Summary
A0A1B0GUX0
Homolog: B9EJX3.
Function: Protein ATP6V1FNB.
Statistics
Total GO Annotation: 37
Unique PROST Go: 0
Unique BLAST Go: 37
Total Homologs: 3
Unique PROST Homologs: 0
Unique BLAST Homologs: 1
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
B9EJX3
(Protein ATP6V1FNB) with a FATCAT P-Value: 3.66e-11 and RMSD of 3.10 angstrom. The sequence alignment identity is 81.5%.
Structural alignment shown in left. Query protein A0A1B0GUX0 colored as red in alignment, homolog B9EJX3 colored as blue.
Query protein A0A1B0GUX0 is also shown in right top, homolog B9EJX3 showed in right bottom. They are colored based on secondary structures.
A0A1B0GUX0 MSRQLNIDALRQNFWKEEYLREKMLRCEWYRKYGSMVKAKQKAKAAARLPLKLPTLHPKAPLS-PPPAPKSAPSKVPSPVPEAP-FQSEMYPVPPITRAL 98 B9EJX3 MSRQLNMDTLRQNFWKEEYLKEMMLRYEWQRKYGTLVKAKQKAKAASRLPRKLPTLLPQASVAPPPPASKTTPSKAPSPAPE-PLFLSDMYPVAPNTKAL 99 A0A1B0GUX0 LYEGISHDFQGRYRYLNTRKLDMPETRYLFPITTSFTYGWQLGPPVKQELVSCKMCRIESFFRKNGAFALLDPRDLAL 176 B9EJX3 LYEGISHDLQGRYQYLNTRKLDLPETRYLFPITTNFTYGWQLGPPTKQELVSCKMCRIESFFRKNGAFALLDPRDLAL 177
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 3. B | GO:0022407 | regulation of cell-cell adhesion |
| 3. B | GO:2000309 | positive regulation of tumor necrosis factor (ligand) superfamily member 11 production |
| 3. B | GO:0071133 | alpha9-beta1 integrin-ADAM8 complex |
| 3. B | GO:0045780 | positive regulation of bone resorption |
| 3. B | GO:0001525 | angiogenesis |
| 3. B | GO:0070820 | tertiary granule |
| 3. B | GO:2000418 | positive regulation of eosinophil migration |
| 3. B | GO:2000415 | positive regulation of fibronectin-dependent thymocyte migration |
| 3. B | GO:2000391 | positive regulation of neutrophil extravasation |
| 3. B | GO:0050714 | positive regulation of protein secretion |
| 3. B | GO:0050839 | cell adhesion molecule binding |
| 3. B | GO:0035579 | specific granule membrane |
| 3. B | GO:0033089 | positive regulation of T cell differentiation in thymus |
| 3. B | GO:0022617 | extracellular matrix disassembly |
| 3. B | GO:0045089 | positive regulation of innate immune response |
| 3. B | GO:0000902 | cell morphogenesis |
| 3. B | GO:0071456 | cellular response to hypoxia |
| 3. B | GO:0043621 | protein self-association |
| 3. B | GO:0051092 | positive regulation of NF-kappaB transcription factor activity |
| 3. B | GO:0101003 | ficolin-1-rich granule membrane |
| 3. B | GO:0098609 | cell-cell adhesion |
| 3. B | GO:0051044 | positive regulation of membrane protein ectodomain proteolysis |
| 3. B | GO:0048247 | lymphocyte chemotaxis |
| 3. B | GO:0043406 | positive regulation of MAP kinase activity |
| 3. B | GO:0070245 | positive regulation of thymocyte apoptotic process |
| 3. B | GO:0051897 | positive regulation of protein kinase B signaling |
| 3. B | GO:0002693 | positive regulation of cellular extravasation |
| 3. B | GO:0002102 | podosome |
| 3. B | GO:0010954 | positive regulation of protein processing |
| 3. B | GO:0043524 | negative regulation of neuron apoptotic process |
| 3. B | GO:0002675 | positive regulation of acute inflammatory response |
| 3. B | GO:0045785 | positive regulation of cell adhesion |
| 3. B | GO:0042581 | specific granule |
| 3. B | GO:0032127 | dense core granule membrane |
| 3. B | GO:0002523 | leukocyte migration involved in inflammatory response |
| 3. B | GO:0032010 | phagolysosome |
| 3. B | GO:0070821 | tertiary granule membrane |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | B9EJX3 | Protein ATP6V1FNB | 3.66e-11 | 1.31e-59 | 1.54e-95 |
| 1. PB | A0A1B0GUX0 | Protein ATP6V1FNB | 0 | 2.08e-140 | 1.05e-128 |
| 3. B | P78325 | Disintegrin and metalloproteinase domain-containing protein 8 | 7.50e-01 | NA | 0.015 |