Summary

A0A1B0GUJ8

Homolog: Q8VHZ4.
Function: Paraneoplastic antigen Ma1 homolog.

Statistics

Total GO Annotation: 65
Unique PROST Go: 47
Unique BLAST Go: 16

Total Homologs: 64
Unique PROST Homologs: 36
Unique BLAST Homologs: 27

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q8VHZ4 (Paraneoplastic antigen Ma1 homolog) with a FATCAT P-Value: 6.75e-08 and RMSD of 1.24 angstrom. The sequence alignment identity is 21.7%.
Structural alignment shown in left. Query protein A0A1B0GUJ8 colored as red in alignment, homolog Q8VHZ4 colored as blue. Query protein A0A1B0GUJ8 is also shown in right top, homolog Q8VHZ4 showed in right bottom. They are colored based on secondary structures. 

  A0A1B0GUJ8 MLFGVKDIALLEHGCKALEVDSYKSLMILGIPEDCNHEEFEEIIRLPLKPLGKFEVAGKAYLEEDKSKAAIIQLTEDINYAVVPREIKGKGGVWRVVYMP 100
      Q8VHZ4 MA-----MTLLEDWCRGMDVNSQRALLVWGIPVNCDETEIEETLQAAM-PQVSYRVLGRMFWREENAKAALLELTGTVDYSLIPREMPGKGGLWKVVFKP 94

  A0A1B0GUJ8 RKQDIEFLTKLNLFLQSEGRTVEDMARVL--RQELCP-PATGPRELPARKC-----SV--PGLGE----KPEAGATV--QMDVVP-P----LDSSEKESK 179
      Q8VHZ4 PTSDAEFLERLHLFLAREGWTVQDVARVLGFQN---PAPAPGP-EMPAEMLNYILDNVIQP-LVESIWYKK---LTLFSGRD-IPGPGEETFDSWLEHSN 185

  A0A1B0GUJ8 AGVGKRGKRKN-KKNRR-----RHHASDK-KL-------------------------------------------------------------------- 204
      Q8VHZ4 E-VIEEWQVSDIEKRRRLMESLRGPAADVIRILKTNNPAITTAECLKALEQVFGSVESSRDAQVRFLNTYQNPGEKLSSYVIRLEPLLQKVVDKGAIDKD 284

  A0A1B0GUJ8 --------------------------------------------------------------------- 204
      Q8VHZ4 NVNQARLEQVIAGANHSGALRRQLWLTGATEGPAPNLFQLLVQIREEEAKEEEEEAEAALLQLGLEGHF 353

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0005730 nucleolus
1. PB GO:0005654 nucleoplasm
2. P GO:0005844 polysome
2. P GO:0016973 poly(A)+ mRNA export from nucleus
2. P GO:0033173 calcineurin-NFAT signaling cascade
2. P GO:0000394 RNA splicing, via endonucleolytic cleavage and ligation
2. P GO:0051028 mRNA transport
2. P GO:0000398 mRNA splicing, via spliceosome
2. P GO:0031987 locomotion involved in locomotory behavior
2. P GO:0017069 snRNA binding
2. P GO:0005846 nuclear cap binding complex
2. P GO:0005686 U2 snRNP
2. P GO:0000245 spliceosomal complex assembly
2. P GO:0019722 calcium-mediated signaling
2. P GO:0000339 RNA cap binding
2. P GO:0007614 short-term memory
2. P GO:0005689 U12-type spliceosomal complex
2. P GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0032545 CURI complex
2. P GO:0000794 condensed nuclear chromosome
2. P GO:0007219 Notch signaling pathway
2. P GO:0045727 positive regulation of translation
2. P GO:0003729 mRNA binding
2. P GO:0045292 mRNA cis splicing, via spliceosome
2. P GO:0030346 protein phosphatase 2B binding
2. P GO:0000243 commitment complex
2. P GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0019058 viral life cycle
2. P GO:0045171 intercellular bridge
2. P GO:0021522 spinal cord motor neuron differentiation
2. P GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
2. P GO:0008597 calcium-dependent protein serine/threonine phosphatase regulator activity
2. P GO:0035145 exon-exon junction complex
2. P GO:0005634 nucleus
2. P GO:0000340 RNA 7-methylguanosine cap binding
2. P GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0016070 RNA metabolic process
2. P GO:0034462 small-subunit processome assembly
2. P GO:0006979 response to oxidative stress
2. P GO:0071011 precatalytic spliceosome
2. P GO:0003723 RNA binding
2. P GO:0005845 mRNA cap binding complex
2. P GO:0034456 UTP-C complex
2. P GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0009303 rRNA transcription
2. P GO:0031053 primary miRNA processing
2. P GO:0051607 defense response to virus
2. P GO:0070478 nuclear-transcribed mRNA catabolic process, 3'-5' exonucleolytic nonsense-mediated decay
2. P GO:0016072 rRNA metabolic process
3. B GO:0090200 positive regulation of release of cytochrome c from mitochondria
3. B GO:0005813 centrosome
3. B GO:0007088 regulation of mitotic nuclear division
3. B GO:0005829 cytosol
3. B GO:0097190 apoptotic signaling pathway
3. B GO:0097192 extrinsic apoptotic signaling pathway in absence of ligand
3. B GO:0002437 inflammatory response to antigenic stimulus
3. B GO:0000226 microtubule cytoskeleton organization
3. B GO:0031625 ubiquitin protein ligase binding
3. B GO:0008625 extrinsic apoptotic signaling pathway via death domain receptors
3. B GO:0005741 mitochondrial outer membrane
3. B GO:1990393 3M complex
3. B GO:0042981 regulation of apoptotic process
3. B GO:0001844 protein insertion into mitochondrial membrane involved in apoptotic signaling pathway
3. B GO:0008630 intrinsic apoptotic signaling pathway in response to DNA damage
3. B GO:0043065 positive regulation of apoptotic process

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A0A1B0GUJ8 Paraneoplastic antigen-like protein 8C 0 6.19e-144 2.94e-149
2. P Q66J99 Probable RNA-binding protein 18 2.72e-02 2.23e-05 NA
2. P Q3ZCC5 Probable RNA-binding protein 18 1.69e-02 1.17e-04 NA
2. P Q9P383 Nuclear cap-binding protein subunit 2 6.61e-02 7.27e-04 NA
2. P Q9BYG3 MKI67 FHA domain-interacting nucleolar phosphoprotein 4.12e-02 4.13e-03 NA
2. P O74460 Uncharacterized protein C16C4.16c 3.60e-02 5.56e-11 NA
2. P Q5RL73 RNA-binding protein 48 3.64e-02 3.15e-02 NA
2. P Q6GL69 MKI67 FHA domain-interacting nucleolar phosphoprotein-like 1.53e-02 1.13e-02 NA
2. P Q5RJM0 MKI67 FHA domain-interacting nucleolar phosphoprotein 7.85e-03 2.36e-05 NA
2. P Q9XFD1 Nuclear cap-binding protein subunit 2 3.65e-02 1.67e-03 NA
2. P Q23314 Ribosomal RNA-processing protein 7 homolog 7.17e-02 2.02e-02 NA
2. P Q10355 Uncharacterized RNA-binding protein C22E12.02 1.07e-01 3.32e-06 NA
2. P Q96H35 Probable RNA-binding protein 18 3.41e-02 4.56e-05 NA
2. P Q7SYS2 MKI67 FHA domain-interacting nucleolar phosphoprotein-like 7.41e-03 3.25e-04 NA
2. P Q08920 Nuclear cap-binding protein subunit 2 3.74e-02 8.83e-03 NA
2. P Q9CR83 Probable RNA-binding protein 18 1.39e-02 5.93e-05 NA
2. P Q1LZH0 U11/U12 small nuclear ribonucleoprotein 35 kDa protein 1.33e-02 6.95e-03 NA
2. P Q3SZM1 MKI67 FHA domain-interacting nucleolar phosphoprotein 7.03e-02 4.01e-03 NA
2. P Q8JIY8 MKI67 FHA domain-interacting nucleolar phosphoprotein 5.40e-03 4.96e-02 NA
2. P Q148M8 Activator of basal transcription 1 2.73e-02 1.15e-02 NA
2. P O94290 U2 snRNP component ist3 1.37e-02 1.73e-06 NA
2. P Q9JHG2 Calcipressin-2 4.66e-02 3.71e-03 NA
2. P Q4KMD3 U11/U12 small nuclear ribonucleoprotein 35 kDa protein 4.23e-02 1.25e-02 NA
2. P Q10B98 Zinc finger CCCH domain-containing protein 25 1.84e-02 2.16e-03 NA
2. P P48412 Nonsense-mediated mRNA decay protein 3 4.97e-02 3.78e-02 NA
2. P Q84L14 Nuclear cap-binding protein subunit 2 1.92e-02 9.77e-04 NA
2. P Q6PBM8 Probable RNA-binding protein 18 2.37e-02 1.09e-06 NA
2. P Q5R6W3 Probable RNA-binding protein 18 3.19e-02 4.56e-05 NA
2. P Q10267 Nonsense-mediated mRNA decay protein 3 4.01e-03 3.77e-06 NA
2. P P36054 Calcipressin-like protein 3.20e-01 5.24e-04 NA
2. P Q8CH27 Calcipressin-2 6.04e-02 4.25e-03 NA
2. P C5DZ92 RNA annealing protein YRA2 2.71e-02 3.03e-02 NA
2. P O42847 Uncharacterized RNA-binding protein C23A1.09 5.94e-03 3.45e-02 NA
2. P Q54KR9 Nuclear cap-binding protein subunit 2 4.77e-03 1.99e-07 NA
2. P Q76635 Virion infectivity factor NA 1.14e-03 NA
2. P Q6FNF9 RNA annealing protein YRA2 1.75e-02 1.38e-02 NA
2. P Q754W7 Nuclear cap-binding protein subunit 2 8.74e-03 8.83e-04 NA
3. B Q95KI4 Modulator of apoptosis 1 4.38e-07 NA 3.24e-27
3. B P62521 Coiled-coil domain-containing protein 8 1.83e-01 NA 3.43e-13
3. B Q8ND90 Paraneoplastic antigen Ma1 9.89e-07 NA 1.60e-32
3. B Q5DTT8 Paraneoplastic antigen-like protein 5 7.81e-04 NA 4.18e-23
3. B Q8VHZ4 Paraneoplastic antigen Ma1 homolog 6.75e-08 NA 1.39e-33
3. B Q9UL42 Paraneoplastic antigen Ma2 8.43e-07 NA 8.91e-35
3. B Q9GMU3 Paraneoplastic antigen Ma2 homolog 9.25e-07 NA 1.55e-33
3. B A7E321 Paraneoplastic antigen-like protein 8A 7.05e-05 NA 1.09e-31
3. B A0A0J9YX94 Paraneoplastic antigen Ma6F 2.54e-04 NA 4.08e-22
3. B Q9H0W5 Coiled-coil domain-containing protein 8 2.14e-01 NA 3.29e-13
3. B Q9ERH6 Modulator of apoptosis 1 2.17e-06 NA 1.96e-24
3. B A6QLK5 Paraneoplastic antigen Ma1 homolog 8.40e-07 NA 2.17e-34
3. B Q8BHK0 Paraneoplastic antigen Ma2 homolog 6.15e-06 NA 2.62e-34
3. B Q5R486 Paraneoplastic antigen Ma2 homolog 1.16e-06 NA 7.17e-33
3. B Q96PV4 Paraneoplastic antigen-like protein 5 1.09e-04 NA 1.37e-31
3. B Q86V59 Paraneoplastic antigen-like protein 8A 2.82e-05 NA 2.47e-34
3. B Q2KIT6 Paraneoplastic antigen Ma2 homolog 8.88e-07 NA 1.80e-35
3. B A0A0J9YXQ4 Paraneoplastic antigen Ma6E 7.27e-03 NA 1.17e-22
3. B Q96BY2 Modulator of apoptosis 1 4.69e-07 NA 5.61e-27
3. B Q5R6R8 Paraneoplastic antigen-like protein 8A 6.06e-05 NA 3.17e-34
3. B Q9UL41 Paraneoplastic antigen Ma3 2.02e-05 NA 2.93e-33
3. B Q80VM8 Paraneoplastic antigen-like protein 8A 9.86e-05 NA 2.06e-31
3. B P0CW24 Paraneoplastic antigen-like protein 6A 1.06e-07 NA 1.81e-30
3. B Q9ULN7 Paraneoplastic antigen-like protein 8B 1.82e-04 NA 2.85e-24
3. B Q8C1C8 Paraneoplastic antigen Ma1 homolog 7.81e-06 NA 2.31e-32
3. B D3YZV8 Coiled-coil domain-containing protein 8 homolog 2.26e-01 NA 2.83e-13
3. B Q8JZW8 Paraneoplastic antigen Ma3 homolog 2.06e-04 NA 2.23e-33