Summary

A0A1B0GTR3

Homolog: O97965.
Function: Spermatid nuclear transition protein 3.

Statistics

Total GO Annotation: 74
Unique PROST Go: 69
Unique BLAST Go: 3

Total Homologs: 14
Unique PROST Homologs: 10
Unique BLAST Homologs: 2

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was O97965 (Spermatid nuclear transition protein 3) with a FATCAT P-Value: 1.41e-05 and RMSD of 2.13 angstrom. The sequence alignment identity is 30.6%.
Structural alignment shown in left. Query protein A0A1B0GTR3 colored as red in alignment, homolog O97965 colored as blue. Query protein A0A1B0GTR3 is also shown in right top, homolog O97965 showed in right bottom. They are colored based on secondary structures. 

  A0A1B0GTR3 MAKVTSEPQKPNEDVDEQTPSTSSTKGRKKGKTPRQRRSRSGVKGLKTTRKAKRPLRGSSSQKAGETNTPAGKPKKARGP--ILRG-----------RYH 87
      O97965 MAKGTRKPRQPRR-V--AVRFASRMKGRK--KTLWQRRYRGSVKAPNMTMRVRRPLKGTLRKKIRSYATPSKKVKNTREPNCFLRSCAREKLNQSRKRYQ 95

  A0A1B0GTR3 RLKEKMKKEEADKEQSETSVL 108
      O97965 NMRQSQRRGQNQKRR------ 110

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0007283 spermatogenesis
1. PB GO:0000786 nucleosome
2. P GO:2000685 positive regulation of cellular response to X-ray
2. P GO:0008134 transcription factor binding
2. P GO:0090402 oncogene-induced cell senescence
2. P GO:0003680 minor groove of adenine-thymine-rich DNA binding
2. P GO:0030374 nuclear receptor coactivator activity
2. P GO:2001038 regulation of cellular response to drug
2. P GO:0048333 mesodermal cell differentiation
2. P GO:0046965 retinoid X receptor binding
2. P GO:0035986 obsolete senescence-associated heterochromatin focus assembly
2. P GO:0045892 negative regulation of transcription, DNA-templated
2. P GO:0030527 structural constituent of chromatin
2. P GO:0003713 transcription coactivator activity
2. P GO:0008285 negative regulation of cell population proliferation
2. P GO:0003131 mesodermal-endodermal cell signaling
2. P GO:0006268 DNA unwinding involved in DNA replication
2. P GO:0035497 cAMP response element binding
2. P GO:0042974 retinoic acid receptor binding
2. P GO:0035985 senescence-associated heterochromatin focus
2. P GO:0007275 multicellular organism development
2. P GO:0035987 endodermal cell differentiation
2. P GO:0035500 MH2 domain binding
2. P GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
2. P GO:0045444 fat cell differentiation
2. P GO:0031507 heterochromatin assembly
2. P GO:0031052 chromosome breakage
2. P GO:0035988 chondrocyte proliferation
2. P GO:0045869 negative regulation of single stranded viral RNA replication via double stranded DNA intermediate
2. P GO:0090575 RNA polymerase II transcription regulator complex
2. P GO:0042975 peroxisome proliferator activated receptor binding
2. P GO:0071902 positive regulation of protein serine/threonine kinase activity
2. P GO:0001837 epithelial to mesenchymal transition
2. P GO:0046426 negative regulation of receptor signaling pathway via JAK-STAT
2. P GO:0070742 C2H2 zinc finger domain binding
2. P GO:0035501 MH1 domain binding
2. P GO:0008301 DNA binding, bending
2. P GO:0019899 enzyme binding
2. P GO:0003682 chromatin binding
2. P GO:0071864 positive regulation of cell proliferation in bone marrow
2. P GO:0006337 nucleosome disassembly
2. P GO:0048863 stem cell differentiation
2. P GO:2000036 regulation of stem cell population maintenance
2. P GO:0031492 nucleosomal DNA binding
2. P GO:0051575 5'-deoxyribose-5-phosphate lyase activity
2. P GO:2001022 positive regulation of response to DNA damage stimulus
2. P GO:0048762 mesenchymal cell differentiation
2. P GO:0042769 obsolete DNA damage response, detection of DNA damage
2. P GO:0043392 negative regulation of DNA binding
2. P GO:0046332 SMAD binding
2. P GO:2000648 positive regulation of stem cell proliferation
2. P GO:0003712 transcription coregulator activity
2. P GO:0071141 SMAD protein complex
2. P GO:0031936 obsolete negative regulation of chromatin silencing
2. P GO:0002062 chondrocyte differentiation
2. P GO:0006284 base-excision repair
2. P GO:0000987 cis-regulatory region sequence-specific DNA binding
2. P GO:0009615 response to virus
2. P GO:0030261 chromosome condensation
2. P GO:0006355 regulation of transcription, DNA-templated
2. P GO:0007095 mitotic G2 DNA damage checkpoint signaling
2. P GO:0033144 negative regulation of intracellular steroid hormone receptor signaling pathway
2. P GO:0035978 histone H2A-S139 phosphorylation
2. P GO:0043922 negative regulation by host of viral transcription
2. P GO:0045944 positive regulation of transcription by RNA polymerase II
2. P GO:2001033 negative regulation of double-strand break repair via nonhomologous end joining
2. P GO:2000773 negative regulation of cellular senescence
2. P GO:0045893 positive regulation of transcription, DNA-templated
2. P GO:0010564 regulation of cell cycle process
2. P GO:0000228 nuclear chromosome
2. P GO:2000774 positive regulation of cellular senescence
3. B GO:0030154 cell differentiation
3. B GO:0005634 nucleus
3. B GO:0003677 DNA binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB P0DPH9 Uncharacterized protein CXorf51B 2.49e-10 2.87e-130 5.26e-71
1. PB A0A1B0GTR3 Uncharacterized protein CXorf51A 0 2.87e-130 5.26e-71
2. P Q8C6B9 Active regulator of SIRT1 4.24e-01 4.39e-02 NA
2. P P17843 60S ribosomal protein L44 5.14e-01 3.08e-02 NA
2. P P17095 High mobility group protein HMG-I/HMG-Y 1.82e-01 2.63e-03 NA
2. P P52926 High mobility group protein HMGI-C 1.35e-01 1.37e-02 NA
2. P Q8K585 High mobility group protein HMG-I/HMG-Y 5.12e-02 3.92e-04 NA
2. P Q6URC2 High mobility group protein HMG-I/HMG-Y 1.51e-01 1.59e-02 NA
2. P P42136 Sperm protamine P1 9.26e-02 1.95e-02 NA
2. P P42147 Sperm protamine P1 1.38e-01 3.02e-03 NA
2. P Q07602 Uncharacterized protein in mosA 5'region 2.13e-01 1.60e-02 NA
2. P P17096 High mobility group protein HMG-I/HMG-Y 1.39e-01 1.59e-02 NA
3. B Q09821 Spermatid nuclear transition protein 4 8.61e-05 NA 0.006
3. B O97965 Spermatid nuclear transition protein 3 1.41e-05 NA 0.007