Summary

A0A1B0GU71

Homolog: B2RV13.
Function: Sperm axonemal maintenance protein CFAP97D1.

Statistics

Total GO Annotation: 12
Unique PROST Go: 11
Unique BLAST Go: 0

Total Homologs: 9
Unique PROST Homologs: 5
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was B2RV13 (Sperm axonemal maintenance protein CFAP97D1) with a FATCAT P-Value: 4.82e-06 and RMSD of 2.68 angstrom. The sequence alignment identity is 21.1%.
Structural alignment shown in left. Query protein A0A1B0GU71 colored as red in alignment, homolog B2RV13 colored as blue. Query protein A0A1B0GU71 is also shown in right top, homolog B2RV13 showed in right bottom. They are colored based on secondary structures. 

  A0A1B0GU71 MHGA-PRLTFPC-ASEYLWH-----AREK----AYQDHRRKVQSAQPLVDTRAPL--TFRHLHLKLKRLKLEEERLSVIERDNRLLLEKVASVMRTRG-- 85
      B2RV13 MNNSLDYLAYPVIVSN---HRQSTTFRKKLDFGHYVSHKNRIQIAKPTVDTKPPVAHT-NHI-LKLSKLQGEQKKINKIEYENKQLCQKIANA--HRGPA 93

  A0A1B0GU71 QTD------SKN-NSKHRRK--------------------------------------------------- 98
      B2RV13 KVDCWNEYFSKSLNRETRNRELVRITMENQGILKRLVDRKPHYDRRASEIDWQNSRRYIRNTTRYLLSQNE 164

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0007288 sperm axoneme assembly
2. P GO:0008017 microtubule binding
2. P GO:0007218 neuropeptide signaling pathway
2. P GO:0016239 positive regulation of macroautophagy
2. P GO:0061564 axon development
2. P GO:0006508 proteolysis
2. P GO:0000139 Golgi membrane
2. P GO:0005179 hormone activity
2. P GO:0005576 extracellular region
2. P GO:0061635 regulation of protein complex stability
2. P GO:1905048 regulation of metallopeptidase activity
2. P GO:0005856 cytoskeleton

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q9DAN9 Sperm axonemal maintenance protein CFAP97D1 5.86e-06 1.25e-03 2.72e-08
1. PB G3UW36 Uncharacterized protein CFAP97D2 4.41e-08 9.78e-37 4.22e-37
1. PB A0A1B0GU71 Uncharacterized protein CFAP97D2 0 1.21e-141 5.56e-68
1. PB B2RV13 Sperm axonemal maintenance protein CFAP97D1 4.82e-06 2.28e-04 3.38e-07
2. P C0HKT5 Diuretic hormone 45 (Fragment) 9.97e-03 4.78e-03 NA
2. P Q08BG7 Short coiled-coil protein A 7.64e-04 6.65e-04 NA
2. P Q9LZX5 Protein LITTLE ZIPPER 2 3.00e-04 1.77e-07 NA
2. P P0CT51 Blood-induced peptide 1 2.11e-03 2.59e-02 NA
2. P B5FZ42 Small vasohibin-binding protein 2.37e-02 1.24e-02 NA