Summary
A0A1B0GU71
Homolog: B2RV13.
Function: Sperm axonemal maintenance protein CFAP97D1.
Statistics
Total GO Annotation: 12
Unique PROST Go: 11
Unique BLAST Go: 0
Total Homologs: 9
Unique PROST Homologs: 5
Unique BLAST Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
B2RV13
(Sperm axonemal maintenance protein CFAP97D1) with a FATCAT P-Value: 4.82e-06 and RMSD of 2.68 angstrom. The sequence alignment identity is 21.1%.
Structural alignment shown in left. Query protein A0A1B0GU71 colored as red in alignment, homolog B2RV13 colored as blue.
Query protein A0A1B0GU71 is also shown in right top, homolog B2RV13 showed in right bottom. They are colored based on secondary structures.
A0A1B0GU71 MHGA-PRLTFPC-ASEYLWH-----AREK----AYQDHRRKVQSAQPLVDTRAPL--TFRHLHLKLKRLKLEEERLSVIERDNRLLLEKVASVMRTRG-- 85 B2RV13 MNNSLDYLAYPVIVSN---HRQSTTFRKKLDFGHYVSHKNRIQIAKPTVDTKPPVAHT-NHI-LKLSKLQGEQKKINKIEYENKQLCQKIANA--HRGPA 93 A0A1B0GU71 QTD------SKN-NSKHRRK--------------------------------------------------- 98 B2RV13 KVDCWNEYFSKSLNRETRNRELVRITMENQGILKRLVDRKPHYDRRASEIDWQNSRRYIRNTTRYLLSQNE 164
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0007288 | sperm axoneme assembly |
| 2. P | GO:0008017 | microtubule binding |
| 2. P | GO:0007218 | neuropeptide signaling pathway |
| 2. P | GO:0016239 | positive regulation of macroautophagy |
| 2. P | GO:0061564 | axon development |
| 2. P | GO:0006508 | proteolysis |
| 2. P | GO:0000139 | Golgi membrane |
| 2. P | GO:0005179 | hormone activity |
| 2. P | GO:0005576 | extracellular region |
| 2. P | GO:0061635 | regulation of protein complex stability |
| 2. P | GO:1905048 | regulation of metallopeptidase activity |
| 2. P | GO:0005856 | cytoskeleton |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q9DAN9 | Sperm axonemal maintenance protein CFAP97D1 | 5.86e-06 | 1.25e-03 | 2.72e-08 |
| 1. PB | G3UW36 | Uncharacterized protein CFAP97D2 | 4.41e-08 | 9.78e-37 | 4.22e-37 |
| 1. PB | A0A1B0GU71 | Uncharacterized protein CFAP97D2 | 0 | 1.21e-141 | 5.56e-68 |
| 1. PB | B2RV13 | Sperm axonemal maintenance protein CFAP97D1 | 4.82e-06 | 2.28e-04 | 3.38e-07 |
| 2. P | C0HKT5 | Diuretic hormone 45 (Fragment) | 9.97e-03 | 4.78e-03 | NA |
| 2. P | Q08BG7 | Short coiled-coil protein A | 7.64e-04 | 6.65e-04 | NA |
| 2. P | Q9LZX5 | Protein LITTLE ZIPPER 2 | 3.00e-04 | 1.77e-07 | NA |
| 2. P | P0CT51 | Blood-induced peptide 1 | 2.11e-03 | 2.59e-02 | NA |
| 2. P | B5FZ42 | Small vasohibin-binding protein | 2.37e-02 | 1.24e-02 | NA |