Summary
A0A0J9YXQ4
Homolog: P0CW24.
Function: Paraneoplastic antigen-like protein 6A.
Statistics
Total GO Annotation: 246
Unique PROST Go: 17
Unique BLAST Go: 221
Total Homologs: 200
Unique PROST Homologs: 7
Unique BLAST Homologs: 178
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
P0CW24
(Paraneoplastic antigen-like protein 6A) with a FATCAT P-Value: 4.99e-06 and RMSD of 10.10 angstrom. The sequence alignment identity is 31.7%.
Structural alignment shown in left. Query protein A0A0J9YXQ4 colored as red in alignment, homolog P0CW24 colored as blue.
Query protein A0A0J9YXQ4 is also shown in right top, homolog P0CW24 showed in right bottom. They are colored based on secondary structures.
A0A0J9YXQ4 MALAMLRDWCRWMGANAERSLLILGIPDDCKEHEFQEAVRAALSPLGRYRVLTKHFRKELGAKAALVEFAEYLNRSLIPHQIPGNGGPWKVIFLPQVPVI 100 P0CW24 MAVTMLQDWCRWMGVNARRGLLILGIPEDCDDAEFQESLEAALRPMGHFTVLGKAFREEDNATAALVELDREVNYALVPREIPGTGGPWNVVFVP----- 95 A0A0J9YXQ4 EFQDMPSFPAQPQGQAVAKAAGEGGGAGEAGGVGEVGAAGEAGGTGEAGATGEAGAAGEAGGAGEAGGVGEAGAAGEAGGAGEAGAAGEGGAAGEAGGAG 200 P0CW24 ------------------RCSGE-----EFLGLGRVFHFPE-----QEGQMVES--------------V--AGAL------------------------- 126 A0A0J9YXQ4 EAGGVGEAGAAGEAGGAGEAGGVGEAGAAGEAGGAGEAGAAGEAGGAGEGRAAGEAGAAGEAGAVGEAGAAGEAGAVGEAGAAGEAGAVGEAGGTNVTKA 300 P0CW24 ---GV----------------GL--------------------------RRVCW-------LRSIGQA-------------------------------- 142 A0A0J9YXQ4 WVQPW----RCTLQPVLENRAYRELRPFSRREQ--PGCEEESFESWVEHAKDMLQLWCHASEREKKRWLLESLGGPALEVVSGLLEEDTNLSALDCLAAL 394 P0CW24 -VQPWVEAVRC-----------QSLGVFSGRDQPAPG--EESFEVWLDHTTEMLHVWQGVSERERRRRLLEGLRGTALQLVHALLAENPARTAQDCLAAL 228 A0A0J9YXQ4 GQVFRNQDTRMTSRLKFLTCTQGPQEG--LFAFVVRLEGLLQRAVEKGAVCPALANYLRLQQVLSWARPSEALQDTLRGMQLEKRPPGFLGLLRLIREME 492 P0CW24 AQVFGDNESQATIRVKCLTAQQ--QSGERLSAFVLRLEVLLQKAMEKEALARASADRVRLRQMLTRAHLTEPLDEALRKLRMAGRSPSFLEMLGLVRESE 326 A0A0J9YXQ4 AWAAFPARSQQGVAWAAAPVESEDPAAAQASPAQGNASEAG--PGAEDAAEAASATKEAARGAPAAGEGESAPAGPEGLGQARPIEVPWGSSPARMSSAV 590 P0CW24 AWEASLARS----------VR------AQTQ--EG----AGARAGAQAVARA--STKV-----------EAVPGGP-G----R--E-------------- 370 A0A0J9YXQ4 WVFPRGLSWGPEGLIQVRGQEARKPPL--EGLQTILEEPENEDEDGAGDEGQPKSSQGK 647 P0CW24 ----------PEGLLQAGGQEAEE--LLQEGLKPVLEECDN------------------ 399
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0090200 | positive regulation of release of cytochrome c from mitochondria |
| 1. PB | GO:0008625 | extrinsic apoptotic signaling pathway via death domain receptors |
| 1. PB | GO:0097192 | extrinsic apoptotic signaling pathway in absence of ligand |
| 1. PB | GO:0097190 | apoptotic signaling pathway |
| 1. PB | GO:0001844 | protein insertion into mitochondrial membrane involved in apoptotic signaling pathway |
| 1. PB | GO:0008630 | intrinsic apoptotic signaling pathway in response to DNA damage |
| 1. PB | GO:0043065 | positive regulation of apoptotic process |
| 1. PB | GO:0002437 | inflammatory response to antigenic stimulus |
| 2. P | GO:0042025 | host cell nucleus |
| 2. P | GO:0039588 | suppression by virus of host antigen processing and presentation |
| 2. P | GO:0019042 | viral latency |
| 2. P | GO:0003700 | DNA-binding transcription factor activity |
| 2. P | GO:0006275 | regulation of DNA replication |
| 2. P | GO:0039660 | structural constituent of virion |
| 2. P | GO:0005829 | cytosol |
| 2. P | GO:0039504 | suppression by virus of host adaptive immune response |
| 2. P | GO:0039644 | suppression by virus of host NF-kappaB cascade |
| 2. P | GO:0045893 | positive regulation of transcription, DNA-templated |
| 2. P | GO:0044185 | host cell late endosome membrane |
| 2. P | GO:0005730 | nucleolus |
| 2. P | GO:0072494 | host multivesicular body |
| 2. P | GO:0042981 | regulation of apoptotic process |
| 2. P | GO:0039702 | viral budding via host ESCRT complex |
| 2. P | GO:0005654 | nucleoplasm |
| 2. P | GO:0003676 | nucleic acid binding |
| 3. B | GO:0030198 | extracellular matrix organization |
| 3. B | GO:0071711 | basement membrane organization |
| 3. B | GO:0099184 | structural constituent of postsynaptic intermediate filament cytoskeleton |
| 3. B | GO:0048706 | embryonic skeletal system development |
| 3. B | GO:0060021 | roof of mouth development |
| 3. B | GO:2001240 | negative regulation of extrinsic apoptotic signaling pathway in absence of ligand |
| 3. B | GO:0048407 | platelet-derived growth factor binding |
| 3. B | GO:0032183 | SUMO binding |
| 3. B | GO:0010718 | positive regulation of epithelial to mesenchymal transition |
| 3. B | GO:1903561 | extracellular vesicle |
| 3. B | GO:0016043 | cellular component organization |
| 3. B | GO:0060107 | annuli extracellular matrix |
| 3. B | GO:0005589 | collagen type VI trimer |
| 3. B | GO:0001958 | endochondral ossification |
| 3. B | GO:0097418 | neurofibrillary tangle |
| 3. B | GO:0051216 | cartilage development |
| 3. B | GO:0097440 | apical dendrite |
| 3. B | GO:1904399 | heparan sulfate binding |
| 3. B | GO:0071873 | response to norepinephrine |
| 3. B | GO:0005201 | extracellular matrix structural constituent |
| 3. B | GO:2001223 | negative regulation of neuron migration |
| 3. B | GO:0007585 | respiratory gaseous exchange by respiratory system |
| 3. B | GO:0033693 | neurofilament bundle assembly |
| 3. B | GO:0005586 | collagen type III trimer |
| 3. B | GO:0045299 | otolith mineralization |
| 3. B | GO:0048705 | skeletal system morphogenesis |
| 3. B | GO:0071306 | cellular response to vitamin E |
| 3. B | GO:1902513 | regulation of organelle transport along microtubule |
| 3. B | GO:0060174 | limb bud formation |
| 3. B | GO:0050910 | detection of mechanical stimulus involved in sensory perception of sound |
| 3. B | GO:0090263 | positive regulation of canonical Wnt signaling pathway |
| 3. B | GO:0030903 | notochord development |
| 3. B | GO:1903225 | negative regulation of endodermal cell differentiation |
| 3. B | GO:0035987 | endodermal cell differentiation |
| 3. B | GO:0007605 | sensory perception of sound |
| 3. B | GO:0010812 | negative regulation of cell-substrate adhesion |
| 3. B | GO:0002164 | larval development |
| 3. B | GO:0048514 | blood vessel morphogenesis |
| 3. B | GO:0005576 | extracellular region |
| 3. B | GO:0048840 | otolith development |
| 3. B | GO:0001502 | cartilage condensation |
| 3. B | GO:0030141 | secretory granule |
| 3. B | GO:0050828 | regulation of liquid surface tension |
| 3. B | GO:0035848 | oviduct morphogenesis |
| 3. B | GO:0003431 | growth plate cartilage chondrocyte development |
| 3. B | GO:0097242 | amyloid-beta clearance |
| 3. B | GO:0035025 | positive regulation of Rho protein signal transduction |
| 3. B | GO:0035313 | wound healing, spreading of epidermal cells |
| 3. B | GO:0005788 | endoplasmic reticulum lumen |
| 3. B | GO:0005615 | extracellular space |
| 3. B | GO:0040032 | post-embryonic body morphogenesis |
| 3. B | GO:0007266 | Rho protein signal transduction |
| 3. B | GO:0008228 | opsonization |
| 3. B | GO:0001569 | branching involved in blood vessel morphogenesis |
| 3. B | GO:0009612 | response to mechanical stimulus |
| 3. B | GO:0048704 | embryonic skeletal system morphogenesis |
| 3. B | GO:0005044 | scavenger receptor activity |
| 3. B | GO:1903935 | response to sodium arsenite |
| 3. B | GO:0005737 | cytoplasm |
| 3. B | GO:0048936 | peripheral nervous system neuron axonogenesis |
| 3. B | GO:0060351 | cartilage development involved in endochondral bone morphogenesis |
| 3. B | GO:0071560 | cellular response to transforming growth factor beta stimulus |
| 3. B | GO:0099160 | postsynaptic intermediate filament cytoskeleton |
| 3. B | GO:0050766 | positive regulation of phagocytosis |
| 3. B | GO:0007420 | brain development |
| 3. B | GO:0005597 | collagen type XVI trimer |
| 3. B | GO:0097435 | supramolecular fiber organization |
| 3. B | GO:0071260 | cellular response to mechanical stimulus |
| 3. B | GO:0002020 | protease binding |
| 3. B | GO:0008217 | regulation of blood pressure |
| 3. B | GO:0031581 | hemidesmosome assembly |
| 3. B | GO:0043394 | proteoglycan binding |
| 3. B | GO:0050777 | negative regulation of immune response |
| 3. B | GO:0045104 | intermediate filament cytoskeleton organization |
| 3. B | GO:0005585 | collagen type II trimer |
| 3. B | GO:0007417 | central nervous system development |
| 3. B | GO:0001501 | skeletal system development |
| 3. B | GO:0043129 | surfactant homeostasis |
| 3. B | GO:0005883 | neurofilament |
| 3. B | GO:0005581 | collagen trimer |
| 3. B | GO:0042302 | structural constituent of cuticle |
| 3. B | GO:0005584 | collagen type I trimer |
| 3. B | GO:0034505 | tooth mineralization |
| 3. B | GO:0071300 | cellular response to retinoic acid |
| 3. B | GO:0042130 | negative regulation of T cell proliferation |
| 3. B | GO:0042383 | sarcolemma |
| 3. B | GO:0061304 | retinal blood vessel morphogenesis |
| 3. B | GO:0005886 | plasma membrane |
| 3. B | GO:0071773 | cellular response to BMP stimulus |
| 3. B | GO:0006911 | phagocytosis, engulfment |
| 3. B | GO:0009314 | response to radiation |
| 3. B | GO:0003007 | heart morphogenesis |
| 3. B | GO:0001649 | osteoblast differentiation |
| 3. B | GO:0048565 | digestive tract development |
| 3. B | GO:0045087 | innate immune response |
| 3. B | GO:0002062 | chondrocyte differentiation |
| 3. B | GO:0034381 | plasma lipoprotein particle clearance |
| 3. B | GO:0042289 | MHC class II protein binding |
| 3. B | GO:0005537 | mannose binding |
| 3. B | GO:0001894 | tissue homeostasis |
| 3. B | GO:0001540 | amyloid-beta binding |
| 3. B | GO:0070208 | protein heterotrimerization |
| 3. B | GO:0071447 | cellular response to hydroperoxide |
| 3. B | GO:0030282 | bone mineralization |
| 3. B | GO:0070287 | ferritin receptor activity |
| 3. B | GO:0038024 | cargo receptor activity |
| 3. B | GO:0060325 | face morphogenesis |
| 3. B | GO:0050765 | negative regulation of phagocytosis |
| 3. B | GO:0043152 | induction of bacterial agglutination |
| 3. B | GO:0048839 | inner ear development |
| 3. B | GO:0003417 | growth plate cartilage development |
| 3. B | GO:0005592 | collagen type XI trimer |
| 3. B | GO:0032964 | collagen biosynthetic process |
| 3. B | GO:0042338 | cuticle development involved in collagen and cuticulin-based cuticle molting cycle |
| 3. B | GO:0048592 | eye morphogenesis |
| 3. B | GO:0060346 | bone trabecula formation |
| 3. B | GO:0007160 | cell-matrix adhesion |
| 3. B | GO:0007229 | integrin-mediated signaling pathway |
| 3. B | GO:1900078 | positive regulation of cellular response to insulin stimulus |
| 3. B | GO:0007601 | visual perception |
| 3. B | GO:0001886 | endothelial cell morphogenesis |
| 3. B | GO:0045112 | integrin biosynthetic process |
| 3. B | GO:1905226 | regulation of adhesion of symbiont to host epithelial cell |
| 3. B | GO:0051591 | response to cAMP |
| 3. B | GO:0007179 | transforming growth factor beta receptor signaling pathway |
| 3. B | GO:0052405 | |
| 3. B | GO:0060272 | embryonic skeletal joint morphogenesis |
| 3. B | GO:0045162 | clustering of voltage-gated sodium channels |
| 3. B | GO:0006029 | proteoglycan metabolic process |
| 3. B | GO:0032963 | collagen metabolic process |
| 3. B | GO:0048570 | notochord morphogenesis |
| 3. B | GO:0030056 | hemidesmosome |
| 3. B | GO:0042329 | structural constituent of collagen and cuticulin-based cuticle |
| 3. B | GO:0048286 | lung alveolus development |
| 3. B | GO:0001957 | intramembranous ossification |
| 3. B | GO:0045110 | intermediate filament bundle assembly |
| 3. B | GO:0006898 | receptor-mediated endocytosis |
| 3. B | GO:0035108 | limb morphogenesis |
| 3. B | GO:0005178 | integrin binding |
| 3. B | GO:0010171 | body morphogenesis |
| 3. B | GO:0150017 | basal proximal dendrite |
| 3. B | GO:0005590 | collagen type VII trimer |
| 3. B | GO:0031012 | extracellular matrix |
| 3. B | GO:0005518 | collagen binding |
| 3. B | GO:0008201 | heparin binding |
| 3. B | GO:0031103 | axon regeneration |
| 3. B | GO:0001552 | ovarian follicle atresia |
| 3. B | GO:0033622 | integrin activation |
| 3. B | GO:0032355 | response to estradiol |
| 3. B | GO:0002063 | chondrocyte development |
| 3. B | GO:0120153 | calcium-dependent carbohydrate binding |
| 3. B | GO:0086080 | protein binding involved in heterotypic cell-cell adhesion |
| 3. B | GO:0060385 | axonogenesis involved in innervation |
| 3. B | GO:0008544 | epidermis development |
| 3. B | GO:0005588 | collagen type V trimer |
| 3. B | GO:0001530 | lipopolysaccharide binding |
| 3. B | GO:0030335 | positive regulation of cell migration |
| 3. B | GO:0071364 | cellular response to epidermal growth factor stimulus |
| 3. B | GO:1903354 | regulation of distal tip cell migration |
| 3. B | GO:0007155 | cell adhesion |
| 3. B | GO:0044344 | cellular response to fibroblast growth factor stimulus |
| 3. B | GO:0034504 | protein localization to nucleus |
| 3. B | GO:0097065 | anterior head development |
| 3. B | GO:0001568 | blood vessel development |
| 3. B | GO:0003677 | DNA binding |
| 3. B | GO:0060023 | soft palate development |
| 3. B | GO:0008585 | female gonad development |
| 3. B | GO:0018149 | peptide cross-linking |
| 3. B | GO:0061564 | axon development |
| 3. B | GO:0061333 | renal tubule morphogenesis |
| 3. B | GO:1903937 | response to acrylamide |
| 3. B | GO:0015643 | toxic substance binding |
| 3. B | GO:0032703 | negative regulation of interleukin-2 production |
| 3. B | GO:0005771 | multivesicular body |
| 3. B | GO:0043434 | response to peptide hormone |
| 3. B | GO:0001525 | angiogenesis |
| 3. B | GO:0043277 | apoptotic cell clearance |
| 3. B | GO:0040002 | collagen and cuticulin-based cuticle development |
| 3. B | GO:0005604 | basement membrane |
| 3. B | GO:0071356 | cellular response to tumor necrosis factor |
| 3. B | GO:0051894 | positive regulation of focal adhesion assembly |
| 3. B | GO:0038063 | collagen-activated tyrosine kinase receptor signaling pathway |
| 3. B | GO:0071599 | otic vesicle development |
| 3. B | GO:1902617 | response to fluoride |
| 3. B | GO:0055010 | ventricular cardiac muscle tissue morphogenesis |
| 3. B | GO:0005791 | rough endoplasmic reticulum |
| 3. B | GO:0005583 | fibrillar collagen trimer |
| 3. B | GO:0016021 | integral component of membrane |
| 3. B | GO:0046332 | SMAD binding |
| 3. B | GO:0021987 | cerebral cortex development |
| 3. B | GO:0085029 | extracellular matrix assembly |
| 3. B | GO:0035989 | tendon development |
| 3. B | GO:0071230 | cellular response to amino acid stimulus |
| 3. B | GO:0001503 | ossification |
| 3. B | GO:0030199 | collagen fibril organization |
| 3. B | GO:0005587 | collagen type IV trimer |
| 3. B | GO:0044691 | tooth eruption |
| 3. B | GO:0042472 | inner ear morphogenesis |
| 3. B | GO:0040014 | regulation of multicellular organism growth |
| 3. B | GO:0042542 | response to hydrogen peroxide |
| 3. B | GO:0048621 | post-embryonic digestive tract morphogenesis |
| 3. B | GO:0032528 | microvillus organization |
| 3. B | GO:0034097 | response to cytokine |
| 3. B | GO:0007528 | neuromuscular junction development |
| 3. B | GO:0033627 | cell adhesion mediated by integrin |
| 3. B | GO:0062023 | collagen-containing extracellular matrix |
| 3. B | GO:0055093 | response to hyperoxia |
| 3. B | GO:0060414 | aorta smooth muscle tissue morphogenesis |
| 3. B | GO:0031960 | response to corticosteroid |
| 3. B | GO:0043589 | skin morphogenesis |
| 3. B | GO:0042060 | wound healing |
| 3. B | GO:0060102 | collagen and cuticulin-based cuticle extracellular matrix |
| 3. B | GO:0030020 | extracellular matrix structural constituent conferring tensile strength |
| 3. B | GO:0005594 | collagen type IX trimer |
| 3. B | GO:0060052 | neurofilament cytoskeleton organization |
| 3. B | GO:0042802 | identical protein binding |
| 3. B | GO:0043588 | skin development |
| 3. B | GO:1902618 | cellular response to fluoride |
| 3. B | GO:0008584 | male gonad development |
| 3. B | GO:0051128 | regulation of cellular component organization |
| 3. B | GO:0030674 | protein-macromolecule adaptor activity |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q8ND90 | Paraneoplastic antigen Ma1 | 1.27e-03 | 6.30e-06 | 6.40e-28 |
| 1. PB | Q9ERH6 | Modulator of apoptosis 1 | 3.74e-04 | 3.66e-02 | 6.58e-26 |
| 1. PB | A6QLK5 | Paraneoplastic antigen Ma1 homolog | 3.18e-04 | 4.89e-05 | 4.76e-28 |
| 1. PB | Q8BHK0 | Paraneoplastic antigen Ma2 homolog | 4.60e-04 | 4.80e-04 | 3.85e-24 |
| 1. PB | Q5R486 | Paraneoplastic antigen Ma2 homolog | 4.23e-04 | 2.59e-07 | 6.57e-30 |
| 1. PB | Q96PV4 | Paraneoplastic antigen-like protein 5 | 1.66e-03 | 8.40e-07 | 1.75e-27 |
| 1. PB | Q8VHZ4 | Paraneoplastic antigen Ma1 homolog | 8.94e-04 | 7.14e-07 | 2.51e-27 |
| 1. PB | Q9UL42 | Paraneoplastic antigen Ma2 | 3.81e-04 | 5.98e-07 | 2.02e-31 |
| 1. PB | Q2KIT6 | Paraneoplastic antigen Ma2 homolog | 3.12e-04 | 7.92e-06 | 2.02e-35 |
| 1. PB | Q9GMU3 | Paraneoplastic antigen Ma2 homolog | 2.63e-05 | 5.80e-08 | 4.85e-31 |
| 1. PB | A0A0J9YXQ4 | Paraneoplastic antigen Ma6E | 0 | 8.83e-151 | 0.0 |
| 1. PB | A0A0J9YX94 | Paraneoplastic antigen Ma6F | 7.04e-05 | 1.17e-24 | 1.13e-155 |
| 1. PB | P0CW24 | Paraneoplastic antigen-like protein 6A | 4.99e-06 | 7.12e-03 | 1.48e-33 |
| 1. PB | Q8C1C8 | Paraneoplastic antigen Ma1 homolog | 1.02e-03 | 1.82e-06 | 5.78e-27 |
| 1. PB | Q8JZW8 | Paraneoplastic antigen Ma3 homolog | 4.86e-03 | 8.15e-04 | 8.90e-36 |
| 2. P | Q196Z8 | Uncharacterized protein 062L | NA | 3.82e-03 | NA |
| 2. P | Q7M4S9 | Uncharacterized protein YBL113C | 6.35e-01 | 2.03e-03 | NA |
| 2. P | Q8N8U3 | Retrotransposon Gag-like protein 3 | 3.02e-02 | 1.71e-02 | NA |
| 2. P | P03211 | Epstein-Barr nuclear antigen 1 | NA | 4.25e-05 | NA |
| 2. P | P21416 | Gag polyprotein | NA | 6.84e-03 | NA |
| 2. P | Q1HVF7 | Epstein-Barr nuclear antigen 1 | NA | 3.27e-04 | NA |
| 2. P | Q3KSS4 | Epstein-Barr nuclear antigen 1 | NA | 3.15e-05 | NA |
| 3. B | P16884 | Neurofilament heavy polypeptide | 6.90e-01 | NA | 1.13e-05 |
| 3. B | Q07092 | Collagen alpha-1(XVI) chain | 3.74e-01 | NA | 0.025 |
| 3. B | Q05722 | Collagen alpha-1(IX) chain | 1.64e-01 | NA | 4.47e-12 |
| 3. B | Q0II24 | Complement C1q and tumor necrosis factor-related protein 9 | 1.28e-01 | NA | 4.50e-07 |
| 3. B | C0HJP4 | Collagen alpha-2(I) chain (Fragments) | 3.63e-01 | NA | 0.035 |
| 3. B | O42350 | Collagen alpha-2(I) chain | 8.30e-01 | NA | 1.67e-09 |
| 3. B | Q5UPS7 | Collagen-like protein 4 | NA | NA | 6.48e-09 |
| 3. B | C0HLJ0 | Collagen alpha-2(I) chain (Fragments) | 3.17e-01 | NA | 0.007 |
| 3. B | Q5UPE4 | Collagen-like protein 1 | NA | NA | 1.91e-14 |
| 3. B | Q5UQ50 | Collagen-like protein 6 | NA | NA | 2.70e-10 |
| 3. B | Q14055 | Collagen alpha-2(IX) chain | 1.99e-01 | NA | 1.63e-04 |
| 3. B | Q07643 | Collagen alpha-2(IX) chain | 2.62e-01 | NA | 1.32e-06 |
| 3. B | P12106 | Collagen alpha-1(IX) chain | 3.79e-01 | NA | 3.21e-05 |
| 3. B | A0A1B0GUJ8 | Paraneoplastic antigen-like protein 8C | 2.37e-03 | NA | 8.85e-22 |
| 3. B | Q28668 | Collagen alpha-2(I) chain (Fragment) | 6.59e-02 | NA | 1.19e-13 |
| 3. B | C0HLH0 | Collagen alpha-2(I) chain (Fragments) | 4.28e-01 | NA | 0.022 |
| 3. B | P30204 | Macrophage scavenger receptor types I and II | 6.40e-01 | NA | 0.028 |
| 3. B | Q95WA4 | Spore wall protein 2 | 2.71e-01 | NA | 0.017 |
| 3. B | P13941 | Collagen alpha-1(III) chain | 4.00e-01 | NA | 4.49e-07 |
| 3. B | Q5R6R8 | Paraneoplastic antigen-like protein 8A | 1.99e-02 | NA | 2.46e-22 |
| 3. B | Q9WUB9 | Macrophage receptor MARCO | 2.95e-01 | NA | 6.51e-09 |
| 3. B | P83371 | Otolin-1 | 1.07e-01 | NA | 3.69e-10 |
| 3. B | Q02388 | Collagen alpha-1(VII) chain | NA | NA | 1.04e-09 |
| 3. B | Q03637 | Acetylcholinesterase collagenic tail peptide | 2.02e-01 | NA | 2.72e-07 |
| 3. B | C0HJP8 | Collagen alpha-2(I) chain (Fragments) | 1.92e-01 | NA | 0.003 |
| 3. B | Q80ZF0 | Collagen alpha-1(XXVII) chain | 8.06e-01 | NA | 3.30e-12 |
| 3. B | P20785 | Collagen alpha-1(VI) chain | 3.20e-01 | NA | 1.17e-05 |
| 3. B | Q99MQ5 | Collagen alpha-1(XXV) chain | 3.41e-01 | NA | 8.05e-09 |
| 3. B | A8TX70 | Collagen alpha-5(VI) chain | 9.12e-01 | NA | 3.10e-17 |
| 3. B | P23206 | Collagen alpha-1(X) chain | 2.15e-01 | NA | 6.81e-10 |
| 3. B | Q5UPX3 | Collagen-like protein 3 | NA | NA | 1.55e-09 |
| 3. B | Q05306 | Collagen alpha-1(X) chain | 2.21e-01 | NA | 4.11e-06 |
| 3. B | Q9JI03 | Collagen alpha-1(V) chain | 8.70e-01 | NA | 0.013 |
| 3. B | Q8NFW1 | Collagen alpha-1(XXII) chain | 9.37e-01 | NA | 0.033 |
| 3. B | A6H584 | Collagen alpha-5(VI) chain | 8.08e-01 | NA | 1.22e-18 |
| 3. B | Q5QNQ9 | Collagen alpha-1(XXVII) chain | 8.59e-01 | NA | 8.16e-12 |
| 3. B | Q14050 | Collagen alpha-3(IX) chain | 1.53e-01 | NA | 6.90e-05 |
| 3. B | P15988 | Collagen alpha-2(VI) chain | 2.21e-01 | NA | 3.26e-09 |
| 3. B | P32017 | Collagen alpha-3(IX) chain | 6.47e-02 | NA | 2.92e-07 |
| 3. B | Q6P4Z2 | Collagen alpha-1(II) chain | 6.71e-01 | NA | 2.13e-09 |
| 3. B | Q30D77 | Collagen alpha-1(XXIV) chain | 8.70e-01 | NA | 2.06e-15 |
| 3. B | P91285 | Cuticle collagen dpy-5 | 9.94e-02 | NA | 6.47e-05 |
| 3. B | A8XV37 | Putative cuticle collagen 145 | 3.95e-01 | NA | 0.031 |
| 3. B | Q07563 | Collagen alpha-1(XVII) chain | 8.18e-01 | NA | 6.45e-04 |
| 3. B | C0HLJ8 | Collagen alpha-2(I) chain (Fragments) | 3.69e-01 | NA | 6.22e-04 |
| 3. B | P11087 | Collagen alpha-1(I) chain | 7.24e-01 | NA | 3.18e-04 |
| 3. B | Q80VM8 | Paraneoplastic antigen-like protein 8A | 1.62e-02 | NA | 7.39e-21 |
| 3. B | A2AX52 | Collagen alpha-4(VI) chain | 4.93e-01 | NA | 5.08e-14 |
| 3. B | P34340 | Putative cuticle collagen 90 | 1.01e-01 | NA | 4.12e-07 |
| 3. B | P08123 | Collagen alpha-2(I) chain | 8.08e-01 | NA | 4.42e-08 |
| 3. B | P08120 | Collagen alpha-1(IV) chain | 9.24e-01 | NA | 0.002 |
| 3. B | C0HLK0 | Collagen alpha-2(I) chain (Fragments) | 5.45e-01 | NA | 0.047 |
| 3. B | P08572 | Collagen alpha-2(IV) chain | 7.97e-01 | NA | 7.86e-06 |
| 3. B | C0HLG8 | Collagen alpha-2(I) chain (Fragments) | 3.42e-01 | NA | 0.004 |
| 3. B | Q9YIB4 | Collagen alpha-1(I) chain | 6.25e-01 | NA | 1.93e-06 |
| 3. B | P85154 | Collagen alpha-2(I) chain | 7.37e-01 | NA | 0.013 |
| 3. B | Q02788 | Collagen alpha-2(VI) chain | 2.60e-01 | NA | 2.08e-07 |
| 3. B | P02460 | Collagen alpha-1(II) chain (Fragment) | 3.05e-01 | NA | 4.15e-06 |
| 3. B | Q86V59 | Paraneoplastic antigen-like protein 8A | 8.60e-03 | NA | 7.56e-23 |
| 3. B | Q91717 | Collagen alpha-1(II) chain | 8.03e-01 | NA | 8.24e-08 |
| 3. B | P35248 | Pulmonary surfactant-associated protein D | 6.59e-02 | NA | 1.39e-07 |
| 3. B | P15989 | Collagen alpha-3(VI) chain | NA | NA | 1.02e-11 |
| 3. B | Q4ZJM7 | Otolin-1 | 1.04e-01 | NA | 9.43e-12 |
| 3. B | P30754 | Fibril-forming collagen alpha chain (Fragment) | 3.55e-01 | NA | 2.77e-06 |
| 3. B | P12107 | Collagen alpha-1(XI) chain | 6.53e-01 | NA | 8.19e-06 |
| 3. B | P02458 | Collagen alpha-1(II) chain | 8.30e-01 | NA | 4.62e-07 |
| 3. B | Q9UMD9 | Collagen alpha-1(XVII) chain | 7.64e-01 | NA | 0.046 |
| 3. B | Q8IZC6 | Collagen alpha-1(XXVII) chain | 5.49e-01 | NA | 5.97e-08 |
| 3. B | Q0VF58 | Collagen alpha-1(XIX) chain | 5.46e-01 | NA | 6.14e-05 |
| 3. B | C7DZK3 | Collagen alpha-1(XXVII) chain A | 5.14e-01 | NA | 1.54e-12 |
| 3. B | Q9UEW3 | Macrophage receptor MARCO | 2.25e-01 | NA | 2.33e-12 |
| 3. B | Q6PEW1 | Zinc finger CCHC domain-containing protein 12 | 1.83e-03 | NA | 1.67e-21 |
| 3. B | P08116 | Processed variable antigen (Fragment) | 2.64e-01 | NA | 1.03e-09 |
| 3. B | P12109 | Collagen alpha-1(VI) chain | 8.76e-02 | NA | 5.46e-07 |
| 3. B | B7Z0K8 | Collagen alpha chain CG42342 | 5.05e-01 | NA | 2.44e-06 |
| 3. B | P20909 | Collagen alpha-1(XI) chain | 8.39e-01 | NA | 6.29e-06 |
| 3. B | Q2UY11 | Collagen alpha-1(XXVIII) chain | 1.82e-01 | NA | 2.13e-05 |
| 3. B | Q9QZR9 | Collagen alpha-4(IV) chain | 8.43e-01 | NA | 0.015 |
| 3. B | P18503 | Short-chain collagen C4 (Fragment) | 4.60e-01 | NA | 0.001 |
| 3. B | Q17460 | Cuticle collagen 10 | 1.16e-01 | NA | 6.76e-04 |
| 3. B | Q8BMF8 | Gliomedin | 3.83e-01 | NA | 0.040 |
| 3. B | Q8MHZ9 | Collectin-46 | 1.02e-01 | NA | 8.49e-08 |
| 3. B | Q5HZA3 | Zinc finger CCHC domain-containing protein 12 | 1.82e-03 | NA | 3.52e-19 |
| 3. B | Q8VD24 | Zinc finger CCHC domain-containing protein 18 | 3.69e-04 | NA | 2.92e-21 |
| 3. B | A0A060WQA3 | Otolin-1 | 9.24e-02 | NA | 1.92e-06 |
| 3. B | O93484 | Collagen alpha-2(I) chain | 6.26e-01 | NA | 6.13e-06 |
| 3. B | Q9N1X4 | Pulmonary surfactant-associated protein D | 6.65e-02 | NA | 0.050 |
| 3. B | Q17RW2 | Collagen alpha-1(XXIV) chain | 8.16e-01 | NA | 1.71e-14 |
| 3. B | Q9JMH4 | Collagen alpha-1(XVII) chain | 2.29e-01 | NA | 2.02e-05 |
| 3. B | P27393 | Collagen alpha-2(IV) chain | 8.62e-01 | NA | 9.97e-05 |
| 3. B | Q9CZA5 | Zinc finger CCHC domain-containing protein 12 | 4.82e-04 | NA | 2.60e-18 |
| 3. B | Q641F3 | Collagen alpha-1(XXI) chain | 2.79e-01 | NA | 1.39e-12 |
| 3. B | P0C862 | Complement C1q and tumor necrosis factor-related protein 9A | 3.68e-01 | NA | 1.96e-11 |
| 3. B | Q8BLX7 | Collagen alpha-1(XVI) chain | 6.05e-01 | NA | 0.002 |
| 3. B | Q95KI4 | Modulator of apoptosis 1 | 3.01e-04 | NA | 2.78e-22 |
| 3. B | Q64739 | Collagen alpha-2(XI) chain | 6.73e-01 | NA | 5.29e-09 |
| 3. B | Q9BXS0 | Collagen alpha-1(XXV) chain | 2.87e-01 | NA | 2.59e-07 |
| 3. B | Q63870 | Collagen alpha-1(VII) chain | NA | NA | 5.98e-14 |
| 3. B | P12111 | Collagen alpha-3(VI) chain | NA | NA | 3.56e-07 |
| 3. B | Q7SIB2 | Collagen alpha-1(IV) chain | 8.61e-01 | NA | 6.38e-06 |
| 3. B | Q60754 | Macrophage receptor MARCO | 2.66e-01 | NA | 3.14e-11 |
| 3. B | A5PN28 | Otolin-1-A | 1.58e-01 | NA | 8.71e-10 |
| 3. B | C0HLJ6 | Collagen alpha-2(I) chain (Fragments) | 3.95e-01 | NA | 6.00e-04 |
| 3. B | Q5U3G1 | Collectin-11 | 6.56e-01 | NA | 0.021 |
| 3. B | O35206 | Collagen alpha-1(XV) chain | 5.38e-01 | NA | 1.65e-05 |
| 3. B | P02466 | Collagen alpha-2(I) chain | 7.26e-01 | NA | 1.80e-08 |
| 3. B | P02453 | Collagen alpha-1(I) chain | 8.78e-01 | NA | 2.64e-04 |
| 3. B | Q5RFW0 | Scavenger receptor class A member 5 | 3.19e-01 | NA | 0.001 |
| 3. B | C0HLI4 | Collagen alpha-2(I) chain (Fragments) | 5.75e-01 | NA | 0.007 |
| 3. B | Q9ULN7 | Paraneoplastic antigen-like protein 8B | 2.32e-03 | NA | 2.70e-16 |
| 3. B | P12110 | Collagen alpha-2(VI) chain | 4.97e-01 | NA | 6.84e-10 |
| 3. B | P13942 | Collagen alpha-2(XI) chain | 8.28e-01 | NA | 5.29e-07 |
| 3. B | P12108 | Collagen alpha-2(IX) chain | 1.07e-01 | NA | 0.020 |
| 3. B | P35799 | Cuticle collagen dpy-2 | 9.91e-02 | NA | 0.005 |
| 3. B | Q01149 | Collagen alpha-2(I) chain | 5.50e-01 | NA | 2.70e-08 |
| 3. B | P02465 | Collagen alpha-2(I) chain | 5.02e-01 | NA | 4.44e-09 |
| 3. B | Q8C6K9 | Collagen alpha-6(VI) chain | 8.43e-01 | NA | 1.10e-07 |
| 3. B | Q14993 | Collagen alpha-1(XIX) chain | 4.05e-01 | NA | 0.006 |
| 3. B | B2RNN3 | Complement C1q and tumor necrosis factor-related protein 9B | 3.95e-01 | NA | 6.89e-12 |
| 3. B | Q4ZJN1 | Complement C1q and tumor necrosis factor-related protein 9 | 3.35e-01 | NA | 1.05e-08 |
| 3. B | C0HLN2 | Collagen alpha-2(IX) chain | 3.31e-01 | NA | 2.42e-04 |
| 3. B | P20849 | Collagen alpha-1(IX) chain | 4.13e-01 | NA | 1.30e-08 |
| 3. B | Q80WL1 | Gliomedin | 6.85e-01 | NA | 0.023 |
| 3. B | P39061 | Collagen alpha-1(XVIII) chain | 8.22e-01 | NA | 9.48e-05 |
| 3. B | P02457 | Collagen alpha-1(I) chain | NA | NA | 2.28e-10 |
| 3. B | C0HJN6 | Collagen alpha-2(I) chain (Fragments) | 2.66e-01 | NA | 0.002 |
| 3. B | P17140 | Collagen alpha-2(IV) chain | 9.48e-01 | NA | 0.035 |
| 3. B | Q04857 | Collagen alpha-1(VI) chain | 3.30e-01 | NA | 7.96e-11 |
| 3. B | Q23628 | Cuticle collagen lon-3 | 7.48e-01 | NA | 0.006 |
| 3. B | C0HLI8 | Collagen alpha-2(I) chain (Fragments) | 7.33e-01 | NA | 0.004 |
| 3. B | Q5UPS6 | Collagen-like protein 5 | NA | NA | 3.89e-10 |
| 3. B | Q96BY2 | Modulator of apoptosis 1 | 3.48e-04 | NA | 5.01e-25 |
| 3. B | Q9UL41 | Paraneoplastic antigen Ma3 | 1.35e-03 | NA | 2.84e-37 |
| 3. B | P0CG32 | Zinc finger CCHC domain-containing protein 18 | 6.79e-03 | NA | 2.99e-22 |
| 3. B | A6NMZ7 | Collagen alpha-6(VI) chain | 7.85e-01 | NA | 1.14e-11 |
| 3. B | P19246 | Neurofilament heavy polypeptide | 1.97e-01 | NA | 8.23e-14 |
| 3. B | P08121 | Collagen alpha-1(III) chain | 7.36e-01 | NA | 1.00e-06 |
| 3. B | P25940 | Collagen alpha-3(V) chain | 5.96e-01 | NA | 2.31e-07 |
| 3. B | P17139 | Collagen alpha-1(IV) chain | 6.64e-01 | NA | 1.51e-04 |
| 3. B | Q5UNS9 | Collagen-like protein 7 | NA | NA | 1.30e-13 |
| 3. B | A0MSJ1 | Collagen alpha-1(XXVII) chain B | 7.80e-01 | NA | 1.08e-14 |
| 3. B | P08122 | Collagen alpha-2(IV) chain | 6.52e-01 | NA | 0.001 |
| 3. B | C0HJP6 | Collagen alpha-2(I) chain (Fragments) | 3.33e-01 | NA | 0.002 |
| 3. B | B4YNE6 | Collagen-like protein V6 | NA | NA | 4.10e-05 |
| 3. B | B8V7R6 | Collagen alpha chain (Fragment) | 2.01e-01 | NA | 1.29e-08 |
| 3. B | P35247 | Pulmonary surfactant-associated protein D | 2.43e-02 | NA | 2.16e-05 |
| 3. B | Q61245 | Collagen alpha-1(XI) chain | 9.65e-01 | NA | 6.73e-06 |
| 3. B | Q08DL1 | Zinc finger CCHC domain-containing protein 12 | 9.63e-04 | NA | 3.92e-21 |
| 3. B | Q14031 | Collagen alpha-6(IV) chain | 9.49e-01 | NA | 6.13e-04 |
| 3. B | O88207 | Collagen alpha-1(V) chain | 9.40e-01 | NA | 0.013 |
| 3. B | A6NHN0 | Otolin-1 | 5.01e-01 | NA | 6.07e-11 |
| 3. B | Q9XSJ7 | Collagen alpha-1(I) chain | 8.76e-01 | NA | 4.48e-05 |
| 3. B | Q1PBC5 | Pulmonary surfactant-associated protein D | 2.24e-01 | NA | 9.18e-05 |
| 3. B | Q5UQ13 | Collagen-like protein 2 | NA | NA | 1.22e-11 |
| 3. B | P02461 | Collagen alpha-1(III) chain | 6.55e-01 | NA | 1.60e-09 |
| 3. B | P02454 | Collagen alpha-1(I) chain | 6.33e-01 | NA | 8.35e-06 |
| 3. B | P28481 | Collagen alpha-1(II) chain | 7.44e-01 | NA | 2.63e-06 |
| 3. B | Q09578 | Putative cuticle collagen 75 | 1.47e-01 | NA | 8.59e-05 |
| 3. B | P02452 | Collagen alpha-1(I) chain | 8.73e-01 | NA | 2.13e-04 |
| 3. B | P50404 | Pulmonary surfactant-associated protein D | 2.07e-01 | NA | 0.001 |
| 3. B | Q5DTT8 | Paraneoplastic antigen-like protein 5 | 4.21e-04 | NA | 3.29e-30 |
| 3. B | P02462 | Collagen alpha-1(IV) chain | 7.70e-01 | NA | 1.04e-07 |
| 3. B | Q60467 | Collagen alpha-1(V) chain | 5.75e-01 | NA | 0.005 |
| 3. B | A7E321 | Paraneoplastic antigen-like protein 8A | 1.75e-02 | NA | 4.56e-21 |
| 3. B | P05997 | Collagen alpha-2(V) chain | 7.75e-01 | NA | 1.56e-08 |
| 3. B | P18856 | Collagen EMF1-alpha (Fragment) | 6.61e-02 | NA | 5.58e-08 |
| 3. B | P35246 | Pulmonary surfactant-associated protein D | 1.29e-01 | NA | 2.59e-06 |
| 3. B | P98085 | Inner ear-specific collagen | NA | NA | 1.67e-07 |
| 3. B | P23805 | Conglutinin | 2.61e-01 | NA | 1.03e-06 |
| 3. B | Q32S24 | Collagen alpha-2(XI) chain | 7.36e-01 | NA | 2.26e-08 |
| 3. B | Q96P44 | Collagen alpha-1(XXI) chain | 9.87e-02 | NA | 7.60e-13 |
| 3. B | Q3U962 | Collagen alpha-2(V) chain | 7.00e-01 | NA | 1.54e-08 |
| 3. B | P02467 | Collagen alpha-2(I) chain | 6.83e-01 | NA | 8.00e-09 |
| 3. B | P02459 | Collagen alpha-1(II) chain | 3.93e-01 | NA | 3.40e-07 |
| 3. B | Q801S8 | Collagen alpha-1(VI) chain | 2.38e-01 | NA | 3.07e-12 |
| 3. B | P05539 | Collagen alpha-1(II) chain | 8.62e-01 | NA | 4.21e-06 |
| 3. B | O46392 | Collagen alpha-2(I) chain | 3.95e-01 | NA | 6.66e-08 |
| 3. B | P02463 | Collagen alpha-1(IV) chain | 6.87e-01 | NA | 4.39e-09 |