Summary

A0A0U1RRL7

Homolog: Q6DC60.
Function: Protein FAM219A.

Statistics

Total GO Annotation: 4
Unique PROST Go: 4
Unique BLAST Go: 0

Total Homologs: 4
Unique PROST Homologs: 3
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q6DC60 (Protein FAM219A) with a FATCAT P-Value: 0.0423 and RMSD of 2.67 angstrom. The sequence alignment identity is 8.6%.
Structural alignment shown in left. Query protein A0A0U1RRL7 colored as red in alignment, homolog Q6DC60 colored as blue. Query protein A0A0U1RRL7 is also shown in right top, homolog Q6DC60 showed in right bottom. They are colored based on secondary structures. 

  A0A0U1RRL7 --------------------------------------------------------------MGAQLSGGRGAPEPAQTQPQPQPQPAAPEGPEQPR-HP 37
      Q6DC60 MMEEIDRFQVPPVNPEMKLLQDPAETSTIENETAPREPESVAINYKPSPLQVKIEKQRELARKGSVKNGTVGS--PVNQQPKKN-NVMA-----RTRLVV 92

  A0A0U1RRL7 PQPQPQPQPQPQPEPSPWGPLD-------DV-RFLIACTSWY-------------------------------------------------------- 71
      Q6DC60 PN-KGYSSLDQSPDEKPLVALDTDSDDDFDMSRY---SSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCCQATSSTACQIQ 186

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0042025 host cell nucleus
2. P GO:0030246 carbohydrate binding
2. P GO:0006952 defense response
2. P GO:0008061 chitin binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A0A0U1RRL7 Protein MMP24OS 0 4.99e-155 1.24e-41
2. P P05663 Packaging protein 3 (Fragment) NA 3.02e-02 NA
2. P Q9S8M0 Chitin-binding lectin 1 2.25e-01 4.17e-02 NA
2. P Q6DC60 Protein FAM219A 4.23e-02 3.08e-02 NA