 3. B | A5WVX9 | Palmitoyltransferase ZDHHC17 | 1.59e-07 | NA | 8.99e-12 |
| 3. B | Q9J504 | Putative ankyrin repeat protein FPV231 | NA | NA | 2.25e-13 |
| 3. B | Q91ZT9 | Ankyrin repeat and SOCS box protein 8 | 2.13e-08 | NA | 2.49e-10 |
| 3. B | P40578 | Protein MGA2 | 5.05e-02 | NA | 7.94e-06 |
| 3. B | Q6W2J9 | BCL-6 corepressor | 4.04e-01 | NA | 0.001 |
| 3. B | P0DSS9 | Ankyrin repeat protein B4 | NA | NA | 2.56e-04 |
| 3. B | Q9Y2G4 | Ankyrin repeat domain-containing protein 6 | 9.49e-08 | NA | 2.51e-18 |
| 3. B | Q58CT0 | Dynein axonemal heavy chain 12 | 1.95e-04 | NA | 0.006 |
| 3. B | F1LTE0 | Protein TANC2 | 4.97e-03 | NA | 5.49e-12 |
| 3. B | B1AK53 | Espin | 8.32e-05 | NA | 1.03e-11 |
| 3. B | Q9ERC1 | Unconventional myosin-XVI | 1.45e-01 | NA | 5.49e-08 |
| 3. B | Q9P2R3 | Rabankyrin-5 | 2.74e-03 | NA | 2.60e-13 |
| 3. B | Q8BZ25 | Ankyrin repeat and protein kinase domain-containing protein 1 | 1.59e-05 | NA | 1.31e-17 |
| 3. B | Q8UVC3 | Inversin | 3.62e-03 | NA | 2.04e-14 |
| 3. B | P13508 | Protein glp-1 | 6.47e-04 | NA | 1.96e-04 |
| 3. B | Q9SCX5 | Probable potassium channel AKT5 | 1.96e-03 | NA | 8.60e-13 |
| 3. B | Q05823 | 2-5A-dependent ribonuclease | 3.87e-04 | NA | 3.84e-11 |
| 3. B | P57044 | Integrin-linked protein kinase | 4.96e-04 | NA | 2.10e-09 |
| 3. B | Q8ZWC4 | Putative ankyrin repeat protein PAE1861 | 3.23e-12 | NA | 1.18e-11 |
| 3. B | Q91XL9 | Oxysterol-binding protein-related protein 1 | 5.33e-05 | NA | 6.22e-06 |
| 3. B | O54910 | NF-kappa-B inhibitor epsilon | 1.20e-05 | NA | 1.72e-08 |
| 3. B | Q75HP9 | Potassium channel AKT2 | 1.35e-02 | NA | 5.87e-08 |
| 3. B | Q4X251 | Palmitoyltransferase akr1 | 1.52e-03 | NA | 7.12e-10 |
| 3. B | Q12013 | Probable palmitoyltransferase AKR2 | 5.96e-05 | NA | 7.48e-06 |
| 3. B | Q08E43 | Ankyrin repeat and SOCS box protein 8 | 1.71e-08 | NA | 1.66e-10 |
| 3. B | Q5UPG6 | Putative ankyrin repeat protein L92 | NA | NA | 2.03e-05 |
| 3. B | Q75HA6 | BTB/POZ domain and ankyrin repeat-containing protein NPR3 | 6.17e-03 | NA | 0.011 |
| 3. B | Q1RK82 | Putative ankyrin repeat protein RBE_0151 | 2.49e-06 | NA | 0.003 |
| 3. B | Q8VBX0 | Ankyrin repeat and SOCS box protein 13 | 2.44e-14 | NA | 1.14e-10 |
| 3. B | B7WN72 | Protein shank | 7.63e-04 | NA | 4.20e-07 |
| 3. B | Q9Z205 | DNA-binding protein RFXANK | 5.50e-07 | NA | 8.84e-10 |
| 3. B | Q9BXW6 | Oxysterol-binding protein-related protein 1 | 3.69e-03 | NA | 1.84e-06 |
| 3. B | Q14678 | KN motif and ankyrin repeat domain-containing protein 1 | 1.16e-02 | NA | 4.81e-05 |
| 3. B | Q00653 | Nuclear factor NF-kappa-B p100 subunit | 1.49e-04 | NA | 5.16e-08 |
| 3. B | P46683 | Ankyrin repeat-containing protein YAR1 | 1.92e-05 | NA | 0.005 |
| 3. B | Q5ZLC8 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 6.27e-04 | NA | 1.63e-16 |
| 3. B | Q68LP1 | E3 ubiquitin-protein ligase MIB2 | 4.72e-05 | NA | 5.79e-11 |
| 3. B | Q01484 | Ankyrin-2 | NA | NA | 1.88e-18 |
| 3. B | Q9UK73 | Protein fem-1 homolog B | 3.67e-06 | NA | 9.08e-10 |
| 3. B | F8W2M1 | E3 ubiquitin-protein ligase HACE1 | 1.79e-03 | NA | 4.73e-14 |
| 3. B | Q9WV71 | Ankyrin repeat and SOCS box protein 4 | 8.67e-05 | NA | 9.73e-10 |
| 3. B | Q9J513 | Putative ankyrin repeat protein FPV222 | NA | NA | 1.95e-08 |
| 3. B | Q9DBR7 | Protein phosphatase 1 regulatory subunit 12A | 3.37e-04 | NA | 1.04e-04 |
| 3. B | Q9U518 | L-asparaginase | 1.01e-05 | NA | 6.28e-04 |
| 3. B | Q9Y283 | Inversin | 7.56e-05 | NA | 1.19e-14 |
| 3. B | Q9J512 | Putative ankyrin repeat protein FPV223 | NA | NA | 4.31e-07 |
| 3. B | Q495B1 | Ankyrin repeat and death domain-containing protein 1A | 2.75e-07 | NA | 6.05e-18 |
| 3. B | Q9M8S6 | Potassium channel SKOR | 2.02e-03 | NA | 5.39e-12 |
| 3. B | Q9ULH0 | Kinase D-interacting substrate of 220 kDa | 1.18e-02 | NA | 5.77e-18 |
| 3. B | G3I6Z6 | Neurogenic locus notch homolog protein 1 | NA | NA | 5.48e-07 |
| 3. B | Q9BGT9 | Ankyrin repeat and SOCS box protein 7 | 1.74e-07 | NA | 1.13e-13 |
| 3. B | Q5XJ13 | Ankyrin repeat and SAM domain-containing protein 6 | 3.44e-06 | NA | 2.02e-05 |
| 3. B | O70445 | BRCA1-associated RING domain protein 1 | 5.21e-02 | NA | 5.67e-04 |
| 3. B | Q4UKJ3 | Putative ankyrin repeat protein RF_1087 | 6.70e-05 | NA | 5.01e-06 |
| 3. B | Q5UPG5 | Putative ankyrin repeat protein L93 | NA | NA | 4.49e-17 |
| 3. B | Q86SG2 | Ankyrin repeat domain-containing protein 23 | 2.05e-06 | NA | 9.51e-12 |
| 3. B | Q9WV72 | Ankyrin repeat and SOCS box protein 3 | 9.43e-07 | NA | 1.46e-11 |
| 3. B | Q9J502 | Putative ankyrin repeat protein FPV233 | NA | NA | 5.89e-11 |
| 3. B | Q91WK7 | Ankyrin repeat domain-containing protein 54 | 2.34e-04 | NA | 4.70e-10 |
| 3. B | Q876L4 | Probable palmitoyltransferase AKR2 | 6.44e-06 | NA | 3.21e-05 |
| 3. B | Q5U2S6 | Ankyrin repeat and SOCS box protein 2 | 6.74e-05 | NA | 3.75e-14 |
| 3. B | Q80SY4 | E3 ubiquitin-protein ligase MIB1 | 8.22e-05 | NA | 1.95e-13 |
| 3. B | Q876L5 | Palmitoyltransferase AKR1 | 2.98e-03 | NA | 9.75e-08 |
| 3. B | Q4I8B6 | Palmitoyltransferase AKR1 | 4.43e-06 | NA | 4.34e-10 |
| 3. B | P16157 | Ankyrin-1 | 2.00e-03 | NA | 2.25e-14 |
| 3. B | Q5VUR7 | Putative ankyrin repeat domain-containing protein 20A3 | 9.48e-10 | NA | 2.38e-62 |
| 3. B | O88202 | 60 kDa lysophospholipase | 4.79e-03 | NA | 0.001 |
| 3. B | Q502M6 | Ankyrin repeat domain-containing protein 29 | 1.21e-13 | NA | 1.72e-10 |
| 3. B | A4II29 | Notch-regulated ankyrin repeat-containing protein | 9.54e-05 | NA | 0.010 |
| 3. B | Q337A0 | Probable E3 ubiquitin-protein ligase XBOS33 | 2.81e-05 | NA | 0.002 |
| 3. B | Q6S8J3 | POTE ankyrin domain family member E | 3.37e-10 | NA | 0.0 |
| 3. B | P0C0T2 | Ankyrin repeat and SAM domain-containing protein 6 | 1.56e-03 | NA | 2.80e-15 |
| 3. B | Q0VGY8 | Protein TANC1 | 1.77e-03 | NA | 1.19e-13 |
| 3. B | Q9UI32 | Glutaminase liver isoform, mitochondrial | 3.16e-02 | NA | 0.006 |
| 3. B | G0LXV8 | Alpha-latrotoxin-Lh1a (Fragment) | 2.77e-03 | NA | 7.60e-12 |
| 3. B | Q8WWX0 | Ankyrin repeat and SOCS box protein 5 | 3.78e-09 | NA | 0.038 |
| 3. B | Q15027 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 | 3.46e-02 | NA | 0.040 |
| 3. B | Q9Y566 | SH3 and multiple ankyrin repeat domains protein 1 | 1.41e-01 | NA | 6.12e-08 |
| 3. B | Q653P0 | Potassium channel KOR1 | 4.43e-03 | NA | 2.00e-10 |
| 3. B | Q9J5I3 | Putative ankyrin repeat protein FPV018 | NA | NA | 1.49e-06 |
| 3. B | Q94B55 | Putative E3 ubiquitin-protein ligase XBAT31 | 2.00e-06 | NA | 2.86e-10 |
| 3. B | Q6P1S6 | Myotrophin | 5.46e-09 | NA | 1.51e-06 |
| 3. B | C7B178 | Protein VAPYRIN | 4.08e-04 | NA | 2.99e-13 |
| 3. B | Q5R4M7 | Ankyrin repeat and SOCS box protein 6 | 1.73e-04 | NA | 1.06e-06 |
| 3. B | Q875M2 | Palmitoyltransferase AKR1 | 4.96e-05 | NA | 4.38e-05 |
| 3. B | Q8VHK2 | Caskin-1 | 1.49e-03 | NA | 3.28e-12 |
| 3. B | Q9R172 | Neurogenic locus notch homolog protein 3 | 2.10e-01 | NA | 8.12e-08 |
| 3. B | Q29Q26 | Ankyrin repeat domain-containing protein 2B | 6.56e-04 | NA | 4.21e-05 |
| 3. B | Q5JPF3 | Ankyrin repeat domain-containing protein 36C | 7.27e-04 | NA | 2.11e-65 |
| 3. B | Q6DGX3 | Ankyrin repeat domain-containing protein 54 | 1.60e-04 | NA | 1.54e-09 |
| 3. B | Q9P0K7 | Ankycorbin | 7.68e-07 | NA | 7.48e-17 |
| 3. B | Q4P6L3 | Palmitoyltransferase AKR1 | 3.18e-04 | NA | 7.49e-09 |
| 3. B | Q7Z020 | Transient receptor potential cation channel subfamily A member 1 | 1.47e-02 | NA | 0.003 |
| 3. B | Q96AX9 | E3 ubiquitin-protein ligase MIB2 | 3.12e-04 | NA | 1.24e-10 |
| 3. B | A0A3L7I2I8 | 85/88 kDa calcium-independent phospholipase A2 | 3.96e-04 | NA | 3.51e-14 |
| 3. B | Q5DU14 | Unconventional myosin-XVI | 7.37e-03 | NA | 1.96e-08 |
| 3. B | Q5UPH0 | Putative ankyrin repeat protein L100 | NA | NA | 0.003 |
| 3. B | Q7Z5J8 | Ankyrin and armadillo repeat-containing protein | 1.82e-02 | NA | 0.020 |
| 3. B | Q5UQY4 | Putative ankyrin repeat protein R886 (Fragment) | NA | NA | 5.28e-07 |
| 3. B | Q6F3J0 | Nuclear factor NF-kappa-B p105 subunit | 2.14e-03 | NA | 3.11e-04 |
| 3. B | Q8N9B4 | Ankyrin repeat domain-containing protein 42 | 7.36e-06 | NA | 2.33e-04 |
| 3. B | Q15653 | NF-kappa-B inhibitor beta | 1.47e-06 | NA | 3.37e-04 |
| 3. B | O00522 | Krev interaction trapped protein 1 | 9.71e-02 | NA | 0.024 |
| 3. B | Q07E28 | Cortactin-binding protein 2 | 2.18e-02 | NA | 5.34e-09 |
| 3. B | Q5H9F3 | BCL-6 corepressor-like protein 1 | 4.32e-01 | NA | 0.030 |
| 3. B | Q8WXK3 | Ankyrin repeat and SOCS box protein 13 | 3.33e-14 | NA | 2.09e-10 |
| 3. B | Q96P64 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 4 | 9.49e-02 | NA | 0.013 |
| 3. B | Q55A55 | Probable serine/threonine-protein kinase DDB_G0272092 | 2.65e-03 | NA | 2.17e-04 |
| 3. B | Q5TYW2 | Ankyrin repeat domain-containing protein 20A1 | 2.87e-08 | NA | 5.85e-62 |
| 3. B | Q5GIG6 | Serine/threonine-protein kinase TNNI3K | 1.43e-04 | NA | 1.55e-12 |
| 3. B | Q92625 | Ankyrin repeat and SAM domain-containing protein 1A | 4.34e-04 | NA | 1.69e-10 |
| 3. B | Q3UUF8 | Ankyrin repeat domain-containing protein 34B | 1.53e-03 | NA | 3.69e-05 |
| 3. B | A0M8T5 | Cortactin-binding protein 2 | 8.14e-02 | NA | 7.27e-09 |
| 3. B | Q9J5I9 | Putative ankyrin repeat protein FPV012 | NA | NA | 3.58e-05 |
| 3. B | Q5ZM55 | Protein fem-1 homolog B | 1.28e-05 | NA | 7.88e-11 |
| 3. B | Q2KI79 | Ankyrin repeat family A protein 2 | 8.61e-06 | NA | 6.45e-07 |
| 3. B | Q07E15 | Cortactin-binding protein 2 | 1.81e-02 | NA | 1.56e-09 |
| 3. B | Q6UB98 | Ankyrin repeat domain-containing protein 12 | 1.84e-01 | NA | 1.91e-04 |
| 3. B | A6QPE7 | Ankyrin repeat domain-containing protein 65 | 4.76e-09 | NA | 3.34e-11 |
| 3. B | Q9XZC0 | Alpha-latrocrustotoxin-Lt1a (Fragment) | 2.65e-02 | NA | 4.51e-11 |
| 3. B | Q9V7A7 | G patch domain and ankyrin repeat-containing protein 1 homolog | 5.98e-02 | NA | 3.77e-04 |
| 3. B | Q94A76 | Potassium channel GORK | 5.31e-03 | NA | 4.15e-09 |
| 3. B | Q8Q0U0 | Putative ankyrin repeat protein MM_0045 | 1.88e-13 | NA | 5.90e-24 |
| 3. B | Q7EZ44 | Probable E3 ubiquitin-protein ligase XBOS35 | 1.51e-06 | NA | 9.53e-05 |
| 3. B | Q54KH3 | Ankyrin repeat domain-containing protein 39 homolog | 1.67e-08 | NA | 0.004 |
| 3. B | O35516 | Neurogenic locus notch homolog protein 2 | 2.19e-02 | NA | 8.03e-08 |
| 3. B | Q5VYY1 | Ankyrin repeat domain-containing protein 22 | 1.62e-10 | NA | 0.002 |
| 3. B | Q755Y0 | Palmitoyltransferase AKR1 | 1.48e-04 | NA | 2.27e-08 |
| 3. B | Q3UHD9 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 | 5.32e-01 | NA | 0.002 |
| 3. B | Q9XX14 | Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 | 1.82e-01 | NA | 0.017 |
| 3. B | Q03017 | NF-kappa-B inhibitor cactus | 1.58e-05 | NA | 6.76e-08 |
| 3. B | Q91WD2 | Transient receptor potential cation channel subfamily V member 6 | 2.82e-04 | NA | 1.32e-04 |
| 3. B | B8N0E6 | Ankyrin-repeat domain containing transcription coregulator asaA | 3.22e-03 | NA | 6.64e-06 |
| 3. B | O75762 | Transient receptor potential cation channel subfamily A member 1 | 5.17e-04 | NA | 5.53e-09 |
| 3. B | Q5M9H0 | Ankyrin repeat and SAM domain-containing protein 3 | 1.95e-03 | NA | 2.72e-15 |
| 3. B | Q9CQM6 | Ankyrin repeat domain-containing protein 61 | 1.10e-06 | NA | 8.76e-11 |
| 3. B | Q5UPA0 | Putative ankyrin repeat protein L25 | NA | NA | 0.024 |
| 3. B | Q6NY19 | KN motif and ankyrin repeat domain-containing protein 3 | 7.63e-03 | NA | 7.95e-07 |
| 3. B | P19838 | Nuclear factor NF-kappa-B p105 subunit | 1.08e-03 | NA | 2.17e-04 |
| 3. B | A0M8S4 | Cortactin-binding protein 2 | 1.41e-02 | NA | 2.34e-09 |
| 3. B | Q9Z1E3 | NF-kappa-B inhibitor alpha | 4.51e-07 | NA | 8.97e-04 |
| 3. B | Q24145 | Tyrosine-protein kinase Shark | 2.72e-03 | NA | 0.016 |
| 3. B | A6NIR3 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 5 | 1.68e-01 | NA | 0.012 |
| 3. B | Q9TU71 | Ankyrin repeat domain-containing protein 1 | 3.35e-07 | NA | 1.86e-12 |
| 3. B | Q18297 | Transient receptor potential cation channel subfamily A member 1 homolog | 2.71e-03 | NA | 9.74e-13 |
| 3. B | E9Q4F7 | Ankyrin repeat domain-containing protein 11 | 5.97e-01 | NA | 6.58e-07 |
| 3. B | P98150 | Nuclear factor NF-kappa-B p100 subunit | 8.91e-03 | NA | 5.58e-12 |
| 3. B | Q9XSM3 | Transient receptor potential cation channel subfamily V member 5 | 8.63e-04 | NA | 1.14e-04 |
| 3. B | Q5UQZ7 | Putative ankyrin repeat protein R901 | NA | NA | 0.002 |
| 3. B | Q5RF15 | Serine/threonine-protein kinase TNNI3K | 2.73e-05 | NA | 1.18e-11 |
| 3. B | Q9VFD5 | Protein fem-1 homolog CG6966 | 6.98e-04 | NA | 1.21e-05 |
| 3. B | Q6P9K8 | Caskin-1 | 3.70e-02 | NA | 2.67e-12 |
| 3. B | Q9BZL4 | Protein phosphatase 1 regulatory subunit 12C | 5.27e-04 | NA | 8.60e-05 |
| 3. B | Q2T9W8 | Ankyrin repeat domain-containing protein 61 | 2.93e-06 | NA | 6.14e-07 |
| 3. B | Q2IBA2 | Cortactin-binding protein 2 | 1.32e-02 | NA | 2.32e-09 |
| 3. B | Q5UR04 | Putative ankyrin repeat protein R911 | NA | NA | 0.026 |
| 3. B | Q812A3 | Ankyrin repeat domain-containing protein 23 | 2.80e-06 | NA | 1.24e-11 |
| 3. B | Q3SWY2 | Integrin-linked protein kinase | 3.91e-04 | NA | 2.81e-09 |
| 3. B | A5PMU4 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 6.04e-03 | NA | 2.26e-14 |
| 3. B | Q876A6 | Palmitoyltransferase AKR1 | 1.76e-04 | NA | 2.84e-06 |
| 3. B | Q96KQ7 | Histone-lysine N-methyltransferase EHMT2 | 3.98e-02 | NA | 2.30e-16 |
| 3. B | Q9HFE7 | Ankyrin repeat-containing protein P16F5.05c | 7.63e-09 | NA | 0.004 |
| 3. B | P25799 | Nuclear factor NF-kappa-B p105 subunit | 1.95e-04 | NA | 2.04e-07 |
| 3. B | Q92882 | Osteoclast-stimulating factor 1 | 1.02e-03 | NA | 0.026 |
| 3. B | Q99LW0 | Ankyrin repeat domain-containing protein 10 | 1.10e-05 | NA | 0.025 |
| 3. B | Q91ZU0 | Ankyrin repeat and SOCS box protein 7 | 4.21e-08 | NA | 1.16e-13 |
| 3. B | Q6GNY1 | E3 ubiquitin-protein ligase mib1 | 5.93e-04 | NA | 3.84e-13 |
| 3. B | Q5UPV1 | Putative ankyrin repeat protein L271 | NA | NA | 2.61e-05 |
| 3. B | Q91ZT8 | Ankyrin repeat and SOCS box protein 9 | 4.43e-10 | NA | 0.011 |
| 3. B | Q9JLU4 | SH3 and multiple ankyrin repeat domains protein 3 | 1.06e-02 | NA | 0.023 |
| 3. B | Q8NI38 | NF-kappa-B inhibitor delta | 5.43e-07 | NA | 0.005 |
| 3. B | Q9BYH8 | NF-kappa-B inhibitor zeta | 1.26e-03 | NA | 0.001 |
| 3. B | A2A2Z9 | Ankyrin repeat domain-containing protein 18B | 3.82e-09 | NA | 1.13e-66 |
| 3. B | Q9J5H7 | Putative ankyrin repeat protein FPV024 | NA | NA | 2.46e-10 |
| 3. B | Q09701 | Palmitoyltransferase akr1 | 5.99e-06 | NA | 1.97e-08 |
| 3. B | Q01705 | Neurogenic locus notch homolog protein 1 | 1.53e-01 | NA | 5.38e-07 |
| 3. B | Q9Z2G1 | Protein fem-1 homolog A-A | 1.26e-04 | NA | 0.027 |
| 3. B | P0C550 | Potassium channel AKT1 | 7.43e-03 | NA | 5.93e-13 |
| 3. B | X1WE18 | KN motif and ankyrin repeat domain-containing protein 2 | 1.70e-02 | NA | 2.21e-05 |
| 3. B | G5EGA3 | Ankyrin repeat and LEM domain-containing protein 1 homolog | 5.14e-02 | NA | 7.50e-05 |
| 3. B | Q8TF27 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 11 | 6.96e-02 | NA | 0.025 |
| 3. B | D3Z7P3 | Glutaminase kidney isoform, mitochondrial | 6.12e-02 | NA | 0.002 |
| 3. B | Q5VUJ5 | Putative Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 7 | 1.53e-01 | NA | 0.012 |
| 3. B | Q8WXK1 | Ankyrin repeat and SOCS box protein 15 | 7.29e-05 | NA | 6.65e-09 |
| 3. B | Q2IBF8 | Cortactin-binding protein 2 | 2.84e-02 | NA | 3.00e-09 |
| 3. B | Q2T9K6 | Protein fem-1 homolog C | 4.72e-06 | NA | 4.89e-07 |
| 3. B | Q9ULJ7 | Ankyrin repeat domain-containing protein 50 | 1.44e-03 | NA | 4.87e-20 |
| 3. B | P0C927 | Ankyrin repeat and SOCS box protein 14 | 2.62e-05 | NA | 2.39e-08 |
| 3. B | Q8VHK1 | Caskin-2 | 4.81e-04 | NA | 1.29e-06 |
| 3. B | Q9Y6X6 | Unconventional myosin-XVI | 1.23e-01 | NA | 3.09e-07 |
| 3. B | Q9ZCL3 | Putative ankyrin repeat protein RP714 | 2.15e-08 | NA | 6.10e-08 |
| 3. B | Q8K2H4 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 | 1.98e-02 | NA | 0.022 |
| 3. B | P46531 | Neurogenic locus notch homolog protein 1 | 4.99e-02 | NA | 9.00e-07 |
| 3. B | Q2IBE6 | Cortactin-binding protein 2 | 1.20e-01 | NA | 1.45e-08 |
| 3. B | Q3ZBX7 | Ankyrin repeat domain-containing protein 1 | 2.78e-07 | NA | 2.06e-11 |
| 3. B | Q4V869 | Acyl-CoA-binding domain-containing protein 6 | 1.62e-03 | NA | 8.04e-06 |
| 3. B | Q09YG9 | Cortactin-binding protein 2 | 1.20e-02 | NA | 7.92e-09 |
| 3. B | Q8HXA6 | Ankyrin repeat and SOCS box protein 15 | 1.42e-04 | NA | 7.96e-10 |
| 3. B | Q91ZU1 | Ankyrin repeat and SOCS box protein 6 | 2.39e-04 | NA | 2.66e-04 |
| 3. B | Q96NS5 | Ankyrin repeat and SOCS box protein 16 | 6.83e-05 | NA | 2.21e-04 |
| 3. B | Q52T38 | Protein S-acyltransferase 24 | 1.15e-06 | NA | 1.10e-04 |
| 3. B | P0C6S7 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 1.04e-03 | NA | 3.33e-14 |
| 3. B | P0C6C1 | Ankyrin repeat domain-containing protein 34C | 3.05e-03 | NA | 2.43e-07 |
| 3. B | Q96JP0 | Protein fem-1 homolog C | 1.39e-04 | NA | 5.82e-07 |
| 3. B | Q9C6C3 | ADP-ribosylation factor GTPase-activating protein AGD2 | 5.85e-02 | NA | 0.004 |
| 3. B | F1N6G5 | E3 ubiquitin-protein ligase HACE1 | 9.98e-03 | NA | 6.06e-13 |
| 3. B | Q8NFD2 | Ankyrin repeat and protein kinase domain-containing protein 1 | 7.90e-06 | NA | 2.47e-18 |
| 3. B | Q865U8 | Ankyrin repeat domain-containing protein 1 | 2.36e-08 | NA | 1.14e-11 |
| 3. B | Q9DF58 | Integrin-linked protein kinase | 5.05e-04 | NA | 3.29e-09 |
| 3. B | O60237 | Protein phosphatase 1 regulatory subunit 12B | 4.90e-04 | NA | 1.19e-06 |
| 3. B | Q6NZL6 | Tonsoku-like protein | 3.90e-02 | NA | 0.018 |
| 3. B | Q9SMX5 | ADP-ribosylation factor GTPase-activating protein AGD4 | 5.28e-02 | NA | 0.015 |
| 3. B | Q1LZH7 | KN motif and ankyrin repeat domain-containing protein 2 | 1.46e-04 | NA | 1.64e-08 |
| 3. B | P17442 | Phosphate system positive regulatory protein PHO81 | 7.13e-03 | NA | 0.014 |
| 3. B | Q8WVL7 | Ankyrin repeat domain-containing protein 49 | 7.21e-04 | NA | 0.001 |
| 3. B | A2VDR2 | Acyl-CoA-binding domain-containing protein 6 | 5.41e-04 | NA | 6.45e-09 |
| 3. B | Q00PJ1 | Cortactin-binding protein 2 | 7.87e-02 | NA | 2.16e-08 |
| 3. B | Q54BA2 | Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 | 8.92e-03 | NA | 5.78e-10 |
| 3. B | Q9VCA8 | Ankyrin repeat and KH domain-containing protein mask | NA | NA | 1.76e-13 |
| 3. B | Q04861 | Nuclear factor NF-kappa-B p105 subunit | 1.40e-03 | NA | 2.41e-07 |
| 3. B | A2ARS0 | Ankyrin repeat domain-containing protein 63 | 1.39e-05 | NA | 8.16e-06 |
| 3. B | F1MJR8 | Inactive serine/threonine-protein kinase TEX14 | 1.23e-01 | NA | 0.003 |
| 3. B | Q15327 | Ankyrin repeat domain-containing protein 1 | 3.09e-07 | NA | 3.50e-13 |
| 3. B | Q25338 | Delta-latroinsectotoxin-Lt1a | 1.93e-04 | NA | 2.77e-08 |
| 3. B | Q5EA33 | Ankyrin repeat domain-containing protein 49 | 7.45e-05 | NA | 8.30e-05 |
| 3. B | O94925 | Glutaminase kidney isoform, mitochondrial | 3.41e-01 | NA | 0.015 |
| 3. B | Q5UPB6 | Putative ankyrin repeat protein L45 | NA | NA | 0.031 |
| 3. B | Q9BXX3 | Ankyrin repeat domain-containing protein 30A | 5.49e-04 | NA | 1.15e-62 |
| 3. B | Q86YT6 | E3 ubiquitin-protein ligase MIB1 | 7.20e-05 | NA | 2.36e-13 |
| 3. B | Q94CT7 | Probable E3 ubiquitin-protein ligase XBOS31 | 1.15e-05 | NA | 1.51e-13 |
| 3. B | Q9TZC4 | Integrin-linked protein kinase homolog pat-4 | 9.90e-03 | NA | 1.06e-08 |
| 3. B | O89019 | Inversin | 2.17e-05 | NA | 4.74e-15 |
| 3. B | Q66JD7 | Acyl-CoA-binding domain-containing protein 6 | 4.75e-03 | NA | 1.23e-05 |
| 3. B | Q53RE8 | Ankyrin repeat domain-containing protein 39 | 2.70e-07 | NA | 6.82e-07 |
| 3. B | Q54HW1 | 26S proteasome non-ATPase regulatory subunit 10 | 1.11e-16 | NA | 4.49e-14 |
| 3. B | Q9J4Z8 | Putative ankyrin repeat protein FPV242 | NA | NA | 0.049 |
| 3. B | Q69ZU8 | Ankyrin repeat domain-containing protein 6 | 3.49e-07 | NA | 1.55e-17 |
| 3. B | Q0JKV1 | Potassium channel AKT1 | 9.87e-04 | NA | 5.83e-13 |
| 3. B | Q60773 | Cyclin-dependent kinase 4 inhibitor D | 2.08e-09 | NA | 0.001 |
| 3. B | Q2IBB2 | Cortactin-binding protein 2 | 5.13e-02 | NA | 1.63e-09 |
| 3. B | Q5UPG7 | Putative ankyrin repeat protein L91 | NA | NA | 4.21e-04 |
| 3. B | Q9EQG6 | Kinase D-interacting substrate of 220 kDa | 2.30e-02 | NA | 3.17e-17 |
| 3. B | Q5ZLC6 | Ankyrin repeat domain-containing protein 10 | 2.83e-05 | NA | 2.27e-04 |
| 3. B | Q4KL97 | Ankyrin repeat domain-containing protein 1 | 7.25e-06 | NA | 4.94e-09 |
| 3. B | P14368 | Putative ankyrin repeat protein FPV234 | NA | NA | 5.86e-05 |
| 3. B | Q91955 | Myotrophin | 7.65e-09 | NA | 1.96e-04 |
| 3. B | P58546 | Myotrophin | 5.09e-09 | NA | 3.18e-04 |
| 3. B | Q2QLG9 | Cortactin-binding protein 2 | 5.36e-02 | NA | 1.67e-08 |
| 3. B | Q4R544 | Ankyrin repeat and SOCS box protein 8 | 1.66e-08 | NA | 9.43e-10 |
| 3. B | Q9J4Z6 | Putative ankyrin repeat protein FPV244 | NA | NA | 1.23e-12 |
| 3. B | Q9J5A7 | Putative ankyrin repeat protein FPV115 | NA | NA | 8.61e-11 |
| 3. B | Q5I1X5 | RelA-associated inhibitor | 6.09e-02 | NA | 0.023 |
| 3. B | Q9UVH3 | Palmitoyltransferase AKR1 (Fragment) | 4.57e-03 | NA | 5.41e-08 |
| 3. B | O08560 | Diacylglycerol kinase zeta | 5.33e-02 | NA | 0.045 |
| 3. B | P0CG38 | POTE ankyrin domain family member I | 8.49e-09 | NA | 0.0 |
| 3. B | O74205 | Transcription factor TOXE | 1.25e-03 | NA | 5.39e-05 |
| 3. B | P77736 | Putative ankyrin repeat protein YahD | 8.77e-15 | NA | 1.80e-05 |
| 3. B | Q5F478 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 2.15e-04 | NA | 7.75e-20 |
| 3. B | Q9EST8 | NF-kappa-B inhibitor zeta | 5.29e-04 | NA | 3.54e-04 |
| 3. B | Q9J507 | Putative ankyrin repeat protein FPV228 | NA | NA | 4.48e-10 |
| 3. B | Q7TQP6 | Serine/threonine-protein kinase TNNI3K | 2.24e-04 | NA | 1.17e-12 |
| 3. B | P28492 | Glutaminase liver isoform, mitochondrial | 2.17e-02 | NA | 0.007 |
| 3. B | P0CS67 | Palmitoyltransferase AKR1 | 1.78e-05 | NA | 9.79e-11 |
| 3. B | Q9Z2G0 | Protein fem-1 homolog B | 3.86e-05 | NA | 8.93e-10 |
| 3. B | Q9XXH8 | Arf-GAP with ANK repeat and PH domain-containing protein cnt-1 | 4.01e-03 | NA | 0.004 |
| 3. B | Q5UP11 | Putative ankyrin repeat protein R848 | NA | NA | 0.019 |
| 3. B | P14356 | Ankyrin repeat protein M1 | NA | NA | 0.008 |
| 3. B | G5E8K5 | Ankyrin-3 | 4.96e-03 | NA | 2.18e-18 |
| 3. B | Q8K0L0 | Ankyrin repeat and SOCS box protein 2 | 1.20e-03 | NA | 1.03e-13 |
| 3. B | Q4UJC0 | Putative ankyrin repeat protein RF_p42/RF_pd42 | 1.79e-05 | NA | 1.80e-04 |
| 3. B | A0PJZ0 | Putative ankyrin repeat domain-containing protein 20A5 | 1.40e-07 | NA | 6.44e-39 |
| 3. B | V6CLA2 | E3 ubiquitin-protein ligase hecd-1 | 7.06e-01 | NA | 0.013 |
| 3. B | Q6DD51 | Caskin-2 | 6.92e-03 | NA | 3.07e-08 |
| 3. B | Q5VW22 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 6 | 1.58e-01 | NA | 0.021 |
| 3. B | Q3TYA6 | M-phase phosphoprotein 8 | 1.26e-02 | NA | 0.001 |
| 3. B | P21783 | Neurogenic locus notch homolog protein 1 | 3.29e-02 | NA | 1.28e-06 |
| 3. B | Q8TF21 | Ankyrin repeat domain-containing protein 24 | 2.79e-06 | NA | 3.24e-13 |
| 3. B | Q6NUI1 | Putative coiled-coil domain-containing protein 144 N-terminal-like | 3.37e-01 | NA | 0.018 |
| 3. B | A0A0R4IQZ2 | Putative palmitoyltransferase ZDHHC13 | 2.89e-07 | NA | 1.37e-14 |
| 3. B | Q96HA7 | Tonsoku-like protein | 2.10e-01 | NA | 0.010 |
| 3. B | Q5CZ79 | Ankyrin repeat domain-containing protein 20B | 5.24e-09 | NA | 2.75e-63 |
| 3. B | Q9H765 | Ankyrin repeat and SOCS box protein 8 | 1.93e-06 | NA | 2.56e-10 |
| 3. B | Q99549 | M-phase phosphoprotein 8 | 8.33e-03 | NA | 3.21e-04 |
| 3. B | Q54HC6 | Ankyrin repeat-containing protein kinase A | 9.90e-03 | NA | 1.56e-04 |
| 3. B | Q1RJR6 | Putative ankyrin repeat protein RBE_0317 | 1.69e-06 | NA | 2.11e-10 |
| 3. B | Q9R186 | Transient receptor potential cation channel subfamily V member 6 | 1.77e-05 | NA | 1.02e-04 |
| 3. B | Q10728 | Protein phosphatase 1 regulatory subunit 12A | 3.15e-03 | NA | 1.03e-04 |
| 3. B | Q63746 | NF-kappa-B inhibitor alpha | 8.77e-07 | NA | 0.001 |
| 3. B | Q9JIP0 | Transient receptor potential cation channel subfamily V member 5 | 1.74e-04 | NA | 0.009 |
| 3. B | P07207 | Neurogenic locus Notch protein | NA | NA | 4.63e-09 |
| 3. B | Q07DV1 | Cortactin-binding protein 2 | 4.09e-01 | NA | 1.28e-08 |
| 3. B | Q9W0T5 | Transient receptor potential channel pyrexia | 5.91e-05 | NA | 1.95e-13 |
| 3. B | Q9CWU2 | Palmitoyltransferase ZDHHC13 | 2.30e-04 | NA | 1.66e-10 |
| 3. B | Q9NWX5 | Ankyrin repeat and SOCS box protein 6 | 2.02e-04 | NA | 1.96e-06 |
| 3. B | Q5W7F2 | ADP-ribosylation factor GTPase-activating protein AGD3 | 2.99e-01 | NA | 2.17e-04 |
| 3. B | Q9FNP4 | Phytochrome-interacting ankyrin-repeat protein 2 | 2.33e-07 | NA | 0.004 |
| 3. B | Q9STP8 | Acyl-CoA-binding domain-containing protein 2 | 4.67e-03 | NA | 8.03e-06 |
| 3. B | A2CIR5 | Ankyrin repeat-containing protein NPR4 | 7.67e-04 | NA | 0.011 |
| 3. B | A6NGH8 | Ankyrin repeat domain-containing protein 61 | 1.13e-05 | NA | 1.37e-10 |
| 3. B | Q63ZY3 | KN motif and ankyrin repeat domain-containing protein 2 | 1.24e-04 | NA | 8.63e-09 |
| 3. B | Q07DX4 | Cortactin-binding protein 2 | 1.38e-02 | NA | 1.58e-08 |
| 3. B | Q1RHQ8 | Putative ankyrin repeat protein RBE_1025 | 1.10e-06 | NA | 1.45e-05 |
| 3. B | Q9CR42 | Ankyrin repeat domain-containing protein 1 | 3.95e-08 | NA | 1.86e-12 |
| 3. B | Q8BTZ5 | Ankyrin repeat domain-containing protein 46 | 1.13e-05 | NA | 0.008 |
| 3. B | A6NK59 | Ankyrin repeat and SOCS box protein 14 | 1.14e-04 | NA | 1.06e-06 |
| 3. B | Q8BLA8 | Transient receptor potential cation channel subfamily A member 1 | 4.32e-04 | NA | 2.51e-10 |
| 3. B | Q8H569 | Potassium channel AKT3 | 1.52e-02 | NA | 1.37e-08 |
| 3. B | O73630 | Nuclear factor NF-kappa-B p100 subunit | 2.97e-03 | NA | 9.51e-14 |
| 3. B | Q5UQV3 | Putative ankyrin repeat protein L371 | NA | NA | 6.29e-08 |
| 3. B | Q6C520 | Palmitoyltransferase AKR1 | 1.21e-05 | NA | 1.02e-06 |
| 3. B | Q2QLA2 | Cortactin-binding protein 2 | 3.54e-02 | NA | 5.58e-09 |
| 3. B | Q9D2X0 | Ankyrin repeat domain-containing protein 39 | 4.70e-08 | NA | 5.33e-07 |
| 3. B | O75179 | Ankyrin repeat domain-containing protein 17 | 6.79e-02 | NA | 1.38e-13 |
| 3. B | Q86AT8 | Stress-activated protein kinase alpha | 1.51e-05 | NA | 1.11e-06 |
| 3. B | Q9HYV6 | Putative ankyrin repeat protein PA3287 | 1.10e-11 | NA | 4.71e-07 |
| 3. B | Q5ZMD2 | Ankyrin repeat and MYND domain-containing protein 2 | 6.98e-05 | NA | 0.007 |
| 3. B | Q09YM8 | Cortactin-binding protein 2 | 2.71e-02 | NA | 2.38e-08 |
| 3. B | Q9WTK5 | Nuclear factor NF-kappa-B p100 subunit | 1.94e-04 | NA | 2.50e-08 |
| 3. B | Q6GPE5 | Protein fem-1 homolog B | 3.05e-04 | NA | 5.04e-09 |
| 3. B | Q8WXE0 | Caskin-2 | 1.06e-03 | NA | 1.66e-06 |
| 3. B | Q8BXK8 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 | 1.93e-01 | NA | 0.006 |
| 3. B | Q4R690 | Palmitoyltransferase ZDHHC13 | 2.07e-07 | NA | 1.34e-10 |
| 3. B | Q5DW34 | Histone-lysine N-methyltransferase EHMT1 | 8.79e-04 | NA | 8.58e-13 |
| 3. B | Q86YJ7 | Ankyrin repeat domain-containing protein 13B | 1.41e-01 | NA | 0.024 |
| 3. B | Q80YE7 | Death-associated protein kinase 1 | 2.44e-03 | NA | 6.01e-18 |
| 3. B | Q5URB8 | Putative ankyrin repeat protein R841 | NA | NA | 1.96e-05 |
| 3. B | Q5UPG0 | Putative ankyrin repeat protein L86 | NA | NA | 2.19e-09 |
| 3. B | Q4UMP3 | Putative ankyrin repeat protein RF_0314 | 4.08e-03 | NA | 6.95e-07 |
| 3. B | E9PTT0 | Palmitoyltransferase ZDHHC17 | 5.11e-06 | NA | 5.07e-11 |
| 3. B | P0DJE3 | Alpha-latrotoxin-Lhe1a | 3.53e-03 | NA | 4.66e-12 |
| 3. B | Q5F259 | Ankyrin repeat domain-containing protein 13B | 6.61e-02 | NA | 0.027 |
| 3. B | Q978J0 | Putative ankyrin repeat protein TV1425 | 1.09e-13 | NA | 9.53e-13 |
| 3. B | O00221 | NF-kappa-B inhibitor epsilon | 2.27e-05 | NA | 7.69e-07 |
| 3. B | P33825 | Ankyrin repeat protein M1 | NA | NA | 0.019 |
| 3. B | Q3UYR4 | Espin-like protein | 2.00e-05 | NA | 6.29e-05 |
| 3. B | Q8IWZ3 | Ankyrin repeat and KH domain-containing protein 1 | 2.73e-03 | NA | 2.36e-14 |
| 3. B | Q4V890 | Protein fem-1 homolog A | 3.28e-05 | NA | 0.022 |
| 3. B | Q8IVF6 | Ankyrin repeat domain-containing protein 18A | 2.26e-08 | NA | 3.66e-67 |
| 3. B | Q9J5H5 | Putative ankyrin repeat protein FPV026 | NA | NA | 8.10e-08 |
| 3. B | Q9J4Z4 | Putative ankyrin repeat protein FPV246 | NA | NA | 3.76e-14 |
| 3. B | P20640 | Ankyrin repeat protein M1 | NA | NA | 0.008 |
| 3. B | A6NC57 | Ankyrin repeat domain-containing protein 62 | 6.77e-09 | NA | 2.68e-89 |
| 3. B | Q29RV0 | Cyclin-dependent kinase 4 inhibitor D | 1.01e-09 | NA | 0.013 |
| 3. B | Q5RD76 | NAD-capped RNA hydrolase NUDT12 | 2.15e-02 | NA | 0.012 |
| 3. B | Q4ACU6 | SH3 and multiple ankyrin repeat domains protein 3 | 1.01e-02 | NA | 0.023 |
| 3. B | B0G124 | Ankyrin repeat-containing protein DDB_G0279043 | 2.39e-10 | NA | 1.00e-10 |
| 3. B | Q6TNJ1 | Krev interaction trapped protein 1 | 5.95e-02 | NA | 0.033 |
| 3. B | Q8CGU4 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 | 4.59e-01 | NA | 0.002 |
| 3. B | Q8C6Y6 | Ankyrin repeat and SOCS box protein 14 | 1.13e-04 | NA | 4.10e-10 |
| 3. B | Q5UPJ9 | Putative ankyrin repeat protein L122 | NA | NA | 2.38e-07 |
| 3. B | Q91974 | NF-kappa-B inhibitor alpha | 5.40e-08 | NA | 2.80e-06 |
| 3. B | Q5AL27 | Palmitoyltransferase AKR1 | 9.04e-05 | NA | 2.33e-05 |
| 3. B | Q54F46 | Homeobox protein Wariai | 1.61e-04 | NA | 1.53e-13 |
| 3. B | A2RUR9 | Coiled-coil domain-containing protein 144A | 3.65e-01 | NA | 2.47e-22 |
| 3. B | Q108T9 | Cortactin-binding protein 2 | 1.43e-02 | NA | 2.85e-10 |
| 3. B | Q9H672 | Ankyrin repeat and SOCS box protein 7 | 3.21e-08 | NA | 1.13e-13 |
| 3. B | Q9ET47 | Espin | 1.99e-05 | NA | 2.13e-09 |
| 3. B | Q9GKW8 | Ankyrin repeat and death domain-containing protein 1A (Fragment) | 1.54e-07 | NA | 1.77e-15 |
| 3. B | Q5ZIJ9 | E3 ubiquitin-protein ligase MIB2 | 2.86e-04 | NA | 3.09e-13 |
| 3. B | Q05921 | 2-5A-dependent ribonuclease | 7.01e-05 | NA | 4.85e-10 |
| 3. B | Q5UP19 | Putative ankyrin repeat protein R864 | NA | NA | 0.023 |
| 3. B | Q99490 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 | 3.11e-01 | NA | 0.002 |
| 3. B | Q80VM7 | Ankyrin repeat domain-containing protein 24 | 5.16e-05 | NA | 5.60e-16 |
| 3. B | P50086 | Probable 26S proteasome regulatory subunit p28 | 1.31e-13 | NA | 4.07e-05 |
| 3. B | Q1RHT6 | Putative ankyrin repeat protein RBE_0997 | 8.10e-05 | NA | 2.10e-11 |
| 3. B | Q02979 | Glycerophosphocholine phosphodiesterase GDE1 | 3.18e-02 | NA | 8.25e-04 |
| 3. B | Q505D1 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A | 5.43e-04 | NA | 3.03e-19 |
| 3. B | O90760 | Putative ankyrin repeat protein FPV031 | NA | NA | 2.13e-08 |
| 3. B | Q8IUH4 | Palmitoyltransferase ZDHHC13 | 1.80e-07 | NA | 1.70e-11 |
| 3. B | P81069 | GA-binding protein subunit beta-2 | 2.85e-09 | NA | 1.90e-05 |
| 3. B | Q54GC8 | Acyl-CoA-binding domain-containing protein 6 homolog | 1.79e-03 | NA | 5.10e-04 |
| 3. B | Q9UPS8 | Ankyrin repeat domain-containing protein 26 | 7.42e-02 | NA | 1.26e-64 |
| 3. B | Q9VUW9 | Palmitoyltransferase Hip14 | 4.62e-06 | NA | 1.45e-06 |
| 3. B | Q9NXR5 | Ankyrin repeat domain-containing protein 10 | 3.13e-05 | NA | 0.013 |
| 3. B | Q96Q27 | Ankyrin repeat and SOCS box protein 2 | 1.66e-05 | NA | 4.13e-17 |
| 3. B | Q00420 | GA-binding protein subunit beta-1 | 1.15e-07 | NA | 3.52e-09 |
| 3. B | Q6NLQ8 | E3 ubiquitin-protein ligase XBAT32 | 2.36e-05 | NA | 6.85e-08 |
| 3. B | Q9J508 | Putative ankyrin repeat protein FPV227 | NA | NA | 8.33e-08 |
| 3. B | Q86WC6 | Protein phosphatase 1 regulatory subunit 27 | 3.94e-05 | NA | 0.001 |
| 3. B | Q96P47 | Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 | 3.47e-01 | NA | 1.40e-05 |
| 3. B | Q1RI12 | Putative ankyrin repeat protein RBE_0921 | 2.96e-05 | NA | 9.48e-07 |
| 3. B | Q9Y6H5 | Synphilin-1 | 2.65e-03 | NA | 0.013 |
| 3. B | Q8R516 | E3 ubiquitin-protein ligase MIB2 | 3.13e-05 | NA | 2.70e-10 |
| 3. B | Q5ZXN6 | Phosphocholine transferase AnkX | 8.43e-04 | NA | 0.002 |
| 3. B | P83757 | NF-kappa-B inhibitor cactus | NA | NA | 1.62e-06 |
| 3. B | Q13418 | Integrin-linked protein kinase | 3.53e-04 | NA | 2.91e-09 |
| 3. B | Q8BG95 | Protein phosphatase 1 regulatory subunit 12B | 5.28e-04 | NA | 9.96e-06 |
| 3. B | Q6ZVH7 | Espin-like protein | 1.22e-04 | NA | 3.93e-05 |
| 3. B | Q9BE45 | NF-kappa-B inhibitor zeta | 2.10e-04 | NA | 2.52e-04 |
| 3. B | Q9FF09 | Phytochrome-interacting ankyrin-repeat protein 1 | 1.16e-04 | NA | 0.002 |
| 3. B | F1REV3 | Krev interaction trapped protein 1 | 9.28e-02 | NA | 0.038 |
| 3. B | Q9C0D5 | Protein TANC1 | 5.63e-03 | NA | 4.38e-12 |
| 3. B | Q5BKI6 | Ankyrin repeat domain-containing protein 1 | 1.08e-05 | NA | 3.60e-09 |
| 3. B | Q9Z1P7 | KN motif and ankyrin repeat domain-containing protein 3 | 1.88e-03 | NA | 4.68e-07 |
| 3. B | Q9J516 | Putative ankyrin repeat protein FPV219 | NA | NA | 1.44e-06 |
| 3. B | Q9D738 | Ankyrin repeat and SOCS box protein 12 | 3.34e-06 | NA | 0.021 |
| 3. B | Q07DZ5 | Cortactin-binding protein 2 | 1.75e-02 | NA | 2.53e-07 |
| 3. B | Q2TXF6 | Ankyrin repeat domain-containing protein oryK | 5.92e-03 | NA | 0.002 |
| 3. B | D3YZU1 | SH3 and multiple ankyrin repeat domains protein 1 | 4.37e-02 | NA | 2.65e-07 |
| 3. B | Q92527 | Ankyrin repeat domain-containing protein 7 | 2.08e-13 | NA | 2.10e-50 |
| 3. B | Q02989 | Alpha-latroinsectotoxin-Lt1a (Fragment) | 2.24e-03 | NA | 7.58e-13 |
| 3. B | Q60J38 | Ankyrin repeat and KH domain-containing protein CBG24701 | 1.64e-02 | NA | 2.05e-12 |
| 3. B | D3ZD05 | KN motif and ankyrin repeat domain-containing protein 2 | 8.08e-05 | NA | 1.08e-08 |
| 3. B | Q8T2Q0 | Putative ZDHHC-type palmitoyltransferase 6 | 1.67e-06 | NA | 3.65e-09 |
| 3. B | B2RXR6 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 1.74e-04 | NA | 6.39e-20 |
| 3. B | Q502K3 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 4.48e-04 | NA | 6.11e-18 |
| 3. B | Q3TPE9 | Ankyrin repeat and MYND domain-containing protein 2 | 1.22e-04 | NA | 0.006 |
| 3. B | Q66H07 | Fibronectin type 3 and ankyrin repeat domains 1 protein | 8.40e-08 | NA | 6.26e-11 |
| 3. B | Q69YU3 | Ankyrin repeat domain-containing protein 34A | 2.38e-03 | NA | 1.86e-05 |
| 3. B | Q9C104 | Glycerophosphocholine phosphodiesterase gde1 | 6.66e-03 | NA | 0.020 |
| 3. B | Q571F8 | Glutaminase liver isoform, mitochondrial | 2.07e-02 | NA | 0.004 |
| 3. B | Q20500 | Intracellular phospholipase A2 | 6.60e-03 | NA | 1.16e-06 |
| 3. B | Q7M6U3 | Inactive serine/threonine-protein kinase TEX14 | 1.74e-01 | NA | 0.040 |
| 3. B | Q9EP71 | Ankycorbin | 4.06e-05 | NA | 2.87e-18 |
| 3. B | Q5PQ89 | Ankyrin repeat domain-containing protein 34B | 2.58e-03 | NA | 9.02e-07 |
| 3. B | Q8HYY4 | Uveal autoantigen with coiled-coil domains and ankyrin repeats protein | 6.90e-05 | NA | 1.11e-16 |
| 3. B | Q05753 | Ankyrin repeat domain-containing protein, chloroplastic | 8.88e-05 | NA | 1.35e-13 |
| 3. B | Q2QLB3 | Cortactin-binding protein 2 | 8.86e-03 | NA | 2.48e-08 |
| 3. B | Q6UB99 | Ankyrin repeat domain-containing protein 11 | 3.28e-01 | NA | 7.05e-07 |
| 3. B | O22265 | Signal recognition particle 43 kDa protein, chloroplastic | 1.32e-02 | NA | 1.95e-05 |
| 3. B | Q9JIA3 | NF-kappa-B inhibitor beta | 2.27e-06 | NA | 5.89e-06 |
| 3. B | O55222 | Integrin-linked protein kinase | 4.06e-03 | NA | 3.10e-09 |
| 3. B | Q9J569 | Putative ankyrin repeat protein FPV162 | NA | NA | 6.31e-09 |
| 3. B | Q3SX45 | Ankyrin repeat and SOCS box protein 2 | 3.98e-03 | NA | 6.98e-18 |
| 3. B | Q8MJ49 | Osteoclast-stimulating factor 1 | 8.53e-04 | NA | 0.029 |
| 3. B | Q08DV6 | Ankyrin repeat and SOCS box protein 3 | 1.57e-05 | NA | 1.01e-10 |
| 3. B | Q9SAR5 | Ankyrin repeat domain-containing protein 2A | 4.11e-03 | NA | 3.23e-05 |
| 3. B | Q76K24 | Ankyrin repeat domain-containing protein 46 | 1.07e-06 | NA | 0.009 |
| 3. B | Q4V8X4 | Acyl-CoA-binding domain-containing protein 6 | 1.33e-03 | NA | 1.75e-07 |
| 3. B | Q04721 | Neurogenic locus notch homolog protein 2 | 6.04e-02 | NA | 8.24e-08 |
| 3. B | Q9DCN1 | NAD-capped RNA hydrolase NUDT12 | 7.19e-02 | NA | 0.009 |
| 3. B | Q09YI1 | Cortactin-binding protein 2 | 1.01e-01 | NA | 4.53e-09 |
| 3. B | Q9C7A2 | Ankyrin repeat-containing protein ITN1 | 1.01e-06 | NA | 0.015 |
| 3. B | Q8N6D5 | Ankyrin repeat domain-containing protein 29 | 1.40e-13 | NA | 5.59e-10 |
| 3. B | O15084 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A | 5.22e-03 | NA | 9.64e-20 |
| 3. B | Q5NVB9 | Palmitoyltransferase ZDHHC13 | 4.00e-07 | NA | 1.32e-11 |
| 3. B | Q7T2B9 | Myotrophin | 1.60e-08 | NA | 3.58e-06 |
| 3. B | P0DST0 | Ankyrin repeat protein B4 | NA | NA | 2.56e-04 |
| 3. B | Q9J4Z5 | Putative ankyrin repeat protein FPV245 | NA | NA | 3.56e-13 |
| 3. B | Q8BTI7 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 2.25e-04 | NA | 1.14e-14 |
| 3. B | E5RJM6 | Ankyrin repeat domain-containing protein 65 | 1.23e-07 | NA | 9.57e-10 |
| 3. B | Q6P9Z4 | Protein fem-1 homolog A | 1.86e-05 | NA | 5.62e-07 |
| 3. B | Q9GZV1 | Ankyrin repeat domain-containing protein 2 | 6.87e-05 | NA | 4.28e-12 |
| 3. B | Q6GQX6 | Ankyrin repeat and SAM domain-containing protein 6 | 5.39e-05 | NA | 1.59e-12 |
| 3. B | Q9QW30 | Neurogenic locus notch homolog protein 2 | 1.65e-01 | NA | 7.83e-08 |
| 3. B | Q86U10 | 60 kDa lysophospholipase | 5.64e-03 | NA | 0.004 |
| 3. B | Q60649 | Caseinolytic peptidase B protein homolog | 1.51e-02 | NA | 4.48e-04 |
| 3. B | Q3SX00 | Ankyrin repeat domain-containing protein 46 | 2.77e-06 | NA | 0.006 |
| 3. B | Q59H18 | Serine/threonine-protein kinase TNNI3K | 1.93e-05 | NA | 7.28e-13 |
| 3. B | Q9SM23 | Acyl-CoA-binding domain-containing protein 1 | 2.91e-03 | NA | 3.42e-07 |
| 3. B | Q99PE2 | Ankyrin repeat family A protein 2 | 3.74e-05 | NA | 7.96e-07 |
| 3. B | Q7ZYG4 | Osteoclast-stimulating factor 1 | 1.05e-03 | NA | 0.008 |
| 3. B | Q9BSK4 | Protein fem-1 homolog A | 1.19e-05 | NA | 0.003 |
| 3. B | Q9H9B1 | Histone-lysine N-methyltransferase EHMT1 | 5.74e-03 | NA | 5.32e-12 |
| 3. B | Q9BQG2 | NAD-capped RNA hydrolase NUDT12 | 8.04e-02 | NA | 0.011 |
| 3. B | P35210 | Protein SPT23 | 2.12e-02 | NA | 0.008 |
| 3. B | A0JNU3 | 60 kDa lysophospholipase | 6.54e-03 | NA | 1.98e-04 |
| 3. B | Q28BK1 | E3 ubiquitin-protein ligase HACE1 | 3.65e-03 | NA | 7.41e-14 |
| 3. B | Q8IYA2 | Putative coiled-coil domain-containing protein 144C | 2.73e-01 | NA | 6.28e-26 |
| 3. B | D4A615 | Tonsoku-like protein | 3.04e-02 | NA | 0.019 |
| 3. B | Q9J5I7 | Putative ankyrin repeat protein FPV014 | NA | NA | 3.71e-10 |
| 3. B | Q9BZF9 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 5.86e-03 | NA | 3.19e-15 |
| 3. B | Q9DAM9 | Fibronectin type 3 and ankyrin repeat domains 1 protein | 1.08e-07 | NA | 3.15e-10 |
| 3. B | Q8N283 | Ankyrin repeat domain-containing protein 35 | 1.38e-05 | NA | 1.26e-14 |
| 3. B | Q1RJR4 | Putative ankyrin repeat protein RBE_0319 | 1.27e-04 | NA | 3.16e-07 |
| 3. B | O60733 | 85/88 kDa calcium-independent phospholipase A2 | 3.81e-03 | NA | 1.84e-14 |
| 3. B | Q8BLB8 | Ankyrin repeat domain-containing protein 34C | 8.82e-04 | NA | 2.45e-07 |
| 3. B | Q9ERK0 | Receptor-interacting serine/threonine-protein kinase 4 | 6.41e-05 | NA | 2.78e-14 |
| 3. B | Q810B6 | Rabankyrin-5 | 2.03e-03 | NA | 2.54e-12 |
| 3. B | Q9J517 | Putative ankyrin repeat protein FPV218 | NA | NA | 8.42e-12 |
| 3. B | Q09YJ3 | Cortactin-binding protein 2 | 2.96e-03 | NA | 1.70e-09 |
| 3. B | Q12955 | Ankyrin-3 | NA | NA | 1.13e-18 |
| 3. B | Q96IX9 | Putative ankyrin repeat domain-containing protein 26-like 1 | 3.95e-04 | NA | 4.06e-07 |
| 3. B | Q8VHS5 | Ankyrin repeat and SOCS box protein 16 | 3.25e-05 | NA | 1.38e-04 |
| 3. B | Q6TNT2 | Ankyrin repeat domain-containing protein 46 | 1.71e-06 | NA | 0.002 |
| 3. B | P04297 | Interferon antagonist K1L | NA | NA | 0.009 |
| 3. B | A2RUV0 | Neurogenic locus notch homolog protein 1 | 9.34e-02 | NA | 2.78e-07 |
| 3. B | Q8C0T1 | Protein fem-1 homolog A-B | 2.75e-05 | NA | 0.015 |
| 3. B | Q38998 | Potassium channel AKT1 | 1.29e-02 | NA | 1.22e-08 |
| 3. B | Q80TN5 | Palmitoyltransferase ZDHHC17 | 1.07e-05 | NA | 5.17e-11 |
| 3. B | Q54LF0 | NAD-dependent deacetylase sir2B | 1.07e-03 | NA | 2.65e-04 |
| 3. B | C9JTQ0 | Ankyrin repeat domain-containing protein 63 | 3.25e-05 | NA | 6.61e-06 |
| 3. B | Q9JLQ2 | ARF GTPase-activating protein GIT2 | 3.04e-03 | NA | 0.033 |
| 3. B | Q7S3M5 | Palmitoyltransferase akr1 | 7.89e-06 | NA | 4.29e-12 |
| 3. B | Q7Z6G8 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 2.46e-03 | NA | 2.86e-14 |
| 3. B | A5PLL1 | Ankyrin repeat domain-containing protein 34B | 1.14e-03 | NA | 5.73e-05 |
| 3. B | Q5R5V4 | Integrin-linked protein kinase | 3.70e-04 | NA | 3.04e-09 |
| 3. B | Q4UKX2 | Putative ankyrin repeat protein RF_0950 | 9.70e-06 | NA | 1.41e-11 |
| 3. B | O75832 | 26S proteasome non-ATPase regulatory subunit 10 | 4.44e-16 | NA | 2.52e-12 |
| 3. B | P62775 | Myotrophin | 4.62e-09 | NA | 2.57e-04 |
| 3. B | Q6ZW76 | Ankyrin repeat and SAM domain-containing protein 3 | 3.44e-08 | NA | 3.41e-15 |
| 3. B | Q9BYB0 | SH3 and multiple ankyrin repeat domains protein 3 | 8.89e-02 | NA | 7.19e-05 |
| 3. B | Q9TZM3 | Leucine-rich repeat serine/threonine-protein kinase 1 | 1.40e-01 | NA | 0.001 |
| 3. B | P31695 | Neurogenic locus notch homolog protein 4 | 8.02e-03 | NA | 9.29e-08 |
| 3. B | Q8GXE6 | Potassium channel AKT6 | 4.54e-03 | NA | 1.49e-13 |
| 3. B | A0A140LI88 | Ankyrin repeat domain-containing protein 31 | 8.84e-02 | NA | 2.92e-08 |
| 3. B | Q09YK4 | Cortactin-binding protein 2 | 4.00e-02 | NA | 5.10e-08 |
| 3. B | Q8C8R3 | Ankyrin-2 | NA | NA | 2.18e-17 |
| 3. B | E1C656 | E3 ubiquitin-protein ligase HACE1 | 3.59e-05 | NA | 2.21e-13 |
| 3. B | Q6F6B3 | Protein TANC1 | 3.41e-03 | NA | 1.65e-13 |
| 3. B | Q86W74 | Ankyrin repeat domain-containing protein 46 | 8.23e-04 | NA | 0.006 |
| 3. B | Q8N8V4 | Ankyrin repeat and SAM domain-containing protein 4B | 9.01e-03 | NA | 0.005 |
| 3. B | Q4R7L8 | NAD-capped RNA hydrolase NUDT12 | 8.37e-02 | NA | 0.013 |
| 3. B | Q7T3Y0 | Notch-regulated ankyrin repeat-containing protein A | 3.91e-06 | NA | 0.036 |
| 3. B | Q9Y574 | Ankyrin repeat and SOCS box protein 4 | 8.90e-05 | NA | 4.88e-10 |
| 3. B | P40480 | Protein HOS4 | 3.84e-03 | NA | 0.002 |
| 3. B | Q9H9E1 | Ankyrin repeat family A protein 2 | 1.15e-05 | NA | 8.99e-07 |
| 3. B | Q6NXT1 | Ankyrin repeat domain-containing protein 54 | 6.03e-04 | NA | 1.47e-10 |
| 3. B | Q8BIZ1 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 2.26e-04 | NA | 2.68e-14 |
| 3. B | Q6AWW5 | Ankyrin repeat-containing protein At5g02620 | 7.16e-07 | NA | 2.90e-09 |
| 3. B | Q5T7N3 | KN motif and ankyrin repeat domain-containing protein 4 | 6.82e-04 | NA | 2.47e-08 |
| 3. B | Q92HB1 | Putative ankyrin repeat protein RC0860 | 2.81e-03 | NA | 2.70e-06 |
| 3. B | Q9QZH2 | BRCA1-associated RING domain protein 1 | 3.84e-01 | NA | 7.22e-04 |
| 3. B | Q7ZT11 | Ankyrin repeat domain-containing protein 1 | 3.00e-07 | NA | 1.11e-11 |
| 3. B | Q8TC84 | Fibronectin type 3 and ankyrin repeat domains protein 1 | 9.22e-08 | NA | 6.03e-14 |
| 3. B | Q54HT1 | Protein tirA | 6.29e-03 | NA | 0.028 |
| 3. B | Q9J503 | Putative ankyrin repeat protein FPV232 | NA | NA | 8.82e-08 |
| 3. B | Q99728 | BRCA1-associated RING domain protein 1 | 2.16e-02 | NA | 3.86e-05 |
| 3. B | P97570 | 85/88 kDa calcium-independent phospholipase A2 | 6.23e-03 | NA | 1.13e-13 |
| 3. B | Q3UMR0 | Ankyrin repeat domain-containing protein 27 | 3.95e-03 | NA | 1.01e-11 |
| 3. B | A3AYR1 | Acyl-CoA-binding domain-containing protein 4 | 3.80e-03 | NA | 2.84e-08 |
| 3. B | Q07008 | Neurogenic locus notch homolog protein 1 | 1.20e-01 | NA | 4.90e-07 |
| 3. B | Q3T0F7 | Myotrophin | 4.87e-09 | NA | 3.18e-04 |
| 3. B | Q811D2 | Ankyrin repeat domain-containing protein 26 | 2.35e-02 | NA | 1.17e-55 |
| 3. B | Q07DY4 | Cortactin-binding protein 2 | 5.64e-02 | NA | 2.34e-09 |
| 3. B | Q9HCD6 | Protein TANC2 | 2.02e-02 | NA | 2.05e-12 |
| 3. B | A1X157 | Cortactin-binding protein 2 | 5.37e-02 | NA | 3.95e-09 |
| 3. B | Q9GL21 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 9.47e-04 | NA | 1.97e-16 |
| 3. B | Q9Z148 | Histone-lysine N-methyltransferase EHMT2 | 4.37e-03 | NA | 1.67e-15 |
| 3. B | Q1RK13 | Putative ankyrin repeat protein RBE_0220 | 1.47e-04 | NA | 3.51e-07 |
| 3. B | Q54XX5 | Probable serine/threonine-protein kinase DDB_G0278535 | 1.49e-04 | NA | 5.09e-12 |
| 3. B | Q9CZK6 | Ankyrin repeat and SAM domain-containing protein 3 | 1.74e-06 | NA | 7.44e-14 |
| 3. B | Q5UPF8 | Putative ankyrin repeat protein L88 | NA | NA | 2.20e-11 |
| 3. B | P18954 | Protein PhlB | 1.14e-06 | NA | 5.61e-07 |
| 3. B | Q99J82 | Integrin-linked protein kinase | 3.64e-04 | NA | 3.10e-09 |
| 3. B | Q2QLF8 | Cortactin-binding protein 2 | 1.60e-02 | NA | 8.94e-09 |
| 3. B | Q2IBF7 | Cortactin-binding protein 2 | 5.86e-03 | NA | 1.56e-08 |
| 3. B | Q8TAK5 | GA-binding protein subunit beta-2 | 1.11e-06 | NA | 1.69e-06 |
| 3. B | Q71S22 | Inversin-A | 6.09e-05 | NA | 7.60e-15 |
| 3. B | Q1RK83 | Putative ankyrin repeat protein RBE_0150 | 1.10e-05 | NA | 6.88e-04 |
| 3. B | Q1RI31 | Putative ankyrin repeat protein RBE_0902 | 4.19e-05 | NA | 0.007 |
| 3. B | Q5BJT1 | Ankyrin repeat domain-containing protein 34A | 3.29e-04 | NA | 1.51e-05 |
| 3. B | Q4UMH6 | Putative ankyrin repeat protein RF_0381 | 5.79e-04 | NA | 7.73e-18 |
| 3. B | P53355 | Death-associated protein kinase 1 | 4.66e-03 | NA | 3.70e-18 |
| 3. B | Q804S5 | E3 ubiquitin-protein ligase mib1 | 2.94e-04 | NA | 2.24e-13 |
| 3. B | Q8IYU2 | E3 ubiquitin-protein ligase HACE1 | 1.50e-04 | NA | 6.28e-13 |
| 3. B | Q875S9 | Palmitoyltransferase AKR1 | 5.81e-06 | NA | 3.18e-09 |
| 3. B | P0CS66 | Palmitoyltransferase AKR1 | 1.80e-05 | NA | 9.79e-11 |
| 3. B | Q9HLN1 | Putative ankyrin repeat protein Ta0196 | 7.60e-13 | NA | 9.47e-09 |
| 3. B | Q6B858 | Fibronectin type 3 and ankyrin repeat domains protein 1 | 1.62e-10 | NA | 1.48e-13 |
| 3. B | Q8NB46 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 2.37e-04 | NA | 3.08e-15 |
| 3. B | P21001 | Ankyrin repeat protein B4 | NA | NA | 4.12e-05 |
| 3. B | Q9J4Z7 | Putative ankyrin repeat protein FPV243 | NA | NA | 0.003 |
| 3. B | P25963 | NF-kappa-B inhibitor alpha | 1.80e-07 | NA | 4.66e-04 |
| 3. B | Q0VCS9 | Ankyrin repeat and MYND domain-containing protein 2 | 2.83e-05 | NA | 0.005 |
| 3. B | Q5REW9 | Ankyrin repeat domain-containing protein 27 | 1.90e-03 | NA | 4.22e-12 |
| 3. B | Q863Z4 | Myotrophin | 4.77e-09 | NA | 3.18e-04 |
| 3. B | Q9CQ31 | Ankyrin repeat and SOCS box protein 11 | 2.26e-07 | NA | 0.002 |
| 3. B | Q6JAN1 | Inversin | 1.39e-05 | NA | 4.45e-15 |
| 3. B | G3V8T1 | M-phase phosphoprotein 8 | 1.33e-03 | NA | 0.001 |
| 3. B | F4IS56 | Integrin-linked protein kinase 1 | 6.23e-02 | NA | 0.024 |
| 3. B | Q5RJK8 | Acyl-CoA-binding domain-containing protein 6 | 2.57e-04 | NA | 1.10e-06 |
| 3. B | D3ZBM7 | E3 ubiquitin-protein ligase HACE1 | 4.43e-04 | NA | 4.51e-13 |
| 3. B | Q9J5G9 | Putative ankyrin repeat protein FPV034 | NA | NA | 2.10e-08 |
| 3. B | A2AS55 | Ankyrin repeat domain-containing protein 16 | 4.03e-11 | NA | 3.61e-06 |
| 3. B | P23631 | Alpha-latrotoxin-Lt1a | 4.76e-03 | NA | 3.71e-12 |
| 3. B | Q5U5A6 | Notch-regulated ankyrin repeat-containing protein | 3.97e-06 | NA | 0.010 |
| 3. B | P39010 | Palmitoyltransferase AKR1 | 1.58e-04 | NA | 7.54e-07 |
| 3. B | Q8WXD9 | Caskin-1 | 8.56e-04 | NA | 4.49e-13 |
| 3. B | Q8R560 | Ankyrin repeat domain-containing protein 1 | 4.77e-06 | NA | 6.87e-12 |
| 3. B | Q60778 | NF-kappa-B inhibitor beta | 8.28e-06 | NA | 2.64e-05 |
| 3. B | Q9FY48 | E3 ubiquitin-protein ligase KEG | 1.17e-02 | NA | 2.40e-07 |
| 3. B | A0A084B9Z8 | Ankyrin repeat domain-containing protein SAT10 | 6.80e-02 | NA | 2.20e-07 |
| 3. B | Q8WZ74 | Cortactin-binding protein 2 | 1.70e-02 | NA | 1.58e-08 |
| 3. B | Q3EC11 | Probable protein S-acyltransferase 23 | 1.94e-07 | NA | 3.79e-07 |
| 3. B | Q5B0V6 | Palmitoyltransferase akr1 | 9.69e-04 | NA | 2.65e-08 |
| 3. B | Q6DRG7 | Protein phosphatase 1 regulatory subunit 12A | 7.92e-04 | NA | 1.14e-05 |
| 3. B | Q96DX5 | Ankyrin repeat and SOCS box protein 9 | 4.46e-09 | NA | 1.21e-05 |
| 3. B | Q9P2D0 | Inhibitor of Bruton tyrosine kinase | 3.58e-01 | NA | 0.009 |
| 3. B | Q6DCL5 | E3 ubiquitin-protein ligase HACE1 | 3.22e-03 | NA | 8.89e-14 |
| 3. B | Q9BR61 | Acyl-CoA-binding domain-containing protein 6 | 6.57e-03 | NA | 1.05e-07 |
| 3. B | Q2QL82 | Cortactin-binding protein 2 | 2.11e-02 | NA | 5.61e-10 |
| 3. B | Q96NW4 | Ankyrin repeat domain-containing protein 27 | 5.92e-03 | NA | 8.14e-13 |
| 3. B | A7E2S9 | Putative ankyrin repeat domain-containing protein 30B-like | 2.29e-07 | NA | 1.76e-49 |
| 3. B | Q8VE42 | Ankyrin repeat domain-containing protein 49 | 5.39e-04 | NA | 0.002 |