Summary

A0A1B0GUA6

Homolog: Q80VY2.
Function: PAK4-inhibitor INKA2.

Statistics

Total GO Annotation: 71
Unique PROST Go: 71
Unique BLAST Go: 0

Total Homologs: 31
Unique PROST Homologs: 30
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q80VY2 (PAK4-inhibitor INKA2) with a FATCAT P-Value: 0.00497 and RMSD of 3.09 angstrom. The sequence alignment identity is 24.2%.
Structural alignment shown in left. Query protein A0A1B0GUA6 colored as red in alignment, homolog Q80VY2 colored as blue. Query protein A0A1B0GUA6 is also shown in right top, homolog Q80VY2 showed in right bottom. They are colored based on secondary structures. 

  A0A1B0GUA6 -------MEADIQLMRLIQE---MRAEI-HKL-EKEN---QALR-MKL----TASSQ-RASGSGR------ESGDEREEEAP---GQ-SPATLQG-AVST 68
      Q80VY2 MTKESKDM--DCYLRRLKQELMSMK-EVGDGLQDQMNCMMGALQELKLLQVQTALEQLEISG-GTPTFSCPESSQE-QPECPRWQGSGGPA---GPAAWT 92

  A0A1B0GUA6 -------DAAPAVQEHQ---GN-VMIVRRYSI---SSSVCSSA----VN-DPWKS-----GKSH-P----KS------G--I----LE--GQR--TLKSL 123
      Q80VY2 SSSQPSFDSSPKLPCRRSVCGKELAVLPKTQLPEEHQS-CTQQGTEWVEPDDWTSTLMSRGRNRQPLVLGDNVFADLVGNWLDLPELEKGGEKGETGGSI 191

  A0A1B0GUA6 ACSPIK--K-QDME--EKVFATDSLTSN--RTSQRA-SPEHVCGCRDK-TKAV-SFLLPM---DMSSYSK--NSSSL-KHS---PNQATNQLSIIAE--- 201
      Q80VY2 E--P-KGEKGQSRELGRK-FA---LTANIFRKFLRSVRPD-----RDRLLKEKPGWMTPMVSESRAGRSKKVKKRSLSKGSGRFPFSSTGEPRHI-ETPA 278

  A0A1B0GUA6 ---------------------- 201
      Q80VY2 TSSPKALEPSCRGFDINTAVWV 300

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:2000575 obsolete negative regulation of microtubule motor activity
2. P GO:0010369 chromocenter
2. P GO:0034763 negative regulation of transmembrane transport
2. P GO:0008608 attachment of spindle microtubules to kinetochore
2. P GO:0006605 protein targeting
2. P GO:0007080 mitotic metaphase plate congression
2. P GO:0015629 actin cytoskeleton
2. P GO:0048311 mitochondrion distribution
2. P GO:0043011 myeloid dendritic cell differentiation
2. P GO:0047496 vesicle transport along microtubule
2. P GO:0006338 chromatin remodeling
2. P GO:0044295 axonal growth cone
2. P GO:0005102 signaling receptor binding
2. P GO:0030291 protein serine/threonine kinase inhibitor activity
2. P GO:0000022 mitotic spindle elongation
2. P GO:0006836 neurotransmitter transport
2. P GO:0051721 protein phosphatase 2A binding
2. P GO:0072686 mitotic spindle
2. P GO:0045448 mitotic cell cycle, embryonic
2. P GO:0071931 positive regulation of transcription involved in G1/S transition of mitotic cell cycle
2. P GO:0030027 lamellipodium
2. P GO:0045171 intercellular bridge
2. P GO:0019894 kinesin binding
2. P GO:0030425 dendrite
2. P GO:0005634 nucleus
2. P GO:1990385 meiotic spindle midzone
2. P GO:0022008 neurogenesis
2. P GO:0051685 maintenance of ER location
2. P GO:0051987 positive regulation of attachment of spindle microtubules to kinetochore
2. P GO:0098972 anterograde dendritic transport of mitochondrion
2. P GO:0060303 regulation of nucleosome density
2. P GO:0031410 cytoplasmic vesicle
2. P GO:0044732 mitotic spindle pole body
2. P GO:0000070 mitotic sister chromatid segregation
2. P GO:0019899 enzyme binding
2. P GO:0016572 histone phosphorylation
2. P GO:0016591 RNA polymerase II, holoenzyme
2. P GO:0031116 positive regulation of microtubule polymerization
2. P GO:0051301 cell division
2. P GO:0032839 dendrite cytoplasm
2. P GO:0005665 RNA polymerase II, core complex
2. P GO:0000775 chromosome, centromeric region
2. P GO:0006357 regulation of transcription by RNA polymerase II
2. P GO:0005769 early endosome
2. P GO:0019901 protein kinase binding
2. P GO:0043025 neuronal cell body
2. P GO:1904115 axon cytoplasm
2. P GO:0042729 DASH complex
2. P GO:0039702 viral budding via host ESCRT complex
2. P GO:0050811 GABA receptor binding
2. P GO:0098957 anterograde axonal transport of mitochondrion
2. P GO:0098939 dendritic transport of mitochondrion
2. P GO:0051276 chromosome organization
2. P GO:0010506 regulation of autophagy
2. P GO:0006470 protein dephosphorylation
2. P GO:0031011 Ino80 complex
2. P GO:0048813 dendrite morphogenesis
2. P GO:0005880 nuclear microtubule
2. P GO:0017022 myosin binding
2. P GO:0043044
2. P GO:0030911 TPR domain binding
2. P GO:0042832 defense response to protozoan
2. P GO:0008333 endosome to lysosome transport
2. P GO:0051233 spindle midzone
2. P GO:0032410 negative regulation of transporter activity
2. P GO:1903097 regulation of CENP-A containing nucleosome assembly
2. P GO:0005730 nucleolus
2. P GO:0032133 chromosome passenger complex
2. P GO:0050771 negative regulation of axonogenesis
2. P GO:0006493 protein O-linked glycosylation
2. P GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A0A1B0GUA6 Putative coiled-coil domain-containing protein 195 0 4.07e-142 6.20e-149
2. P P86346 Borealin 2.35e-02 9.29e-03 NA
2. P P35734 DASH complex subunit ASK1 2.79e-02 8.79e-03 NA
2. P Q8NBZ0 INO80 complex subunit E 1.12e-02 1.31e-05 NA
2. P Q80VY2 PAK4-inhibitor INKA2 4.97e-03 1.10e-10 NA
2. P A6QP24 PAK4-inhibitor INKA2 1.77e-02 2.34e-07 NA
2. P Q99LJ0 CTTNBP2 N-terminal-like protein 1.91e-01 8.38e-03 NA
2. P Q9NTI7 PAK4-inhibitor INKA2 1.15e-01 9.65e-11 NA
2. P Q9P2B4 CTTNBP2 N-terminal-like protein 9.55e-02 6.03e-03 NA
2. P P06937 Gag polyprotein (Fragment) NA 3.29e-02 NA
2. P A7LKB2 PAK4-inhibitor inka1 1.62e-02 2.45e-03 NA
2. P Q6ZRC1 Uncharacterized protein C4orf50 4.82e-02 2.22e-03 NA
2. P Q8R1H8 Basic leucine zipper transcriptional factor ATF-like 2 7.36e-03 1.49e-02 NA
2. P A6ZZR4 DASH complex subunit ASK1 1.46e-02 1.25e-02 NA
2. P Q6AYH2 INO80 complex subunit E 4.97e-03 1.68e-04 NA
2. P O60296 Trafficking kinesin-binding protein 2 3.63e-01 2.25e-02 NA
2. P O94704 INO80 complex subunit 3 6.72e-03 1.55e-02 NA
2. P P84447 Uncharacterized gene 59 protein NA 3.41e-02 NA
2. P Q5BDI1 Shugoshin 5.22e-02 1.79e-02 NA
2. P P86345 Borealin-2 3.39e-01 1.47e-03 NA
2. P Q6FUD9 Mitotic spindle-associated protein SHE1 1.96e-01 1.03e-04 NA
2. P Q8K2F3 Protein DEPP1 1.10e-01 1.91e-02 NA
2. P P0CAP2 DNA-directed RNA polymerase II subunit GRINL1A 4.29e-02 1.40e-03 NA
2. P Q9VLD6 Borealin 9.74e-02 2.36e-02 NA
2. P Q5RDH2 CTTNBP2 N-terminal-like protein 7.35e-02 8.79e-03 NA
2. P Q5REC6 DNA-directed RNA polymerase II subunit GRINL1A 9.90e-02 7.19e-04 NA
2. P Q29RS4 INO80 complex subunit E 8.72e-03 1.84e-06 NA
2. P Q8BHX3 Borealin 8.52e-02 6.75e-03 NA
2. P P28983 Uncharacterized gene 59 protein NA 3.41e-02 NA
2. P Q8R2H7 Trafficking kinesin-binding protein 2 2.15e-01 1.11e-02 NA
2. P O02761 Proto-oncogene c-Fos (Fragment) 6.68e-03 2.79e-04 NA