Summary

A0A1B0GTI1

Homolog: Q5ACU4.
Function: Mediator of RNA polymerase II transcription subunit 21.

Statistics

Total GO Annotation: 46
Unique PROST Go: 46
Unique BLAST Go: 0

Total Homologs: 42
Unique PROST Homologs: 41
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q5ACU4 (Mediator of RNA polymerase II transcription subunit 21) with a FATCAT P-Value: 0.000458 and RMSD of 1.57 angstrom. The sequence alignment identity is 15.7%.
Structural alignment shown in left. Query protein A0A1B0GTI1 colored as red in alignment, homolog Q5ACU4 colored as blue. Query protein A0A1B0GTI1 is also shown in right top, homolog Q5ACU4 showed in right bottom. They are colored based on secondary structures. 

  A0A1B0GTI1 MEPGVQDLGLSSSEDESPSLAIRSPTLRKPLKHSTPEEAALGWSPRPSGGASYLSGSPMPAHFSQ-----D-LASHPAGVSPPATVRKRRLSTLWASKES 94
      Q5ACU4 ----------------------------------------------------------MADRLTQLQICLDQLIQQ---FN--STI--NYVNT---SAEP 32

  A0A1B0GTI1 SL----DLSAPGEEPPTSASLTQRQRQRQQQQQQQE---SLRAKSWAQNP---GL-P--------GILN--TTGRKRRD--PKKRAAAM--ERVRQWEIY 169
      Q5ACU4 SLLDDDDVNSYSNM-AANAPLPQSQQQRQQQKKQQEPQQEIEQPQQQSNPESKSISPPKEKVSFDNVINELCT-----DLILKSRQIKMLIDSLPG--IG 124

  A0A1B0GTI1 VLQN-----IEEATQHEL-TIEDD------------------------------- 187
      Q5ACU4 VTPNEQMNLINELS-DKLQAIEEERIQKIKEKDNLLNLLESMIKEVVNGITETRI 178

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0016591 RNA polymerase II, holoenzyme
2. P GO:0016239 positive regulation of macroautophagy
2. P GO:0000082 G1/S transition of mitotic cell cycle
2. P GO:0003682 chromatin binding
2. P GO:0005665 RNA polymerase II, core complex
2. P GO:0007379 segment specification
2. P GO:0007080 mitotic metaphase plate congression
2. P GO:0071922 regulation of cohesin loading
2. P GO:0006357 regulation of transcription by RNA polymerase II
2. P GO:0009736 cytokinin-activated signaling pathway
2. P GO:0030430 host cell cytoplasm
2. P GO:0009691 cytokinin biosynthetic process
2. P GO:0016242 negative regulation of macroautophagy
2. P GO:0000166 nucleotide binding
2. P GO:0071930 negative regulation of transcription involved in G1/S transition of mitotic cell cycle
2. P GO:0007124 pseudohyphal growth
2. P GO:0019079 viral genome replication
2. P GO:0008408 3'-5' exonuclease activity
2. P GO:0000278 mitotic cell cycle
2. P GO:0007076 mitotic chromosome condensation
2. P GO:0061635 regulation of protein complex stability
2. P GO:0043486 histone exchange
2. P GO:0045292 mRNA cis splicing, via spliceosome
2. P GO:0000079 regulation of cyclin-dependent protein serine/threonine kinase activity
2. P GO:0006302 double-strand break repair
2. P GO:0001756 somitogenesis
2. P GO:0000812 Swr1 complex
2. P GO:0000287 magnesium ion binding
2. P GO:0090503 RNA phosphodiester bond hydrolysis, exonucleolytic
2. P GO:0003712 transcription coregulator activity
2. P GO:0004861 cyclin-dependent protein serine/threonine kinase inhibitor activity
2. P GO:0048315 conidium formation
2. P GO:0005634 nucleus
2. P GO:0007064 mitotic sister chromatid cohesion
2. P GO:0031536 positive regulation of exit from mitosis
2. P GO:0008409 5'-3' exonuclease activity
2. P GO:0045876 positive regulation of sister chromatid cohesion
2. P GO:0051685 maintenance of ER location
2. P GO:0003723 RNA binding
2. P GO:0016592 mediator complex
2. P GO:0006139 nucleobase-containing compound metabolic process
2. P GO:0016075 rRNA catabolic process
2. P GO:0033309 SBF transcription complex
2. P GO:0009690 cytokinin metabolic process
2. P GO:0001707 mesoderm formation
2. P GO:0000785 chromatin

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A0A1B0GTI1 Coiled-coil domain-containing protein 201 0 4.74e-139 5.93e-133
2. P Q08BG7 Short coiled-coil protein A 3.04e-03 3.03e-02 NA
2. P P36167 Protein SRL3 2.24e-02 6.65e-05 NA
2. P Q1DXC2 Mediator of RNA polymerase II transcription subunit 21 5.83e-02 1.04e-03 NA
2. P P38284 Increased copper sensitivity protein 2 2.48e-01 2.11e-05 NA
2. P Q9D9J2 Testis-expressed protein 33 6.81e-03 1.49e-02 NA
2. P A1DHP1 Mediator of RNA polymerase II transcription subunit 21 7.06e-03 3.66e-02 NA
2. P Q2UF93 Mediator of RNA polymerase II transcription subunit 21 5.25e-03 4.41e-02 NA
2. P B3SRR7 Non-structural protein 5 NA 2.06e-02 NA
2. P P40572 Uncharacterized protein YIR016W 7.36e-02 3.28e-02 NA
2. P P11202 Non-structural protein 5 NA 5.57e-03 NA
2. P A1C712 Mediator of RNA polymerase II transcription subunit 21 3.96e-03 9.95e-03 NA
2. P B6LI37 Cilia- and flagella-associated protein HOATZ 2.81e-02 1.30e-02 NA
2. P P10169 Conidiation-specific protein 8 3.50e-02 2.47e-03 NA
2. P Q96FF9 Sororin 8.73e-02 4.65e-02 NA
2. P P53274 Uncharacterized protein YGR126W 5.79e-02 1.92e-03 NA
2. P A2QC41 Mediator of RNA polymerase II transcription subunit 21 1.80e-02 4.29e-02 NA
2. P P38634 Protein SIC1 2.08e-01 4.35e-03 NA
2. P P36358 Non-structural protein 5 NA 1.98e-02 NA
2. P P04516 Non-structural protein 5 NA 1.73e-02 NA
2. P Q563C3 Sororin 1.83e-02 1.64e-02 NA
2. P Q5ACU4 Mediator of RNA polymerase II transcription subunit 21 4.58e-04 1.49e-02 NA
2. P Q9Y807 Uncharacterized protein C146.02 1.05e-02 6.12e-03 NA
2. P Q10932 Uncharacterized protein B0304.2 5.46e-01 3.66e-02 NA
2. P Q12507 Superficial pseudohyphal growth protein 1 1.05e-01 1.10e-02 NA
2. P Q4X0I5 Mediator of RNA polymerase II transcription subunit 21 1.63e-02 3.82e-02 NA
2. P Q00096 Cross-pathway control protein A 4.13e-02 1.27e-02 NA
2. P Q9BQ61 Telomerase RNA component interacting RNase 8.57e-03 1.91e-02 NA
2. P B2BRG5 Non-structural protein 5 NA 2.72e-02 NA
2. P Q91XQ4 DNA-directed RNA polymerase II subunit GRINL1A 2.20e-02 1.65e-02 NA
2. P Q8V9C3 Non-structural protein 5 NA 1.13e-02 NA
2. P B6IDH8 Protein SOB FIVE-LIKE 6 1.28e-01 1.30e-02 NA
2. P P48238 Uncharacterized protein YGR153W 1.05e-01 2.18e-03 NA
2. P Q7SZP2 UPF0690 protein C1orf52 homolog 2.04e-02 4.00e-03 NA
2. P Q9D735 Telomerase RNA component interacting RNase 1.79e-02 4.52e-03 NA
2. P A2T3Q9 Non-structural protein 5 NA 5.57e-03 NA
2. P O74897 SWR1-complex protein 5 1.01e-03 3.36e-04 NA
2. P Q9E8F2 Non-structural protein 5 NA 1.86e-02 NA
2. P Q8V9C4 Non-structural protein 5 NA 2.44e-02 NA
2. P Q9JK54 Mesogenin-1 2.24e-02 2.22e-03 NA
2. P Q9USK4 Pre-mRNA-splicing factor cwf20 1.33e-01 1.70e-02 NA
2. P B3SRS5 Non-structural protein 5 NA 3.89e-02 NA