Summary
A0A0U1RRL7
Homolog: Q6DC60.
Function: Protein FAM219A.
Statistics
Total GO Annotation: 4
Unique PROST Go: 4
Unique BLAST Go: 0
Total Homologs: 4
Unique PROST Homologs: 3
Unique BLAST Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 2. P was
Q6DC60
(Protein FAM219A) with a FATCAT P-Value: 0.0423 and RMSD of 2.67 angstrom. The sequence alignment identity is 8.6%.
Structural alignment shown in left. Query protein A0A0U1RRL7 colored as red in alignment, homolog Q6DC60 colored as blue.
Query protein A0A0U1RRL7 is also shown in right top, homolog Q6DC60 showed in right bottom. They are colored based on secondary structures.
A0A0U1RRL7 --------------------------------------------------------------MGAQLSGGRGAPEPAQTQPQPQPQPAAPEGPEQPR-HP 37
Q6DC60 MMEEIDRFQVPPVNPEMKLLQDPAETSTIENETAPREPESVAINYKPSPLQVKIEKQRELARKGSVKNGTVGS--PVNQQPKKN-NVMA-----RTRLVV 92
A0A0U1RRL7 PQPQPQPQPQPQPEPSPWGPLD-------DV-RFLIACTSWY-------------------------------------------------------- 71
Q6DC60 PN-KGYSSLDQSPDEKPLVALDTDSDDDFDMSRY---SSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCCQATSSTACQIQ 186
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0042025 | host cell nucleus |
| 2. P | GO:0030246 | carbohydrate binding |
| 2. P | GO:0006952 | defense response |
| 2. P | GO:0008061 | chitin binding |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | A0A0U1RRL7 | Protein MMP24OS | 0 | 4.99e-155 | 1.24e-41 |
| 2. P | P05663 | Packaging protein 3 (Fragment) | NA | 3.02e-02 | NA |
| 2. P | Q9S8M0 | Chitin-binding lectin 1 | 2.25e-01 | 4.17e-02 | NA |
| 2. P | Q6DC60 | Protein FAM219A | 4.23e-02 | 3.08e-02 | NA |