Summary
A0A1B0GV22
Homolog: P0DP71.
Function: Protein FAM236C.
Statistics
Total GO Annotation: 0
Unique PROST Go: 0
Unique BLAST Go: 0
Total Homologs: 5
Unique PROST Homologs: 1
Unique BLAST Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
P0DP71
(Protein FAM236C) with a FATCAT P-Value: 3.49e-06 and RMSD of 4.05 angstrom. The sequence alignment identity is 91.1%.
Structural alignment shown in left. Query protein A0A1B0GV22 colored as red in alignment, homolog P0DP71 colored as blue.
Query protein A0A1B0GV22 is also shown in right top, homolog P0DP71 showed in right bottom. They are colored based on secondary structures.
A0A1B0GV22 MIFTPFLPPADLSVFQNVKGLQNDPEEWVAVSDATEDPSGGTGLPREPALLRGSWRSRFQRALACFTKCFRGGYRALGI 79 P0DP71 MIFTPFLPPADLSVFQNVKGPQKDPEELVAVSDTAEDPSSGTGLPREPALLRGSWRSRFQRALACFIKCFRGGYRALGI 79
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | P0DP71 | Protein FAM236C | 3.49e-06 | 5.50e-64 | 1.26e-47 |
| 1. PB | A0A1B0GTK5 | Protein FAM236D | 4.70e-04 | 5.50e-64 | 1.26e-47 |
| 1. PB | A0A1B0GUQ0 | Protein FAM236A | 4.62e-04 | 9.82e-150 | 9.98e-54 |
| 1. PB | A0A1B0GV22 | Protein FAM236B | 0 | 9.82e-150 | 9.98e-54 |
| 2. P | G2TRU1 | Uncharacterized protein C18.20 | 2.52e-03 | 4.78e-04 | NA |