Summary

A0A0J9YXQ4

Homolog: P0CW24.
Function: Paraneoplastic antigen-like protein 6A.

Statistics

Total GO Annotation: 246
Unique PROST Go: 17
Unique BLAST Go: 221

Total Homologs: 200
Unique PROST Homologs: 7
Unique BLAST Homologs: 178

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was P0CW24 (Paraneoplastic antigen-like protein 6A) with a FATCAT P-Value: 4.99e-06 and RMSD of 10.10 angstrom. The sequence alignment identity is 31.7%.
Structural alignment shown in left. Query protein A0A0J9YXQ4 colored as red in alignment, homolog P0CW24 colored as blue. Query protein A0A0J9YXQ4 is also shown in right top, homolog P0CW24 showed in right bottom. They are colored based on secondary structures. 

  A0A0J9YXQ4 MALAMLRDWCRWMGANAERSLLILGIPDDCKEHEFQEAVRAALSPLGRYRVLTKHFRKELGAKAALVEFAEYLNRSLIPHQIPGNGGPWKVIFLPQVPVI 100
      P0CW24 MAVTMLQDWCRWMGVNARRGLLILGIPEDCDDAEFQESLEAALRPMGHFTVLGKAFREEDNATAALVELDREVNYALVPREIPGTGGPWNVVFVP----- 95

  A0A0J9YXQ4 EFQDMPSFPAQPQGQAVAKAAGEGGGAGEAGGVGEVGAAGEAGGTGEAGATGEAGAAGEAGGAGEAGGVGEAGAAGEAGGAGEAGAAGEGGAAGEAGGAG 200
      P0CW24 ------------------RCSGE-----EFLGLGRVFHFPE-----QEGQMVES--------------V--AGAL------------------------- 126

  A0A0J9YXQ4 EAGGVGEAGAAGEAGGAGEAGGVGEAGAAGEAGGAGEAGAAGEAGGAGEGRAAGEAGAAGEAGAVGEAGAAGEAGAVGEAGAAGEAGAVGEAGGTNVTKA 300
      P0CW24 ---GV----------------GL--------------------------RRVCW-------LRSIGQA-------------------------------- 142

  A0A0J9YXQ4 WVQPW----RCTLQPVLENRAYRELRPFSRREQ--PGCEEESFESWVEHAKDMLQLWCHASEREKKRWLLESLGGPALEVVSGLLEEDTNLSALDCLAAL 394
      P0CW24 -VQPWVEAVRC-----------QSLGVFSGRDQPAPG--EESFEVWLDHTTEMLHVWQGVSERERRRRLLEGLRGTALQLVHALLAENPARTAQDCLAAL 228

  A0A0J9YXQ4 GQVFRNQDTRMTSRLKFLTCTQGPQEG--LFAFVVRLEGLLQRAVEKGAVCPALANYLRLQQVLSWARPSEALQDTLRGMQLEKRPPGFLGLLRLIREME 492
      P0CW24 AQVFGDNESQATIRVKCLTAQQ--QSGERLSAFVLRLEVLLQKAMEKEALARASADRVRLRQMLTRAHLTEPLDEALRKLRMAGRSPSFLEMLGLVRESE 326

  A0A0J9YXQ4 AWAAFPARSQQGVAWAAAPVESEDPAAAQASPAQGNASEAG--PGAEDAAEAASATKEAARGAPAAGEGESAPAGPEGLGQARPIEVPWGSSPARMSSAV 590
      P0CW24 AWEASLARS----------VR------AQTQ--EG----AGARAGAQAVARA--STKV-----------EAVPGGP-G----R--E-------------- 370

  A0A0J9YXQ4 WVFPRGLSWGPEGLIQVRGQEARKPPL--EGLQTILEEPENEDEDGAGDEGQPKSSQGK 647
      P0CW24 ----------PEGLLQAGGQEAEE--LLQEGLKPVLEECDN------------------ 399

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0090200 positive regulation of release of cytochrome c from mitochondria
1. PB GO:0008625 extrinsic apoptotic signaling pathway via death domain receptors
1. PB GO:0097192 extrinsic apoptotic signaling pathway in absence of ligand
1. PB GO:0097190 apoptotic signaling pathway
1. PB GO:0001844 protein insertion into mitochondrial membrane involved in apoptotic signaling pathway
1. PB GO:0008630 intrinsic apoptotic signaling pathway in response to DNA damage
1. PB GO:0043065 positive regulation of apoptotic process
1. PB GO:0002437 inflammatory response to antigenic stimulus
2. P GO:0042025 host cell nucleus
2. P GO:0039588 suppression by virus of host antigen processing and presentation
2. P GO:0019042 viral latency
2. P GO:0003700 DNA-binding transcription factor activity
2. P GO:0006275 regulation of DNA replication
2. P GO:0039660 structural constituent of virion
2. P GO:0005829 cytosol
2. P GO:0039504 suppression by virus of host adaptive immune response
2. P GO:0039644 suppression by virus of host NF-kappaB cascade
2. P GO:0045893 positive regulation of transcription, DNA-templated
2. P GO:0044185 host cell late endosome membrane
2. P GO:0005730 nucleolus
2. P GO:0072494 host multivesicular body
2. P GO:0042981 regulation of apoptotic process
2. P GO:0039702 viral budding via host ESCRT complex
2. P GO:0005654 nucleoplasm
2. P GO:0003676 nucleic acid binding
3. B GO:0030198 extracellular matrix organization
3. B GO:0071711 basement membrane organization
3. B GO:0099184 structural constituent of postsynaptic intermediate filament cytoskeleton
3. B GO:0048706 embryonic skeletal system development
3. B GO:0060021 roof of mouth development
3. B GO:2001240 negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
3. B GO:0048407 platelet-derived growth factor binding
3. B GO:0032183 SUMO binding
3. B GO:0010718 positive regulation of epithelial to mesenchymal transition
3. B GO:1903561 extracellular vesicle
3. B GO:0016043 cellular component organization
3. B GO:0060107 annuli extracellular matrix
3. B GO:0005589 collagen type VI trimer
3. B GO:0001958 endochondral ossification
3. B GO:0097418 neurofibrillary tangle
3. B GO:0051216 cartilage development
3. B GO:0097440 apical dendrite
3. B GO:1904399 heparan sulfate binding
3. B GO:0071873 response to norepinephrine
3. B GO:0005201 extracellular matrix structural constituent
3. B GO:2001223 negative regulation of neuron migration
3. B GO:0007585 respiratory gaseous exchange by respiratory system
3. B GO:0033693 neurofilament bundle assembly
3. B GO:0005586 collagen type III trimer
3. B GO:0045299 otolith mineralization
3. B GO:0048705 skeletal system morphogenesis
3. B GO:0071306 cellular response to vitamin E
3. B GO:1902513 regulation of organelle transport along microtubule
3. B GO:0060174 limb bud formation
3. B GO:0050910 detection of mechanical stimulus involved in sensory perception of sound
3. B GO:0090263 positive regulation of canonical Wnt signaling pathway
3. B GO:0030903 notochord development
3. B GO:1903225 negative regulation of endodermal cell differentiation
3. B GO:0035987 endodermal cell differentiation
3. B GO:0007605 sensory perception of sound
3. B GO:0010812 negative regulation of cell-substrate adhesion
3. B GO:0002164 larval development
3. B GO:0048514 blood vessel morphogenesis
3. B GO:0005576 extracellular region
3. B GO:0048840 otolith development
3. B GO:0001502 cartilage condensation
3. B GO:0030141 secretory granule
3. B GO:0050828 regulation of liquid surface tension
3. B GO:0035848 oviduct morphogenesis
3. B GO:0003431 growth plate cartilage chondrocyte development
3. B GO:0097242 amyloid-beta clearance
3. B GO:0035025 positive regulation of Rho protein signal transduction
3. B GO:0035313 wound healing, spreading of epidermal cells
3. B GO:0005788 endoplasmic reticulum lumen
3. B GO:0005615 extracellular space
3. B GO:0040032 post-embryonic body morphogenesis
3. B GO:0007266 Rho protein signal transduction
3. B GO:0008228 opsonization
3. B GO:0001569 branching involved in blood vessel morphogenesis
3. B GO:0009612 response to mechanical stimulus
3. B GO:0048704 embryonic skeletal system morphogenesis
3. B GO:0005044 scavenger receptor activity
3. B GO:1903935 response to sodium arsenite
3. B GO:0005737 cytoplasm
3. B GO:0048936 peripheral nervous system neuron axonogenesis
3. B GO:0060351 cartilage development involved in endochondral bone morphogenesis
3. B GO:0071560 cellular response to transforming growth factor beta stimulus
3. B GO:0099160 postsynaptic intermediate filament cytoskeleton
3. B GO:0050766 positive regulation of phagocytosis
3. B GO:0007420 brain development
3. B GO:0005597 collagen type XVI trimer
3. B GO:0097435 supramolecular fiber organization
3. B GO:0071260 cellular response to mechanical stimulus
3. B GO:0002020 protease binding
3. B GO:0008217 regulation of blood pressure
3. B GO:0031581 hemidesmosome assembly
3. B GO:0043394 proteoglycan binding
3. B GO:0050777 negative regulation of immune response
3. B GO:0045104 intermediate filament cytoskeleton organization
3. B GO:0005585 collagen type II trimer
3. B GO:0007417 central nervous system development
3. B GO:0001501 skeletal system development
3. B GO:0043129 surfactant homeostasis
3. B GO:0005883 neurofilament
3. B GO:0005581 collagen trimer
3. B GO:0042302 structural constituent of cuticle
3. B GO:0005584 collagen type I trimer
3. B GO:0034505 tooth mineralization
3. B GO:0071300 cellular response to retinoic acid
3. B GO:0042130 negative regulation of T cell proliferation
3. B GO:0042383 sarcolemma
3. B GO:0061304 retinal blood vessel morphogenesis
3. B GO:0005886 plasma membrane
3. B GO:0071773 cellular response to BMP stimulus
3. B GO:0006911 phagocytosis, engulfment
3. B GO:0009314 response to radiation
3. B GO:0003007 heart morphogenesis
3. B GO:0001649 osteoblast differentiation
3. B GO:0048565 digestive tract development
3. B GO:0045087 innate immune response
3. B GO:0002062 chondrocyte differentiation
3. B GO:0034381 plasma lipoprotein particle clearance
3. B GO:0042289 MHC class II protein binding
3. B GO:0005537 mannose binding
3. B GO:0001894 tissue homeostasis
3. B GO:0001540 amyloid-beta binding
3. B GO:0070208 protein heterotrimerization
3. B GO:0071447 cellular response to hydroperoxide
3. B GO:0030282 bone mineralization
3. B GO:0070287 ferritin receptor activity
3. B GO:0038024 cargo receptor activity
3. B GO:0060325 face morphogenesis
3. B GO:0050765 negative regulation of phagocytosis
3. B GO:0043152 induction of bacterial agglutination
3. B GO:0048839 inner ear development
3. B GO:0003417 growth plate cartilage development
3. B GO:0005592 collagen type XI trimer
3. B GO:0032964 collagen biosynthetic process
3. B GO:0042338 cuticle development involved in collagen and cuticulin-based cuticle molting cycle
3. B GO:0048592 eye morphogenesis
3. B GO:0060346 bone trabecula formation
3. B GO:0007160 cell-matrix adhesion
3. B GO:0007229 integrin-mediated signaling pathway
3. B GO:1900078 positive regulation of cellular response to insulin stimulus
3. B GO:0007601 visual perception
3. B GO:0001886 endothelial cell morphogenesis
3. B GO:0045112 integrin biosynthetic process
3. B GO:1905226 regulation of adhesion of symbiont to host epithelial cell
3. B GO:0051591 response to cAMP
3. B GO:0007179 transforming growth factor beta receptor signaling pathway
3. B GO:0052405
3. B GO:0060272 embryonic skeletal joint morphogenesis
3. B GO:0045162 clustering of voltage-gated sodium channels
3. B GO:0006029 proteoglycan metabolic process
3. B GO:0032963 collagen metabolic process
3. B GO:0048570 notochord morphogenesis
3. B GO:0030056 hemidesmosome
3. B GO:0042329 structural constituent of collagen and cuticulin-based cuticle
3. B GO:0048286 lung alveolus development
3. B GO:0001957 intramembranous ossification
3. B GO:0045110 intermediate filament bundle assembly
3. B GO:0006898 receptor-mediated endocytosis
3. B GO:0035108 limb morphogenesis
3. B GO:0005178 integrin binding
3. B GO:0010171 body morphogenesis
3. B GO:0150017 basal proximal dendrite
3. B GO:0005590 collagen type VII trimer
3. B GO:0031012 extracellular matrix
3. B GO:0005518 collagen binding
3. B GO:0008201 heparin binding
3. B GO:0031103 axon regeneration
3. B GO:0001552 ovarian follicle atresia
3. B GO:0033622 integrin activation
3. B GO:0032355 response to estradiol
3. B GO:0002063 chondrocyte development
3. B GO:0120153 calcium-dependent carbohydrate binding
3. B GO:0086080 protein binding involved in heterotypic cell-cell adhesion
3. B GO:0060385 axonogenesis involved in innervation
3. B GO:0008544 epidermis development
3. B GO:0005588 collagen type V trimer
3. B GO:0001530 lipopolysaccharide binding
3. B GO:0030335 positive regulation of cell migration
3. B GO:0071364 cellular response to epidermal growth factor stimulus
3. B GO:1903354 regulation of distal tip cell migration
3. B GO:0007155 cell adhesion
3. B GO:0044344 cellular response to fibroblast growth factor stimulus
3. B GO:0034504 protein localization to nucleus
3. B GO:0097065 anterior head development
3. B GO:0001568 blood vessel development
3. B GO:0003677 DNA binding
3. B GO:0060023 soft palate development
3. B GO:0008585 female gonad development
3. B GO:0018149 peptide cross-linking
3. B GO:0061564 axon development
3. B GO:0061333 renal tubule morphogenesis
3. B GO:1903937 response to acrylamide
3. B GO:0015643 toxic substance binding
3. B GO:0032703 negative regulation of interleukin-2 production
3. B GO:0005771 multivesicular body
3. B GO:0043434 response to peptide hormone
3. B GO:0001525 angiogenesis
3. B GO:0043277 apoptotic cell clearance
3. B GO:0040002 collagen and cuticulin-based cuticle development
3. B GO:0005604 basement membrane
3. B GO:0071356 cellular response to tumor necrosis factor
3. B GO:0051894 positive regulation of focal adhesion assembly
3. B GO:0038063 collagen-activated tyrosine kinase receptor signaling pathway
3. B GO:0071599 otic vesicle development
3. B GO:1902617 response to fluoride
3. B GO:0055010 ventricular cardiac muscle tissue morphogenesis
3. B GO:0005791 rough endoplasmic reticulum
3. B GO:0005583 fibrillar collagen trimer
3. B GO:0016021 integral component of membrane
3. B GO:0046332 SMAD binding
3. B GO:0021987 cerebral cortex development
3. B GO:0085029 extracellular matrix assembly
3. B GO:0035989 tendon development
3. B GO:0071230 cellular response to amino acid stimulus
3. B GO:0001503 ossification
3. B GO:0030199 collagen fibril organization
3. B GO:0005587 collagen type IV trimer
3. B GO:0044691 tooth eruption
3. B GO:0042472 inner ear morphogenesis
3. B GO:0040014 regulation of multicellular organism growth
3. B GO:0042542 response to hydrogen peroxide
3. B GO:0048621 post-embryonic digestive tract morphogenesis
3. B GO:0032528 microvillus organization
3. B GO:0034097 response to cytokine
3. B GO:0007528 neuromuscular junction development
3. B GO:0033627 cell adhesion mediated by integrin
3. B GO:0062023 collagen-containing extracellular matrix
3. B GO:0055093 response to hyperoxia
3. B GO:0060414 aorta smooth muscle tissue morphogenesis
3. B GO:0031960 response to corticosteroid
3. B GO:0043589 skin morphogenesis
3. B GO:0042060 wound healing
3. B GO:0060102 collagen and cuticulin-based cuticle extracellular matrix
3. B GO:0030020 extracellular matrix structural constituent conferring tensile strength
3. B GO:0005594 collagen type IX trimer
3. B GO:0060052 neurofilament cytoskeleton organization
3. B GO:0042802 identical protein binding
3. B GO:0043588 skin development
3. B GO:1902618 cellular response to fluoride
3. B GO:0008584 male gonad development
3. B GO:0051128 regulation of cellular component organization
3. B GO:0030674 protein-macromolecule adaptor activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8ND90 Paraneoplastic antigen Ma1 1.27e-03 6.30e-06 6.40e-28
1. PB Q9ERH6 Modulator of apoptosis 1 3.74e-04 3.66e-02 6.58e-26
1. PB A6QLK5 Paraneoplastic antigen Ma1 homolog 3.18e-04 4.89e-05 4.76e-28
1. PB Q8BHK0 Paraneoplastic antigen Ma2 homolog 4.60e-04 4.80e-04 3.85e-24
1. PB Q5R486 Paraneoplastic antigen Ma2 homolog 4.23e-04 2.59e-07 6.57e-30
1. PB Q96PV4 Paraneoplastic antigen-like protein 5 1.66e-03 8.40e-07 1.75e-27
1. PB Q8VHZ4 Paraneoplastic antigen Ma1 homolog 8.94e-04 7.14e-07 2.51e-27
1. PB Q9UL42 Paraneoplastic antigen Ma2 3.81e-04 5.98e-07 2.02e-31
1. PB Q2KIT6 Paraneoplastic antigen Ma2 homolog 3.12e-04 7.92e-06 2.02e-35
1. PB Q9GMU3 Paraneoplastic antigen Ma2 homolog 2.63e-05 5.80e-08 4.85e-31
1. PB A0A0J9YXQ4 Paraneoplastic antigen Ma6E 0 8.83e-151 0.0
1. PB A0A0J9YX94 Paraneoplastic antigen Ma6F 7.04e-05 1.17e-24 1.13e-155
1. PB P0CW24 Paraneoplastic antigen-like protein 6A 4.99e-06 7.12e-03 1.48e-33
1. PB Q8C1C8 Paraneoplastic antigen Ma1 homolog 1.02e-03 1.82e-06 5.78e-27
1. PB Q8JZW8 Paraneoplastic antigen Ma3 homolog 4.86e-03 8.15e-04 8.90e-36
2. P Q196Z8 Uncharacterized protein 062L NA 3.82e-03 NA
2. P Q7M4S9 Uncharacterized protein YBL113C 6.35e-01 2.03e-03 NA
2. P Q8N8U3 Retrotransposon Gag-like protein 3 3.02e-02 1.71e-02 NA
2. P P03211 Epstein-Barr nuclear antigen 1 NA 4.25e-05 NA
2. P P21416 Gag polyprotein NA 6.84e-03 NA
2. P Q1HVF7 Epstein-Barr nuclear antigen 1 NA 3.27e-04 NA
2. P Q3KSS4 Epstein-Barr nuclear antigen 1 NA 3.15e-05 NA
3. B P16884 Neurofilament heavy polypeptide 6.90e-01 NA 1.13e-05
3. B Q07092 Collagen alpha-1(XVI) chain 3.74e-01 NA 0.025
3. B Q05722 Collagen alpha-1(IX) chain 1.64e-01 NA 4.47e-12
3. B Q0II24 Complement C1q and tumor necrosis factor-related protein 9 1.28e-01 NA 4.50e-07
3. B C0HJP4 Collagen alpha-2(I) chain (Fragments) 3.63e-01 NA 0.035
3. B O42350 Collagen alpha-2(I) chain 8.30e-01 NA 1.67e-09
3. B Q5UPS7 Collagen-like protein 4 NA NA 6.48e-09
3. B C0HLJ0 Collagen alpha-2(I) chain (Fragments) 3.17e-01 NA 0.007
3. B Q5UPE4 Collagen-like protein 1 NA NA 1.91e-14
3. B Q5UQ50 Collagen-like protein 6 NA NA 2.70e-10
3. B Q14055 Collagen alpha-2(IX) chain 1.99e-01 NA 1.63e-04
3. B Q07643 Collagen alpha-2(IX) chain 2.62e-01 NA 1.32e-06
3. B P12106 Collagen alpha-1(IX) chain 3.79e-01 NA 3.21e-05
3. B A0A1B0GUJ8 Paraneoplastic antigen-like protein 8C 2.37e-03 NA 8.85e-22
3. B Q28668 Collagen alpha-2(I) chain (Fragment) 6.59e-02 NA 1.19e-13
3. B C0HLH0 Collagen alpha-2(I) chain (Fragments) 4.28e-01 NA 0.022
3. B P30204 Macrophage scavenger receptor types I and II 6.40e-01 NA 0.028
3. B Q95WA4 Spore wall protein 2 2.71e-01 NA 0.017
3. B P13941 Collagen alpha-1(III) chain 4.00e-01 NA 4.49e-07
3. B Q5R6R8 Paraneoplastic antigen-like protein 8A 1.99e-02 NA 2.46e-22
3. B Q9WUB9 Macrophage receptor MARCO 2.95e-01 NA 6.51e-09
3. B P83371 Otolin-1 1.07e-01 NA 3.69e-10
3. B Q02388 Collagen alpha-1(VII) chain NA NA 1.04e-09
3. B Q03637 Acetylcholinesterase collagenic tail peptide 2.02e-01 NA 2.72e-07
3. B C0HJP8 Collagen alpha-2(I) chain (Fragments) 1.92e-01 NA 0.003
3. B Q80ZF0 Collagen alpha-1(XXVII) chain 8.06e-01 NA 3.30e-12
3. B P20785 Collagen alpha-1(VI) chain 3.20e-01 NA 1.17e-05
3. B Q99MQ5 Collagen alpha-1(XXV) chain 3.41e-01 NA 8.05e-09
3. B A8TX70 Collagen alpha-5(VI) chain 9.12e-01 NA 3.10e-17
3. B P23206 Collagen alpha-1(X) chain 2.15e-01 NA 6.81e-10
3. B Q5UPX3 Collagen-like protein 3 NA NA 1.55e-09
3. B Q05306 Collagen alpha-1(X) chain 2.21e-01 NA 4.11e-06
3. B Q9JI03 Collagen alpha-1(V) chain 8.70e-01 NA 0.013
3. B Q8NFW1 Collagen alpha-1(XXII) chain 9.37e-01 NA 0.033
3. B A6H584 Collagen alpha-5(VI) chain 8.08e-01 NA 1.22e-18
3. B Q5QNQ9 Collagen alpha-1(XXVII) chain 8.59e-01 NA 8.16e-12
3. B Q14050 Collagen alpha-3(IX) chain 1.53e-01 NA 6.90e-05
3. B P15988 Collagen alpha-2(VI) chain 2.21e-01 NA 3.26e-09
3. B P32017 Collagen alpha-3(IX) chain 6.47e-02 NA 2.92e-07
3. B Q6P4Z2 Collagen alpha-1(II) chain 6.71e-01 NA 2.13e-09
3. B Q30D77 Collagen alpha-1(XXIV) chain 8.70e-01 NA 2.06e-15
3. B P91285 Cuticle collagen dpy-5 9.94e-02 NA 6.47e-05
3. B A8XV37 Putative cuticle collagen 145 3.95e-01 NA 0.031
3. B Q07563 Collagen alpha-1(XVII) chain 8.18e-01 NA 6.45e-04
3. B C0HLJ8 Collagen alpha-2(I) chain (Fragments) 3.69e-01 NA 6.22e-04
3. B P11087 Collagen alpha-1(I) chain 7.24e-01 NA 3.18e-04
3. B Q80VM8 Paraneoplastic antigen-like protein 8A 1.62e-02 NA 7.39e-21
3. B A2AX52 Collagen alpha-4(VI) chain 4.93e-01 NA 5.08e-14
3. B P34340 Putative cuticle collagen 90 1.01e-01 NA 4.12e-07
3. B P08123 Collagen alpha-2(I) chain 8.08e-01 NA 4.42e-08
3. B P08120 Collagen alpha-1(IV) chain 9.24e-01 NA 0.002
3. B C0HLK0 Collagen alpha-2(I) chain (Fragments) 5.45e-01 NA 0.047
3. B P08572 Collagen alpha-2(IV) chain 7.97e-01 NA 7.86e-06
3. B C0HLG8 Collagen alpha-2(I) chain (Fragments) 3.42e-01 NA 0.004
3. B Q9YIB4 Collagen alpha-1(I) chain 6.25e-01 NA 1.93e-06
3. B P85154 Collagen alpha-2(I) chain 7.37e-01 NA 0.013
3. B Q02788 Collagen alpha-2(VI) chain 2.60e-01 NA 2.08e-07
3. B P02460 Collagen alpha-1(II) chain (Fragment) 3.05e-01 NA 4.15e-06
3. B Q86V59 Paraneoplastic antigen-like protein 8A 8.60e-03 NA 7.56e-23
3. B Q91717 Collagen alpha-1(II) chain 8.03e-01 NA 8.24e-08
3. B P35248 Pulmonary surfactant-associated protein D 6.59e-02 NA 1.39e-07
3. B P15989 Collagen alpha-3(VI) chain NA NA 1.02e-11
3. B Q4ZJM7 Otolin-1 1.04e-01 NA 9.43e-12
3. B P30754 Fibril-forming collagen alpha chain (Fragment) 3.55e-01 NA 2.77e-06
3. B P12107 Collagen alpha-1(XI) chain 6.53e-01 NA 8.19e-06
3. B P02458 Collagen alpha-1(II) chain 8.30e-01 NA 4.62e-07
3. B Q9UMD9 Collagen alpha-1(XVII) chain 7.64e-01 NA 0.046
3. B Q8IZC6 Collagen alpha-1(XXVII) chain 5.49e-01 NA 5.97e-08
3. B Q0VF58 Collagen alpha-1(XIX) chain 5.46e-01 NA 6.14e-05
3. B C7DZK3 Collagen alpha-1(XXVII) chain A 5.14e-01 NA 1.54e-12
3. B Q9UEW3 Macrophage receptor MARCO 2.25e-01 NA 2.33e-12
3. B Q6PEW1 Zinc finger CCHC domain-containing protein 12 1.83e-03 NA 1.67e-21
3. B P08116 Processed variable antigen (Fragment) 2.64e-01 NA 1.03e-09
3. B P12109 Collagen alpha-1(VI) chain 8.76e-02 NA 5.46e-07
3. B B7Z0K8 Collagen alpha chain CG42342 5.05e-01 NA 2.44e-06
3. B P20909 Collagen alpha-1(XI) chain 8.39e-01 NA 6.29e-06
3. B Q2UY11 Collagen alpha-1(XXVIII) chain 1.82e-01 NA 2.13e-05
3. B Q9QZR9 Collagen alpha-4(IV) chain 8.43e-01 NA 0.015
3. B P18503 Short-chain collagen C4 (Fragment) 4.60e-01 NA 0.001
3. B Q17460 Cuticle collagen 10 1.16e-01 NA 6.76e-04
3. B Q8BMF8 Gliomedin 3.83e-01 NA 0.040
3. B Q8MHZ9 Collectin-46 1.02e-01 NA 8.49e-08
3. B Q5HZA3 Zinc finger CCHC domain-containing protein 12 1.82e-03 NA 3.52e-19
3. B Q8VD24 Zinc finger CCHC domain-containing protein 18 3.69e-04 NA 2.92e-21
3. B A0A060WQA3 Otolin-1 9.24e-02 NA 1.92e-06
3. B O93484 Collagen alpha-2(I) chain 6.26e-01 NA 6.13e-06
3. B Q9N1X4 Pulmonary surfactant-associated protein D 6.65e-02 NA 0.050
3. B Q17RW2 Collagen alpha-1(XXIV) chain 8.16e-01 NA 1.71e-14
3. B Q9JMH4 Collagen alpha-1(XVII) chain 2.29e-01 NA 2.02e-05
3. B P27393 Collagen alpha-2(IV) chain 8.62e-01 NA 9.97e-05
3. B Q9CZA5 Zinc finger CCHC domain-containing protein 12 4.82e-04 NA 2.60e-18
3. B Q641F3 Collagen alpha-1(XXI) chain 2.79e-01 NA 1.39e-12
3. B P0C862 Complement C1q and tumor necrosis factor-related protein 9A 3.68e-01 NA 1.96e-11
3. B Q8BLX7 Collagen alpha-1(XVI) chain 6.05e-01 NA 0.002
3. B Q95KI4 Modulator of apoptosis 1 3.01e-04 NA 2.78e-22
3. B Q64739 Collagen alpha-2(XI) chain 6.73e-01 NA 5.29e-09
3. B Q9BXS0 Collagen alpha-1(XXV) chain 2.87e-01 NA 2.59e-07
3. B Q63870 Collagen alpha-1(VII) chain NA NA 5.98e-14
3. B P12111 Collagen alpha-3(VI) chain NA NA 3.56e-07
3. B Q7SIB2 Collagen alpha-1(IV) chain 8.61e-01 NA 6.38e-06
3. B Q60754 Macrophage receptor MARCO 2.66e-01 NA 3.14e-11
3. B A5PN28 Otolin-1-A 1.58e-01 NA 8.71e-10
3. B C0HLJ6 Collagen alpha-2(I) chain (Fragments) 3.95e-01 NA 6.00e-04
3. B Q5U3G1 Collectin-11 6.56e-01 NA 0.021
3. B O35206 Collagen alpha-1(XV) chain 5.38e-01 NA 1.65e-05
3. B P02466 Collagen alpha-2(I) chain 7.26e-01 NA 1.80e-08
3. B P02453 Collagen alpha-1(I) chain 8.78e-01 NA 2.64e-04
3. B Q5RFW0 Scavenger receptor class A member 5 3.19e-01 NA 0.001
3. B C0HLI4 Collagen alpha-2(I) chain (Fragments) 5.75e-01 NA 0.007
3. B Q9ULN7 Paraneoplastic antigen-like protein 8B 2.32e-03 NA 2.70e-16
3. B P12110 Collagen alpha-2(VI) chain 4.97e-01 NA 6.84e-10
3. B P13942 Collagen alpha-2(XI) chain 8.28e-01 NA 5.29e-07
3. B P12108 Collagen alpha-2(IX) chain 1.07e-01 NA 0.020
3. B P35799 Cuticle collagen dpy-2 9.91e-02 NA 0.005
3. B Q01149 Collagen alpha-2(I) chain 5.50e-01 NA 2.70e-08
3. B P02465 Collagen alpha-2(I) chain 5.02e-01 NA 4.44e-09
3. B Q8C6K9 Collagen alpha-6(VI) chain 8.43e-01 NA 1.10e-07
3. B Q14993 Collagen alpha-1(XIX) chain 4.05e-01 NA 0.006
3. B B2RNN3 Complement C1q and tumor necrosis factor-related protein 9B 3.95e-01 NA 6.89e-12
3. B Q4ZJN1 Complement C1q and tumor necrosis factor-related protein 9 3.35e-01 NA 1.05e-08
3. B C0HLN2 Collagen alpha-2(IX) chain 3.31e-01 NA 2.42e-04
3. B P20849 Collagen alpha-1(IX) chain 4.13e-01 NA 1.30e-08
3. B Q80WL1 Gliomedin 6.85e-01 NA 0.023
3. B P39061 Collagen alpha-1(XVIII) chain 8.22e-01 NA 9.48e-05
3. B P02457 Collagen alpha-1(I) chain NA NA 2.28e-10
3. B C0HJN6 Collagen alpha-2(I) chain (Fragments) 2.66e-01 NA 0.002
3. B P17140 Collagen alpha-2(IV) chain 9.48e-01 NA 0.035
3. B Q04857 Collagen alpha-1(VI) chain 3.30e-01 NA 7.96e-11
3. B Q23628 Cuticle collagen lon-3 7.48e-01 NA 0.006
3. B C0HLI8 Collagen alpha-2(I) chain (Fragments) 7.33e-01 NA 0.004
3. B Q5UPS6 Collagen-like protein 5 NA NA 3.89e-10
3. B Q96BY2 Modulator of apoptosis 1 3.48e-04 NA 5.01e-25
3. B Q9UL41 Paraneoplastic antigen Ma3 1.35e-03 NA 2.84e-37
3. B P0CG32 Zinc finger CCHC domain-containing protein 18 6.79e-03 NA 2.99e-22
3. B A6NMZ7 Collagen alpha-6(VI) chain 7.85e-01 NA 1.14e-11
3. B P19246 Neurofilament heavy polypeptide 1.97e-01 NA 8.23e-14
3. B P08121 Collagen alpha-1(III) chain 7.36e-01 NA 1.00e-06
3. B P25940 Collagen alpha-3(V) chain 5.96e-01 NA 2.31e-07
3. B P17139 Collagen alpha-1(IV) chain 6.64e-01 NA 1.51e-04
3. B Q5UNS9 Collagen-like protein 7 NA NA 1.30e-13
3. B A0MSJ1 Collagen alpha-1(XXVII) chain B 7.80e-01 NA 1.08e-14
3. B P08122 Collagen alpha-2(IV) chain 6.52e-01 NA 0.001
3. B C0HJP6 Collagen alpha-2(I) chain (Fragments) 3.33e-01 NA 0.002
3. B B4YNE6 Collagen-like protein V6 NA NA 4.10e-05
3. B B8V7R6 Collagen alpha chain (Fragment) 2.01e-01 NA 1.29e-08
3. B P35247 Pulmonary surfactant-associated protein D 2.43e-02 NA 2.16e-05
3. B Q61245 Collagen alpha-1(XI) chain 9.65e-01 NA 6.73e-06
3. B Q08DL1 Zinc finger CCHC domain-containing protein 12 9.63e-04 NA 3.92e-21
3. B Q14031 Collagen alpha-6(IV) chain 9.49e-01 NA 6.13e-04
3. B O88207 Collagen alpha-1(V) chain 9.40e-01 NA 0.013
3. B A6NHN0 Otolin-1 5.01e-01 NA 6.07e-11
3. B Q9XSJ7 Collagen alpha-1(I) chain 8.76e-01 NA 4.48e-05
3. B Q1PBC5 Pulmonary surfactant-associated protein D 2.24e-01 NA 9.18e-05
3. B Q5UQ13 Collagen-like protein 2 NA NA 1.22e-11
3. B P02461 Collagen alpha-1(III) chain 6.55e-01 NA 1.60e-09
3. B P02454 Collagen alpha-1(I) chain 6.33e-01 NA 8.35e-06
3. B P28481 Collagen alpha-1(II) chain 7.44e-01 NA 2.63e-06
3. B Q09578 Putative cuticle collagen 75 1.47e-01 NA 8.59e-05
3. B P02452 Collagen alpha-1(I) chain 8.73e-01 NA 2.13e-04
3. B P50404 Pulmonary surfactant-associated protein D 2.07e-01 NA 0.001
3. B Q5DTT8 Paraneoplastic antigen-like protein 5 4.21e-04 NA 3.29e-30
3. B P02462 Collagen alpha-1(IV) chain 7.70e-01 NA 1.04e-07
3. B Q60467 Collagen alpha-1(V) chain 5.75e-01 NA 0.005
3. B A7E321 Paraneoplastic antigen-like protein 8A 1.75e-02 NA 4.56e-21
3. B P05997 Collagen alpha-2(V) chain 7.75e-01 NA 1.56e-08
3. B P18856 Collagen EMF1-alpha (Fragment) 6.61e-02 NA 5.58e-08
3. B P35246 Pulmonary surfactant-associated protein D 1.29e-01 NA 2.59e-06
3. B P98085 Inner ear-specific collagen NA NA 1.67e-07
3. B P23805 Conglutinin 2.61e-01 NA 1.03e-06
3. B Q32S24 Collagen alpha-2(XI) chain 7.36e-01 NA 2.26e-08
3. B Q96P44 Collagen alpha-1(XXI) chain 9.87e-02 NA 7.60e-13
3. B Q3U962 Collagen alpha-2(V) chain 7.00e-01 NA 1.54e-08
3. B P02467 Collagen alpha-2(I) chain 6.83e-01 NA 8.00e-09
3. B P02459 Collagen alpha-1(II) chain 3.93e-01 NA 3.40e-07
3. B Q801S8 Collagen alpha-1(VI) chain 2.38e-01 NA 3.07e-12
3. B P05539 Collagen alpha-1(II) chain 8.62e-01 NA 4.21e-06
3. B O46392 Collagen alpha-2(I) chain 3.95e-01 NA 6.66e-08
3. B P02463 Collagen alpha-1(IV) chain 6.87e-01 NA 4.39e-09