Results | PROST

Summary

A0A1B0GTZ2

Homolog: Q6ZUS5.
Function: Coiled-coil domain-containing protein 121.

Statistics

Total GO Annotation: 261
Unique PROST Go: 261
Unique BLAST Go: 0

Total Homologs: 302
Unique PROST Homologs: 299
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q6ZUS5 (Coiled-coil domain-containing protein 121) with a FATCAT P-Value: 3.34e-09 and RMSD of 3.25 angstrom. The sequence alignment identity is 22.6%.
Structural alignment shown in left. Query protein A0A1B0GTZ2 colored as red in alignment, homolog Q6ZUS5 colored as blue. Query protein A0A1B0GTZ2 is also shown in right top, homolog Q6ZUS5 showed in right bottom. They are colored based on secondary structures.

  A0A1B0GTZ2 ------------------------------------------MTSGANSSGSYLPSEIRSSKIDDNYLKELNEDLKLRKQE----LLEMLKPLEDKNNLL 54
      Q6ZUS5 MTDLNKHIKQAQTQRKQLLEESRELHREKLLVQAENRFFLEYLT---NKTEEY--TE-QPEKVWNSYLQK-SGEIERRRQESASRYAEQISVL--KTALL 91

  A0A1B0GTZ2 FQK--LMSNLEEKQRSLQIMRQIMAGKGCEESSVMELLKEAEEMK--QNLERKNKMLRKEMEMLWNKTFE--AEELSDQQKAPQTKNKAD---LQDGKAP 145
      Q6ZUS5 -QKENIQSSL--K-RKLQAMRDI------------AILKEKQE-KEIQTLQEETKKVQAETA---SKTREVQAQLLQEKRLLEKQLSEPDRRLL--GK-- 167

  A0A1B0GTZ2 KSPSSPRKTESELE-KSFAEKV--KE--------IRKEKQQRKMEWVKYQEQ-NNILQNDFHGKVIELRIEALKNYQKANDLKL-SLYLQQNFEPMQAFL 232
      Q6ZUS5 ------RK-RRELNMKAQALKLAAKRFIFEYSCGINRENQQFKKELLQLIEQAQKLTATQSH----------LEN-RK-QQLQQEQWYLES---LIQARQ 245

  A0A1B0GTZ2 NLPGSQGTMGITTMDRV--TTGRNEHHVRILGTKIYTEQQGTKGSQLDNTGGRLFFLRSLPDEALKN 297
      Q6ZUS5 RLQGSHNQC-LNRQD-VPKTTPS-------L-------PQGTK-SRI-NPK---------------- 278

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
2. P	GO:0017134	fibroblast growth factor binding
2. P	GO:0070530	K63-linked polyubiquitin modification-dependent protein binding
2. P	GO:0019904	protein domain specific binding
2. P	GO:0007094	mitotic spindle assembly checkpoint signaling
2. P	GO:0043296	apical junction complex
2. P	GO:0005874	microtubule
2. P	GO:0048311	mitochondrion distribution
2. P	GO:0005080	protein kinase C binding
2. P	GO:0008286	insulin receptor signaling pathway
2. P	GO:0047496	vesicle transport along microtubule
2. P	GO:2000147	positive regulation of cell motility
2. P	GO:0045121	membrane raft
2. P	GO:0008156	negative regulation of DNA replication
2. P	GO:0007314	oocyte anterior/posterior axis specification
2. P	GO:0031902	late endosome membrane
2. P	GO:0031965	nuclear membrane
2. P	GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
2. P	GO:0023035	CD40 signaling pathway
2. P	GO:0009903	chloroplast avoidance movement
2. P	GO:0019894	kinesin binding
2. P	GO:1990819	actin fusion focus
2. P	GO:1904801	positive regulation of neuron remodeling
2. P	GO:0016325	oocyte microtubule cytoskeleton organization
2. P	GO:0008017	microtubule binding
2. P	GO:0007020	microtubule nucleation
2. P	GO:0060334	regulation of interferon-gamma-mediated signaling pathway
2. P	GO:1990565	HSP90-CDC37 chaperone complex
2. P	GO:0008021	synaptic vesicle
2. P	GO:0007405	neuroblast proliferation
2. P	GO:0006997	nucleus organization
2. P	GO:1900029	positive regulation of ruffle assembly
2. P	GO:0042110	T cell activation
2. P	GO:0070012	oligopeptidase activity
2. P	GO:0010005	cortical microtubule, transverse to long axis
2. P	GO:0051301	cell division
2. P	GO:0032839	dendrite cytoplasm
2. P	GO:0002756	MyD88-independent toll-like receptor signaling pathway
2. P	GO:0060338	regulation of type I interferon-mediated signaling pathway
2. P	GO:0045786	negative regulation of cell cycle
2. P	GO:0000802	transverse filament
2. P	GO:0033157	regulation of intracellular protein transport
2. P	GO:0080009	mRNA methylation
2. P	GO:0043231	intracellular membrane-bounded organelle
2. P	GO:0044565	dendritic cell proliferation
2. P	GO:0098957	anterograde axonal transport of mitochondrion
2. P	GO:0099070	static microtubule bundle
2. P	GO:0043015	gamma-tubulin binding
2. P	GO:0006612	protein targeting to membrane
2. P	GO:2001235	positive regulation of apoptotic signaling pathway
2. P	GO:0045098	type III intermediate filament
2. P	GO:0034162	toll-like receptor 9 signaling pathway
2. P	GO:0005816	spindle pole body
2. P	GO:0010975	regulation of neuron projection development
2. P	GO:0070732	spindle envelope
2. P	GO:0008333	endosome to lysosome transport
2. P	GO:0016592	mediator complex
2. P	GO:0048490	anterograde synaptic vesicle transport
2. P	GO:0042734	presynaptic membrane
2. P	GO:0046718	viral entry into host cell
2. P	GO:0008608	attachment of spindle microtubules to kinetochore
2. P	GO:0016477	cell migration
2. P	GO:0007100	mitotic centrosome separation
2. P	GO:0001786	phosphatidylserine binding
2. P	GO:0031083	BLOC-1 complex
2. P	GO:0021955	central nervous system neuron axonogenesis
2. P	GO:0005819	spindle
2. P	GO:0036158	outer dynein arm assembly
2. P	GO:0035023	regulation of Rho protein signal transduction
2. P	GO:0044295	axonal growth cone
2. P	GO:0030331	estrogen receptor binding
2. P	GO:0008103	oocyte microtubule cytoskeleton polarization
2. P	GO:0007249	I-kappaB kinase/NF-kappaB signaling
2. P	GO:0098779	positive regulation of mitophagy in response to mitochondrial depolarization
2. P	GO:0043515	kinetochore binding
2. P	GO:0007533	mating type switching
2. P	GO:2000145	regulation of cell motility
2. P	GO:0005634	nucleus
2. P	GO:0031593	polyubiquitin modification-dependent protein binding
2. P	GO:0036064	ciliary basal body
2. P	GO:0022008	neurogenesis
2. P	GO:0005930	axoneme
2. P	GO:0045494	photoreceptor cell maintenance
2. P	GO:0043203	axon hillock
2. P	GO:0031410	cytoplasmic vesicle
2. P	GO:0007010	cytoskeleton organization
2. P	GO:0005789	endoplasmic reticulum membrane
2. P	GO:0000743	nuclear migration involved in conjugation with cellular fusion
2. P	GO:0005901	caveola
2. P	GO:0000381	regulation of alternative mRNA splicing, via spliceosome
2. P	GO:0042134	rRNA primary transcript binding
2. P	GO:0003677	DNA binding
2. P	GO:0001764	neuron migration
2. P	GO:0090724	central region of growth cone
2. P	GO:0036258	multivesicular body assembly
2. P	GO:1902405	mitotic actomyosin contractile ring localization
2. P	GO:0034138	toll-like receptor 3 signaling pathway
2. P	GO:0075732	viral penetration into host nucleus
2. P	GO:0005814	centriole
2. P	GO:0005769	early endosome
2. P	GO:2000574	obsolete regulation of microtubule motor activity
2. P	GO:1904600	actin fusion focus assembly
2. P	GO:0060155	platelet dense granule organization
2. P	GO:1904115	axon cytoplasm
2. P	GO:0032391	photoreceptor connecting cilium
2. P	GO:0042729	DASH complex
2. P	GO:0021987	cerebral cortex development
2. P	GO:0030866	cortical actin cytoskeleton organization
2. P	GO:0098939	dendritic transport of mitochondrion
2. P	GO:0044691	tooth eruption
2. P	GO:0042073	intraciliary transport
2. P	GO:0005923	bicellular tight junction
2. P	GO:0003712	transcription coregulator activity
2. P	GO:0000795	synaptonemal complex
2. P	GO:0006623	protein targeting to vacuole
2. P	GO:0035735	intraciliary transport involved in cilium assembly
2. P	GO:0000137	Golgi cis cisterna
2. P	GO:0030911	TPR domain binding
2. P	GO:0005801	cis-Golgi network
2. P	GO:0032118	horsetail-astral microtubule organization
2. P	GO:0006469	negative regulation of protein kinase activity
2. P	GO:0045944	positive regulation of transcription by RNA polymerase II
2. P	GO:0000776	kinetochore
2. P	GO:0034453	microtubule anchoring
2. P	GO:0060052	neurofilament cytoskeleton organization
2. P	GO:0005635	nuclear envelope
2. P	GO:0008090	retrograde axonal transport
2. P	GO:0005881	cytoplasmic microtubule
2. P	GO:0051081	nuclear membrane disassembly
2. P	GO:0051028	mRNA transport
2. P	GO:0007080	mitotic metaphase plate congression
2. P	GO:0032922	circadian regulation of gene expression
2. P	GO:0007060	male meiosis chromosome segregation
2. P	GO:0036286	eisosome filament
2. P	GO:0051898	negative regulation of protein kinase B signaling
2. P	GO:0010008	endosome membrane
2. P	GO:0035020	regulation of Rac protein signal transduction
2. P	GO:2000146	negative regulation of cell motility
2. P	GO:0007399	nervous system development
2. P	GO:0000132	establishment of mitotic spindle orientation
2. P	GO:0034451	centriolar satellite
2. P	GO:0021522	spinal cord motor neuron differentiation
2. P	GO:1902440	protein localization to mitotic spindle pole body
2. P	GO:0007030	Golgi organization
2. P	GO:0007517	muscle organ development
2. P	GO:0008543	fibroblast growth factor receptor signaling pathway
2. P	GO:0005929	cilium
2. P	GO:0098972	anterograde dendritic transport of mitochondrion
2. P	GO:0051311	meiotic metaphase plate congression
2. P	GO:0098535	de novo centriole assembly involved in multi-ciliated epithelial cell differentiation
2. P	GO:0048487	beta-tubulin binding
2. P	GO:0009832	plant-type cell wall biogenesis
2. P	GO:0007097	nuclear migration
2. P	GO:0010168	ER body
2. P	GO:0007059	chromosome segregation
2. P	GO:0120172	positive regulation of actin filament bundle convergence involved in mitotic contractile ring assembly
2. P	GO:0033162	melanosome membrane
2. P	GO:0006363	termination of RNA polymerase I transcription
2. P	GO:0090630	activation of GTPase activity
2. P	GO:0005815	microtubule organizing center
2. P	GO:0036362	ascus membrane
2. P	GO:0060053	neurofilament cytoskeleton
2. P	GO:0044196	host cell nucleolus
2. P	GO:0051642	centrosome localization
2. P	GO:0008089	anterograde axonal transport
2. P	GO:0031616	spindle pole centrosome
2. P	GO:0003341	cilium movement
2. P	GO:0001833	inner cell mass cell proliferation
2. P	GO:0007098	centrosome cycle
2. P	GO:0031023	microtubule organizing center organization
2. P	GO:0005821	intermediate layer of spindle pole body
2. P	GO:0051011	microtubule minus-end binding
2. P	GO:1990810	microtubule anchoring at mitotic spindle pole body
2. P	GO:0070498	interleukin-1-mediated signaling pathway
2. P	GO:0034134	toll-like receptor 2 signaling pathway
2. P	GO:0000922	spindle pole
2. P	GO:1902188	obsolete positive regulation of viral release from host cell
2. P	GO:0048309	endoplasmic reticulum inheritance
2. P	GO:0007129	homologous chromosome pairing at meiosis
2. P	GO:0050811	GABA receptor binding
2. P	GO:0031252	cell leading edge
2. P	GO:0007288	sperm axoneme assembly
2. P	GO:0042383	sarcolemma
2. P	GO:0070847	core mediator complex
2. P	GO:0005652	nuclear lamina
2. P	GO:0048813	dendrite morphogenesis
2. P	GO:0051298	centrosome duplication
2. P	GO:0007130	synaptonemal complex assembly
2. P	GO:0032580	Golgi cisterna membrane
2. P	GO:0005912	adherens junction
2. P	GO:0031024	interphase microtubule organizing center assembly
2. P	GO:0007535	donor selection
2. P	GO:0097545	axonemal outer doublet
2. P	GO:0009303	rRNA transcription
2. P	GO:0050771	negative regulation of axonogenesis
2. P	GO:0032154	cleavage furrow
2. P	GO:2000352	negative regulation of endothelial cell apoptotic process
2. P	GO:0051010	microtubule plus-end binding
2. P	GO:0097298	regulation of nucleus size
2. P	GO:0034763	negative regulation of transmembrane transport
2. P	GO:0060159	regulation of dopamine receptor signaling pathway
2. P	GO:0003382	epithelial cell morphogenesis
2. P	GO:0097320	plasma membrane tubulation
2. P	GO:1990138	neuron projection extension
2. P	GO:1903774	positive regulation of viral budding via host ESCRT complex
2. P	GO:0034501	protein localization to kinetochore
2. P	GO:0021799	cerebral cortex radially oriented cell migration
2. P	GO:0035024	negative regulation of Rho protein signal transduction
2. P	GO:0009904	chloroplast accumulation movement
2. P	GO:0000813	ESCRT I complex
2. P	GO:0048680	positive regulation of axon regeneration
2. P	GO:1990811	MWP complex
2. P	GO:0071392	cellular response to estradiol stimulus
2. P	GO:0032126	eisosome
2. P	GO:0035630	bone mineralization involved in bone maturation
2. P	GO:0010051	xylem and phloem pattern formation
2. P	GO:0000212	meiotic spindle organization
2. P	GO:1901003	negative regulation of fermentation
2. P	GO:0001835	blastocyst hatching
2. P	GO:1901214	regulation of neuron death
2. P	GO:0017075	syntaxin-1 binding
2. P	GO:0007155	cell adhesion
2. P	GO:0044732	mitotic spindle pole body
2. P	GO:0019899	enzyme binding
2. P	GO:0046966	thyroid hormone receptor binding
2. P	GO:0043014	alpha-tubulin binding
2. P	GO:0051303	establishment of chromosome localization
2. P	GO:0007309	oocyte axis specification
2. P	GO:0030154	cell differentiation
2. P	GO:0097028	dendritic cell differentiation
2. P	GO:0098536	deuterosome
2. P	GO:0009908	flower development
2. P	GO:1903445	protein transport from ciliary membrane to plasma membrane
2. P	GO:0005871	kinesin complex
2. P	GO:1990537	mitotic spindle polar microtubule
2. P	GO:0070941	eisosome assembly
2. P	GO:0007286	spermatid development
2. P	GO:0016021	integral component of membrane
2. P	GO:0000278	mitotic cell cycle
2. P	GO:0030989	dynein-driven meiotic oscillatory nuclear movement
2. P	GO:0060271	cilium assembly
2. P	GO:0031175	neuron projection development
2. P	GO:0005875	microtubule associated complex
2. P	GO:0031262	Ndc80 complex
2. P	GO:0032418	lysosome localization
2. P	GO:0005813	centrosome
2. P	GO:0000940	outer kinetochore
2. P	GO:0032991	protein-containing complex
2. P	GO:0005829	cytosol
2. P	GO:0046872	metal ion binding
2. P	GO:0070507	regulation of microtubule cytoskeleton organization
2. P	GO:0036396	RNA N6-methyladenosine methyltransferase complex
2. P	GO:0017022	myosin binding
2. P	GO:0007528	neuromuscular junction development
2. P	GO:0005882	intermediate filament
2. P	GO:0006361	transcription initiation from RNA polymerase I promoter
2. P	GO:1902017	regulation of cilium assembly
2. P	GO:0043032	positive regulation of macrophage activation
2. P	GO:0042802	identical protein binding
2. P	GO:0045773	positive regulation of axon extension
2. P	GO:0005654	nucleoplasm
2. P	GO:0060261	positive regulation of transcription initiation from RNA polymerase II promoter

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	A0A1B0GTZ2	Putative coiled-coil domain-containing protein 196	0	3.41e-154	0.0
1. PB	Q2YDE5	Putative coiled-coil domain-containing protein 196	1.31e-06	9.40e-12	4.66e-90
2. P	A6NI56	Coiled-coil domain-containing protein 154	2.20e-05	8.15e-05	NA
2. P	Q10921	Uncharacterized protein B0286.1	2.34e-05	2.06e-02	NA
2. P	Q5U465	Coiled-coil domain-containing protein 125	1.60e-05	6.98e-06	NA
2. P	Q66IZ7	Nuclear distribution protein nudE-like 1-B	5.63e-06	9.16e-06	NA
2. P	Q6QZQ4	Vimentin-type intermediate filament-associated coiled-coil protein	4.43e-05	5.13e-03	NA
2. P	Q6FLL9	Biogenesis of lysosome-related organelles complex 1 subunit VAB2	5.06e-04	4.59e-03	NA
2. P	Q6AXZ4	Centrosomal protein CEP57L1	4.96e-06	3.65e-04	NA
2. P	Q86T90	Protein hinderin	2.03e-05	4.29e-04	NA
2. P	C7GY13	SWI5-dependent HO expression protein 3	1.45e-06	1.01e-06	NA
2. P	Q6NZI2	Caveolae-associated protein 1	1.40e-05	4.69e-03	NA
2. P	D3YZP9	Coiled-coil domain-containing protein 6	1.37e-06	2.15e-02	NA
2. P	Q28CJ6	Nuclear distribution protein nudE-like 1	4.68e-06	7.88e-05	NA
2. P	Q91VJ2	Caveolae-associated protein 3	5.67e-04	2.44e-03	NA
2. P	P86272	Alpha-S1-casein	1.50e-02	3.67e-02	NA
2. P	Q6ZU80	Centrosomal protein of 128 kDa	1.68e-02	2.23e-02	NA
2. P	P40214	Protein FDO1	9.33e-05	1.78e-05	NA
2. P	Q9VM65	FGFR1 oncogene partner 2 homolog	1.41e-06	1.98e-06	NA
2. P	Q9JJC6	RILP-like protein 1	2.30e-05	1.17e-02	NA
2. P	Q9Y2D8	Afadin- and alpha-actinin-binding protein	2.41e-05	2.03e-05	NA
2. P	Q0VFX2	Cilia- and flagella-associated protein 157	5.62e-05	1.87e-02	NA
2. P	Q99JG7	TNFAIP3-interacting protein 2	1.00e-06	5.26e-04	NA
2. P	Q96KP6	TNFAIP3-interacting protein 3	2.46e-07	9.79e-10	NA
2. P	Q6CVK1	DASH complex subunit DAM1	1.49e-02	1.84e-02	NA
2. P	Q6FLP6	Spindle pole body component SPC42	1.87e-04	4.87e-02	NA
2. P	Q8TDR4	T-complex protein 10A homolog 1	1.41e-03	3.64e-03	NA
2. P	P85125	Caveolae-associated protein 1	2.54e-05	2.19e-02	NA
2. P	O94252	Uncharacterized protein P8B7.02	8.58e-09	3.07e-05	NA
2. P	P70213	Friend virus susceptibility protein 1	1.93e-03	3.27e-02	NA
2. P	B0CM36	Lebercilin-like protein	6.10e-04	2.39e-04	NA
2. P	Q8NHQ1	Centrosomal protein of 70 kDa	1.53e-04	7.44e-03	NA
2. P	Q95K40	Coiled-coil domain-containing protein 83	3.83e-05	7.18e-08	NA
2. P	Q4R7V1	Centrosomal protein of 70 kDa	2.43e-04	4.27e-02	NA
2. P	Q68FQ8	Deleted in lung and esophageal cancer protein 1 homolog	7.02e-02	5.84e-07	NA
2. P	Q6P4K5	Pre-mRNA-splicing regulator WTAP	1.29e-06	2.67e-05	NA
2. P	Q5RDE3	Centrosomal protein of 70 kDa	4.44e-04	4.78e-02	NA
2. P	Q64EW6	Kinetochore protein Spc25	2.18e-04	1.48e-02	NA
2. P	P32448	Anti-silencing protein 2	7.82e-06	7.86e-11	NA
2. P	Q4R3Q7	Lebercilin-like protein	1.93e-04	4.68e-04	NA
2. P	Q6CL89	Spindle pole body component SPC42	4.37e-06	4.94e-06	NA
2. P	A8MQT2	Golgin subfamily A member 8B	2.10e-04	1.28e-02	NA
2. P	Q9CQA5	Mediator of RNA polymerase II transcription subunit 4	1.99e-04	5.34e-03	NA
2. P	Q0VCP9	Coiled-coil domain-containing protein 149	5.84e-07	2.40e-09	NA
2. P	Q9FHZ2	Mediator of RNA polymerase II transcription subunit 10a	6.88e-05	2.36e-02	NA
2. P	A6ZZS3	Spindle pole body component SPC42	4.36e-05	2.47e-03	NA
2. P	Q6RUT8	Coiled-coil domain-containing protein 154	8.11e-06	4.35e-02	NA
2. P	Q8IWF9	Coiled-coil domain-containing protein 83	1.33e-06	8.59e-07	NA
2. P	C8ZCC8	Spindle pole body component SPC42	1.56e-05	2.47e-03	NA
2. P	Q2TBH8	ZW10 interactor	1.04e-05	3.43e-02	NA
2. P	Q5R8T7	Nuclear distribution protein nudE-like 1	3.02e-06	1.47e-04	NA
2. P	Q10336	Meiotic coiled-coil protein 6	1.54e-06	1.40e-05	NA
2. P	Q9D4V3	Coiled-coil domain-containing protein 83	2.41e-05	3.57e-09	NA
2. P	Q96EA4	Protein Spindly	1.68e-05	1.18e-04	NA
2. P	Q93W28	Uncharacterized protein At4g15545	4.16e-04	2.95e-02	NA
2. P	Q6Z746	Microtubule-associated protein 70-2	5.95e-05	5.62e-03	NA
2. P	Q5XJA2	Coiled-coil domain-containing protein 149-A	2.81e-06	2.86e-02	NA
2. P	H2KYP0	PAC-1 interacting and coiled-coil domain-containing protein 1	2.59e-04	3.25e-03	NA
2. P	Q9H9H4	Vacuolar protein sorting-associated protein 37B	6.40e-04	1.06e-02	NA
2. P	Q80X59	Transmembrane and coiled-coil domain-containing protein 5B	7.67e-08	7.49e-06	NA
2. P	Q6DHL7	Coiled-coil domain-containing protein 85C-B	1.38e-04	3.62e-06	NA
2. P	Q2NL98	Vimentin-type intermediate filament-associated coiled-coil protein	1.75e-05	1.15e-03	NA
2. P	A7MBH5	Outer dynein arm-docking complex subunit 3	3.52e-05	1.47e-02	NA
2. P	E7Q664	Spindle pole body component SPC42	NA	1.22e-02	NA
2. P	Q78PB6	Nuclear distribution protein nudE-like 1	5.80e-06	1.54e-04	NA
2. P	A8MYB1	Transmembrane and coiled-coil domain-containing protein 5B	2.31e-08	1.36e-02	NA
2. P	Q28BZ7	Centrosomal protein cep57l1	1.54e-04	7.88e-05	NA
2. P	Q9H6S1	5-azacytidine-induced protein 2	4.92e-07	1.25e-12	NA
2. P	Q5ZKH4	Nuclear distribution protein nudE-like 1	5.64e-06	1.53e-03	NA
2. P	P0C6M0	Large delta antigen	NA	3.95e-02	NA
2. P	Q9UTJ3	Meiotic expression up-regulated protein 1/2	2.66e-04	9.07e-03	NA
2. P	Q68FG0	Zinc finger C4H2 domain-containing protein	6.41e-05	3.84e-02	NA
2. P	Q66J96	Nuclear distribution protein nudE homolog 1-A	3.95e-06	1.72e-02	NA
2. P	H3BSY2	Golgin subfamily A member 8M	7.92e-05	1.59e-05	NA
2. P	O13743	Uncharacterized protein C16E8.08	1.15e-06	6.59e-04	NA
2. P	Q53HC0	Coiled-coil domain-containing protein 92	4.37e-06	5.09e-07	NA
2. P	Q9NXR1	Nuclear distribution protein nudE homolog 1	4.99e-06	2.38e-05	NA
2. P	Q9P6R4	Meiotically up-regulated gene 172 protein	1.27e-06	2.01e-02	NA
2. P	B3LN26	SWI5-dependent HO expression protein 3	4.94e-06	1.29e-06	NA
2. P	Q0V989	Coiled-coil domain-containing protein 85C	9.00e-05	5.32e-04	NA
2. P	O15482	Testis-specific protein TEX28	2.92e-05	2.52e-03	NA
2. P	Q9CA42	Protein CROWDED NUCLEI 3	1.14e-02	3.30e-02	NA
2. P	H2MTR9	Afadin- and alpha-actinin-binding protein	2.84e-06	3.27e-02	NA
2. P	P61430	Synaptonemal complex protein 2	1.35e-03	2.39e-02	NA
2. P	Q2TA00	Coiled-coil domain-containing protein 83	7.44e-04	6.54e-07	NA
2. P	Q8GYX3	Microtubule-associated protein 70-5	7.09e-05	3.42e-03	NA
2. P	D6RF30	Golgin subfamily A member 8K	9.97e-05	2.03e-04	NA
2. P	Q6NZK5	Protein hinderin	6.90e-04	1.77e-02	NA
2. P	A6NCC3	Golgin subfamily A member 8O	1.80e-05	9.42e-08	NA
2. P	Q64EW3	Kinetochore protein Spc25	2.34e-05	1.34e-03	NA
2. P	Q86W54	Spermatogenesis-associated protein 24	4.34e-08	1.31e-02	NA
2. P	Q01649	Spindle pole body-associated protein CIK1	3.33e-06	4.19e-02	NA
2. P	F4K1B4	Nuclear envelope-associated protein 2	1.60e-08	1.24e-02	NA
2. P	Q32LK9	Synaptonemal complex central element protein 1	9.36e-07	8.24e-05	NA
2. P	Q9VT70	Nuclear distribution protein nudE homolog	1.70e-06	9.97e-05	NA
2. P	Q9C717	Protein FLX-like 3	9.30e-07	3.19e-03	NA
2. P	Q09350	Uncharacterized protein T09B9.4	1.17e-05	4.96e-02	NA
2. P	B4R1Z3	Kinetochore protein Spc25	1.66e-04	7.97e-03	NA
2. P	Q8L7S4	Microtubule-associated protein 70-2	4.05e-05	8.41e-04	NA
2. P	Q4R4S6	Nuclear distribution protein nudE-like 1	5.03e-06	3.18e-05	NA
2. P	Q5RD40	5-azacytidine-induced protein 2	1.50e-04	4.23e-10	NA
2. P	A2BDR7	Cilia- and flagella-associated protein 157	9.56e-07	6.45e-04	NA
2. P	A6NC78	Putative golgin subfamily A member 8I	4.42e-05	4.28e-06	NA
2. P	Q5FWP9	Centrosomal protein cep57l1	1.44e-04	8.72e-03	NA
2. P	Q5BKX8	Caveolae-associated protein 4	1.33e-05	3.53e-02	NA
2. P	Q8VYU6	Golgin candidate 4	5.08e-05	2.70e-03	NA
2. P	Q18412	Shugoshin	8.70e-04	5.61e-04	NA
2. P	Q86W67	Protein FAM228A	3.91e-02	3.03e-04	NA
2. P	Q60ZS1	Shugoshin	8.70e-04	1.27e-02	NA
2. P	Q6CRH4	SWI5-dependent HO expression protein 3	1.02e-06	6.12e-06	NA
2. P	Q21194	Guanine nucleotide exchange factor rei-2	9.20e-04	5.31e-05	NA
2. P	A0A125S9M6	Cytotardin	4.42e-05	2.97e-04	NA
2. P	Q5RDH2	CTTNBP2 N-terminal-like protein	4.27e-05	2.21e-02	NA
2. P	C5MH60	SWI5-dependent HO expression protein 3	5.89e-06	3.67e-02	NA
2. P	E9PVD1	Coiled-coil domain-containing protein 62	7.45e-05	4.09e-05	NA
2. P	Q5R8Y4	Leucine zipper protein 2	1.89e-07	7.72e-09	NA
2. P	I6L899	Golgin subfamily A member 8R	2.56e-05	1.20e-07	NA
2. P	Q75DH2	Spindle pole body component SPC42	2.53e-05	3.37e-02	NA
2. P	Q9SCT6	WEB family protein At3g51720	2.73e-06	1.14e-02	NA
2. P	Q8VDS7	Centrosomal protein CEP57L1	2.03e-06	1.32e-05	NA
2. P	Q8IYX8	Centrosomal protein CEP57L1	1.75e-03	1.03e-03	NA
2. P	P36094	Spindle pole body component SPC42	5.41e-05	2.62e-03	NA
2. P	Q7SXI6	Nuclear distribution protein nudE-like 1-A	1.05e-05	1.21e-05	NA
2. P	Q2HJA5	Dysbindin	2.30e-05	1.14e-02	NA
2. P	Q6CV05	Spindle pole body component KRE28	1.47e-05	1.73e-02	NA
2. P	A0PJT0	RILP-like protein 1	8.19e-06	7.08e-03	NA
2. P	Q0VFN8	Cilia- and flagella-associated protein 157	7.96e-06	2.83e-02	NA
2. P	Q969G5	Caveolae-associated protein 3	4.12e-03	1.63e-04	NA
2. P	O42903	GRIP domain-containing protein C119.12	2.91e-07	8.46e-03	NA
2. P	A6NN73	Golgin subfamily A member 8C	2.88e-05	4.03e-03	NA
2. P	Q8NFZ5	TNFAIP3-interacting protein 2	1.08e-07	6.80e-03	NA
2. P	A2BGP7	Coiled-coil domain-containing protein 125	6.16e-05	3.74e-02	NA
2. P	Q6P9F0	Coiled-coil domain-containing protein 62	2.00e-04	3.53e-03	NA
2. P	Q9ERR1	Nuclear distribution protein nudE-like 1	6.33e-06	1.54e-04	NA
2. P	A5WUL3	Mediator of RNA polymerase II transcription subunit 22	3.70e-05	2.06e-02	NA
2. P	B4F7A7	Centrosomal protein of 57 kDa	1.52e-05	3.88e-02	NA
2. P	Q64EV9	Kinetochore protein Spc25	1.79e-05	2.58e-04	NA
2. P	Q2KI75	Keratin-like protein KRT222	2.86e-05	5.24e-03	NA
2. P	A7TJJ7	SWI5-dependent HO expression protein 3	1.59e-05	2.18e-06	NA
2. P	Q68US1	T-complex protein 10A homolog 1	9.31e-04	1.97e-02	NA
2. P	B1H228	Outer dynein arm-docking complex subunit 1	1.96e-04	1.77e-03	NA
2. P	Q4R7H3	Protein Spindly	3.18e-05	2.91e-04	NA
2. P	B4G5J0	Kinetochore protein Spc25	2.79e-04	9.45e-04	NA
2. P	Q86Z20	Coiled-coil domain-containing protein 125	1.25e-03	7.04e-05	NA
2. P	Q653N3	Microtubule-associated protein 70-3	1.79e-05	3.77e-04	NA
2. P	O60296	Trafficking kinesin-binding protein 2	6.41e-04	5.24e-03	NA
2. P	P0C6M9	Large delta antigen	NA	1.87e-02	NA
2. P	O31700	Sporulation protein cse15	8.74e-07	3.87e-03	NA
2. P	Q4R3X1	5-azacytidine-induced protein 2	5.95e-07	1.97e-12	NA
2. P	Q9BE52	CDK5 regulatory subunit-associated protein 2	1.29e-02	9.22e-05	NA
2. P	C5E4H7	Spindle pole body component SPC42	8.39e-06	8.82e-11	NA
2. P	Q7SXL7	Pre-mRNA-splicing regulator WTAP	1.16e-04	8.68e-04	NA
2. P	Q0P485	Coiled-coil domain-containing protein 85C-A	1.41e-05	4.48e-05	NA
2. P	D3YN49	Geminin coiled-coil domain-containing protein 1	5.49e-03	6.95e-04	NA
2. P	Q9BY27	Protein DGCR6L	2.87e-06	1.83e-03	NA
2. P	Q80U23	Syntaphilin	1.25e-03	2.47e-04	NA
2. P	F7DP49	Deuterosome assembly protein 1	1.38e-05	4.98e-03	NA
2. P	Q9P2B4	CTTNBP2 N-terminal-like protein	4.95e-05	1.36e-02	NA
2. P	F4I878	Protein BRANCHLESS TRICHOME	1.64e-04	7.89e-03	NA
2. P	Q5ZMC9	Nuclear distribution protein nudE homolog 1	2.02e-06	1.05e-03	NA
2. P	Q66H98	Caveolae-associated protein 2	1.24e-03	2.94e-03	NA
2. P	Q9V3V7	Kinetochore protein Spc25	3.96e-05	3.17e-04	NA
2. P	Q7QH62	Mediator of RNA polymerase II transcription subunit 4	4.90e-04	1.08e-03	NA
2. P	C5DLA5	SWI5-dependent HO expression protein 3	4.27e-07	2.93e-07	NA
2. P	Q0D2H9	Putative golgin subfamily A member 8D	1.02e-06	1.11e-02	NA
2. P	Q86XR8	Centrosomal protein of 57 kDa	2.23e-05	1.18e-02	NA
2. P	O46480	Nuclear distribution protein nudE-like 1	2.25e-06	1.09e-04	NA
2. P	Q6ZUS5	Coiled-coil domain-containing protein 121	3.34e-09	5.49e-04	NA
2. P	Q6ZUS6	Coiled-coil domain-containing protein 149	1.50e-05	1.55e-04	NA
2. P	A6NEM1	Golgin subfamily A member 6-like protein 9	1.62e-06	9.07e-03	NA
2. P	Q8BXX9	Coiled-coil domain-containing protein 169	4.35e-06	1.91e-06	NA
2. P	O14128	Probable sphingolipid long chain base-responsive protein pil2	9.67e-03	5.19e-05	NA
2. P	Q08AF8	Putative golgin subfamily A member 8F/8G	4.72e-06	2.53e-02	NA
2. P	O54724	Caveolae-associated protein 1	7.72e-05	4.07e-02	NA
2. P	Q9ER69	Pre-mRNA-splicing regulator WTAP	1.14e-06	1.43e-08	NA
2. P	Q86XG9	Putative neuroblastoma breakpoint family member 5	3.34e-05	2.47e-04	NA
2. P	Q9USP7	Uncharacterized protein C902.06	2.17e-02	7.51e-03	NA
2. P	Q16543	Hsp90 co-chaperone Cdc37	1.13e-03	1.97e-02	NA
2. P	Q8N6Q1	Transmembrane and coiled-coil domain-containing protein 5A	9.71e-09	4.13e-05	NA
2. P	E7KEZ1	Spindle pole body component SPC42	9.30e-06	2.47e-03	NA
2. P	Q10PZ6	Microtubule-associated protein 70-4	4.32e-06	2.96e-08	NA
2. P	Q3KR99	Protein Spindly	1.92e-05	1.57e-02	NA
2. P	Q9FLH0	Protein CROWDED NUCLEI 4	1.97e-03	3.95e-03	NA
2. P	Q6DK98	Nuclear distribution protein nudE-like 1-A	6.01e-06	2.03e-05	NA
2. P	A5E5U9	SWI5-dependent HO expression protein 3	4.79e-06	1.00e-02	NA
2. P	Q4KLT6	Pre-mRNA-splicing regulator WTAP	3.98e-07	5.37e-05	NA
2. P	P0C6M4	Large delta antigen	NA	1.87e-02	NA
2. P	Q8R2H7	Trafficking kinesin-binding protein 2	2.12e-04	2.82e-03	NA
2. P	Q8CGZ2	Afadin- and alpha-actinin-binding protein	7.52e-05	3.14e-04	NA
2. P	Q86VQ0	Lebercilin	1.64e-04	1.72e-04	NA
2. P	A5PJI6	Caveolae-associated protein 4	3.71e-06	1.32e-02	NA
2. P	A7TP22	Biogenesis of lysosome-related organelles complex 1 subunit VAB2	1.43e-03	3.21e-02	NA
2. P	Q3URY2	Geminin coiled-coil domain-containing protein 1	5.20e-03	5.33e-08	NA
2. P	F8WBI6	Golgin subfamily A member 8N	1.30e-04	7.37e-08	NA
2. P	A6NNP5	Coiled-coil domain-containing protein 169	1.07e-06	1.70e-09	NA
2. P	P0C6L4	Large delta antigen	NA	4.55e-03	NA
2. P	A5D8S1	Leucine zipper protein 2	5.77e-07	2.61e-06	NA
2. P	Q3SYW5	5-azacytidine-induced protein 2	9.87e-07	4.88e-11	NA
2. P	Q9QYP6	5-azacytidine-induced protein 2	4.25e-06	4.94e-10	NA
2. P	O95447	Lebercilin-like protein	3.53e-04	5.49e-04	NA
2. P	Q6CQV5	Biogenesis of lysosome-related organelles complex 1 subunit VAB2	2.85e-04	9.75e-05	NA
2. P	Q8BSN3	outer dynein arm-docking complex subunit 3	5.42e-05	2.06e-02	NA
2. P	D3UEM3	SWI5-dependent HO expression protein 3	1.40e-06	1.29e-06	NA
2. P	Q3KPT0	Coiled-coil domain-containing protein 169	1.09e-05	7.15e-06	NA
2. P	Q75AC2	Biogenesis of lysosome-related organelles complex 1 subunit VAB2	7.99e-03	1.24e-02	NA
2. P	O45717	Protein nud-2	2.07e-07	2.40e-08	NA
2. P	A7E3D8	Lebercilin-like protein	1.73e-04	5.56e-03	NA
2. P	Q64EW0	Kinetochore protein Spc25	3.18e-04	2.14e-04	NA
2. P	P29996	Large delta antigen	NA	9.25e-04	NA
2. P	P0C6L3	Small delta antigen	NA	3.95e-02	NA
2. P	Q9ZRT1	Protein gamma response 1	5.68e-05	3.70e-02	NA
2. P	Q4KMA0	5-azacytidine-induced protein 2	3.04e-06	2.18e-08	NA
2. P	Q8C0X0	Lebercilin-like protein	7.85e-05	1.51e-06	NA
2. P	A6NKD9	Coiled-coil domain-containing protein 85C	2.85e-04	1.82e-02	NA
2. P	C7GP31	Spindle pole body component SPC42	1.42e-05	2.47e-03	NA
2. P	Q14BK3	Testis-expressed protein 35	2.87e-03	1.89e-03	NA
2. P	P0C6L9	Large delta antigen	NA	4.55e-03	NA
2. P	Q8N0S2	Synaptonemal complex central element protein 1	5.19e-07	1.19e-05	NA
2. P	A2A6T1	Cerebellar degeneration-related protein 2-like	4.45e-06	3.50e-02	NA
2. P	Q6ZRC1	Uncharacterized protein C4orf50	6.86e-04	2.05e-03	NA
2. P	Q4R7I4	Spermatogenesis-associated protein 24	2.24e-07	1.16e-02	NA
2. P	B5VE90	SWI5-dependent HO expression protein 3	1.35e-06	9.02e-07	NA
2. P	Q84TD8	Protein FLX-like 2	4.32e-07	1.92e-03	NA
2. P	Q4R7J8	Synaptonemal complex central element protein 1	5.22e-08	1.16e-02	NA
2. P	B3LR46	Spindle pole body component SPC42	5.62e-05	2.47e-03	NA
2. P	Q32L17	Spermatogenic leucine zipper protein 1	2.94e-06	1.83e-03	NA
2. P	Q63918	Caveolae-associated protein 2	4.70e-04	8.05e-03	NA
2. P	P97817	Cerebellar degeneration-related protein 2	5.22e-06	1.30e-04	NA
2. P	F4HRT5	Protein CROWDED NUCLEI 1	8.48e-03	1.38e-03	NA
2. P	Q6NRK1	Afadin- and alpha-actinin-binding protein A	4.31e-05	8.53e-06	NA
2. P	A6NCL1	Geminin coiled-coil domain-containing protein 1	3.47e-03	6.20e-06	NA
2. P	P38272	SWI5-dependent HO expression protein 3	2.33e-05	2.22e-07	NA
2. P	Q803Q2	Nuclear distribution protein nudE-like 1-B	8.76e-06	1.96e-05	NA
2. P	Q9U2T3	Uncharacterized protein Y116A8C.11	4.56e-09	6.73e-04	NA
2. P	Q8BGY3	Leucine zipper protein 2	4.59e-07	1.05e-08	NA
2. P	A4FV37	Caveolae-associated protein 3	1.35e-04	3.95e-03	NA
2. P	O54818	Tumor protein D53	1.67e-03	4.23e-02	NA
2. P	A6NMD2	Golgin subfamily A member 8J	1.66e-04	3.82e-05	NA
2. P	Q06568	Nuclear distribution protein nudE homolog 1	6.66e-05	4.33e-08	NA
2. P	B1PRL5	Caveolae-associated protein 4	5.45e-06	2.42e-03	NA
2. P	Q6NRX3	Afadin- and alpha-actinin-binding protein B	7.14e-05	2.32e-06	NA
2. P	Q9C9X0	Microtubule-associated protein 70-1	1.91e-05	5.79e-03	NA
2. P	Q86TE4	Leucine zipper protein 2	9.05e-09	6.23e-08	NA
2. P	Q9D9D5	Transmembrane and coiled-coil domain-containing protein 5A	5.13e-08	4.60e-02	NA
2. P	Q9GZM8	Nuclear distribution protein nudE-like 1	1.11e-06	1.98e-04	NA
2. P	B4M3W0	Kinetochore protein Spc25	2.82e-04	1.18e-04	NA
2. P	H3BQL2	Golgin subfamily A member 8T	1.15e-03	1.08e-04	NA
2. P	Q6CM22	Mediator of RNA polymerase II transcription subunit 8	1.81e-03	6.28e-03	NA
2. P	Q4V7B0	Cilia- and flagella-associated protein 157	1.29e-05	9.35e-04	NA
2. P	Q9ES39	Nuclear distribution protein nudE homolog 1	3.64e-06	4.29e-04	NA
2. P	Q6C2T8	DASH complex subunit DAM1	2.02e-03	2.39e-04	NA
2. P	Q14129	Protein DGCR6	8.82e-06	1.40e-02	NA
2. P	Q7ZWE6	Dysbindin-A	4.28e-06	3.95e-02	NA
2. P	Q9LQU7	Microtubule-associated protein 70-4	3.00e-05	9.75e-04	NA
2. P	O74960	Probable sphingolipid long chain base-responsive protein pil1	3.00e-03	7.49e-04	NA
2. P	B5DF41	Syntaphilin	2.03e-03	4.46e-03	NA
2. P	Q7FAD5	Synaptonemal complex protein ZEP1	5.51e-04	1.05e-03	NA
2. P	M1V4Y8	Cilia- and flagella-associated protein 73	6.12e-07	3.22e-03	NA
2. P	Q66JL0	Nuclear distribution protein nudE homolog 1	2.44e-06	2.13e-03	NA
2. P	A7E2F4	Golgin subfamily A member 8A	6.21e-04	5.84e-06	NA
2. P	Q9C9N6	Protein PLASTID MOVEMENT IMPAIRED 2	3.86e-05	3.03e-02	NA
2. P	Q8R0J7	Vacuolar protein sorting-associated protein 37B	4.78e-04	3.60e-02	NA
2. P	Q9V9Y9	Protein spindle-F	1.16e-03	1.56e-02	NA
2. P	Q810I0	Vacuolar protein sorting-associated protein 37D	7.98e-05	2.52e-04	NA
2. P	Q923A2	Protein Spindly	5.63e-05	6.15e-03	NA
2. P	D3ZUQ0	RILP-like protein 1	4.88e-05	1.48e-02	NA
2. P	Q06813	Uncharacterized protein YPR078C	5.97e-03	4.15e-03	NA
2. P	A2IDD5	Coiled-coil domain-containing protein 78	5.27e-05	6.15e-05	NA
2. P	H3BV12	Golgin subfamily A member 8Q	3.01e-05	4.80e-08	NA
2. P	Q9ZUA3	Microtubule-associated protein 70-3	1.02e-04	1.96e-03	NA
2. P	Q15007	Pre-mRNA-splicing regulator WTAP	4.23e-06	1.17e-07	NA
2. P	A6ZL74	SWI5-dependent HO expression protein 3	3.61e-06	1.01e-06	NA
2. P	Q64EW2	Kinetochore protein Spc25	2.83e-04	3.40e-02	NA
2. P	H3BPF8	Golgin subfamily A member 8S	9.98e-06	5.25e-06	NA
2. P	Q561Q8	Mediator of RNA polymerase II transcription subunit 4	4.83e-04	9.16e-04	NA
2. P	E7NK16	Spindle pole body component SPC42	6.00e-05	5.56e-03	NA
2. P	F4IMQ0	Protein FLC EXPRESSOR	1.79e-07	8.84e-06	NA
2. P	Q8N1A0	Keratin-like protein KRT222	2.60e-05	4.64e-02	NA
2. P	C5DUI8	SWI5-dependent HO expression protein 3	8.59e-06	1.43e-05	NA
2. P	Q9I8F4	Tumor protein D53 homolog	3.33e-03	3.33e-02	NA
2. P	Q8VDN4	Coiled-coil domain-containing protein 92	2.94e-05	4.74e-05	NA
2. P	O95810	Caveolae-associated protein 2	1.62e-02	1.77e-02	NA
2. P	Q6FMH8	SWI5-dependent HO expression protein 3	4.02e-06	1.72e-02	NA
2. P	Q4V872	Coiled-coil domain-containing protein 85C	1.29e-04	9.32e-05	NA
2. P	Q8VC66	Afadin- and alpha-actinin-binding protein	6.93e-05	8.32e-04	NA
2. P	Q8CEE0	Centrosomal protein of 57 kDa	2.10e-04	2.43e-02	NA
2. P	Q86XT2	Vacuolar protein sorting-associated protein 37D	6.60e-05	2.00e-04	NA
2. P	O15079	Syntaphilin	1.15e-03	2.81e-02	NA
2. P	Q9CZA6	Nuclear distribution protein nudE homolog 1	4.77e-06	1.38e-04	NA
2. P	P0C6M2	Large delta antigen	NA	3.50e-02	NA
2. P	Q01850	Cerebellar degeneration-related protein 2	5.13e-05	5.15e-04	NA
2. P	Q9Y592	Centrosomal protein of 83 kDa	2.34e-04	4.31e-02	NA
2. P	Q80ST9	Lebercilin	1.74e-04	2.81e-02	NA
2. P	Q9Z1H9	Caveolae-associated protein 3	2.15e-04	1.51e-02	NA
2. P	Q17QG3	RILP-like protein 1	4.52e-05	1.83e-04	NA
2. P	P0CJ92	Golgin subfamily A member 8H	4.79e-05	4.33e-05	NA
2. P	Q6C5P0	Mediator of RNA polymerase II transcription subunit 10	5.10e-04	2.27e-03	NA
2. P	Q9NQZ6	Zinc finger C4H2 domain-containing protein	1.31e-05	3.84e-02	NA
2. P	A8MT33	Synaptonemal complex central element protein 1-like	1.26e-07	3.22e-03	NA
2. P	Q9D083	Kinetochore protein Spc24	2.55e-06	1.94e-04	NA
2. P	B4HGE0	Kinetochore protein Spc25	6.02e-05	1.08e-02	NA
3. B	Q9JJB1	Transmembrane protein 191C	6.48e-08	NA	8.50e-04