Summary

A0A1B0GVG4

Homolog: A0A140LIT1.
Function: Coiled-coil domain-containing protein 194.

Statistics

Total GO Annotation: 82
Unique PROST Go: 76
Unique BLAST Go: 6

Total Homologs: 36
Unique PROST Homologs: 33
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was A0A140LIT1 (Coiled-coil domain-containing protein 194) with a FATCAT P-Value: 8.42e-14 and RMSD of 2.52 angstrom. The sequence alignment identity is 66.9%.
Structural alignment shown in left. Query protein A0A1B0GVG4 colored as red in alignment, homolog A0A140LIT1 colored as blue. Query protein A0A1B0GVG4 is also shown in right top, homolog A0A140LIT1 showed in right bottom. They are colored based on secondary structures. 

  A0A1B0GVG4 MAEPGPEPGRAWRVLALCGVAVFLAAAAAGGALVAWNLAASAARGPRCPEP-GANATA-PPGDPPPGVDDLRRRLAEAAEREEALARQLDQAESIRHELE 98
  A0A140LIT1 MAEPGPEPGRAWRLLALCGAAVFLAAAAAGGALVAWNLAASTARSPRCPEPEQMNATVRPP-DSAPEVEELRRRLAEAEQAQENLVWQLQRAEGDKRELE 99

  A0A1B0GVG4 KALKACEGRQSRLQTQLTTLKIEMDEAKAQGTQMGAENGALTEALARWEAAATESTRRLDEALRRAGVAEAEGEACAAREAALRERLNVLEAEMSPQRRV 198
  A0A140LIT1 AALKACKDSQSRLQTQLKALKIEMDQAKVRGTQMGLENGMLTEALVRWEATATESKQQLEEALQRAGAAEAAGEACVSREVALREHIYALEAELGTLRKE 199

  A0A1B0GVG4 PRPRPRSGSRPRPSPRSRSRSGPSGGCRRPARRARG 234
  A0A140LIT1 SRLRPRSGSRTKPSISHRPKSGSTKGCRRPPRDPQ- 234

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0031985 Golgi cisterna
2. P GO:0070665 positive regulation of leukocyte proliferation
2. P GO:0035455 response to interferon-alpha
2. P GO:0007618 mating
2. P GO:0007610 behavior
2. P GO:0060292 long-term synaptic depression
2. P GO:1901253 negative regulation of intracellular transport of viral material
2. P GO:0010165 response to X-ray
2. P GO:0033209 tumor necrosis factor-mediated signaling pathway
2. P GO:0000280 nuclear division
2. P GO:0048193 Golgi vesicle transport
2. P GO:0140059 dendrite arborization
2. P GO:0000138 Golgi trans cisterna
2. P GO:0061809 NAD+ nucleotidase, cyclic ADP-ribose generating
2. P GO:0097190 apoptotic signaling pathway
2. P GO:0110026 regulation of DNA strand resection involved in replication fork processing
2. P GO:0007030 Golgi organization
2. P GO:0050135 NAD(P)+ nucleosidase activity
2. P GO:0007099 centriole replication
2. P GO:0050853 B cell receptor signaling pathway
2. P GO:0005789 endoplasmic reticulum membrane
2. P GO:0003953 NAD+ nucleosidase activity
2. P GO:0009986 cell surface
2. P GO:0035577 azurophil granule membrane
2. P GO:0000723 telomere maintenance
2. P GO:0005901 caveola
2. P GO:0032526 response to retinoic acid
2. P GO:0042803 protein homodimerization activity
2. P GO:0005044 scavenger receptor activity
2. P GO:0048471 perinuclear region of cytoplasm
2. P GO:0000301 retrograde transport, vesicle recycling within Golgi
2. P GO:0045071 negative regulation of viral genome replication
2. P GO:0002737 negative regulation of plasmacytoid dendritic cell cytokine production
2. P GO:0009650 UV protection
2. P GO:0070555 response to interleukin-1
2. P GO:0010977 negative regulation of neuron projection development
2. P GO:0032504 multicellular organism reproduction
2. P GO:0010569 regulation of double-strand break repair via homologous recombination
2. P GO:0098536 deuterosome
2. P GO:0070062 extracellular exosome
2. P GO:0033194 response to hydroperoxide
2. P GO:0060997 dendritic spine morphogenesis
2. P GO:0034341 response to interferon-gamma
2. P GO:0016849 phosphorus-oxygen lyase activity
2. P GO:2000130 positive regulation of octopamine signaling pathway
2. P GO:0019835 cytolysis
2. P GO:0005794 Golgi apparatus
2. P GO:0042493
2. P GO:0016021 integral component of membrane
2. P GO:0031267 small GTPase binding
2. P GO:0042113 B cell activation
2. P GO:0005581 collagen trimer
2. P GO:0030663 COPI-coated vesicle membrane
2. P GO:0005783 endoplasmic reticulum
2. P GO:0014824 artery smooth muscle contraction
2. P GO:0032570 response to progesterone
2. P GO:0030890 positive regulation of B cell proliferation
2. P GO:0045907 positive regulation of vasoconstriction
2. P GO:0030667 secretory granule membrane
2. P GO:0032502 developmental process
2. P GO:0000137 Golgi cis cisterna
2. P GO:0035456 response to interferon-beta
2. P GO:0021687 cerebellar molecular layer morphogenesis
2. P GO:0005801 cis-Golgi network
2. P GO:0051298 centrosome duplication
2. P GO:0002693 positive regulation of cellular extravasation
2. P GO:0005797 Golgi medial cisterna
2. P GO:0060279 positive regulation of ovulation
2. P GO:0000165 MAPK cascade
2. P GO:0000139 Golgi membrane
2. P GO:0032024 positive regulation of insulin secretion
2. P GO:0045779 negative regulation of bone resorption
2. P GO:0042802 identical protein binding
2. P GO:0040016 embryonic cleavage
2. P GO:0048714 positive regulation of oligodendrocyte differentiation
2. P GO:0030674 protein-macromolecule adaptor activity
3. B GO:0051015 actin filament binding
3. B GO:0032982 myosin filament
3. B GO:0005516 calmodulin binding
3. B GO:0016459 myosin complex
3. B GO:0003774 cytoskeletal motor activity
3. B GO:0030016 myofibril

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A0A140LIT1 Coiled-coil domain-containing protein 194 8.42e-14 6.77e-49 5.17e-79
1. PB A0A1B0GVG4 Coiled-coil domain-containing protein 194 0 4.30e-155 9.47e-159
2. P Q9U2T3 Uncharacterized protein Y116A8C.11 6.61e-10 2.76e-02 NA
2. P Q7ZVT3 Spindle assembly abnormal protein 6 homolog 2.37e-05 2.13e-02 NA
2. P Q8C850 Scavenger receptor class A member 3 3.71e-06 2.49e-03 NA
2. P Q5PQS2 Protein ZNF365 7.67e-07 1.19e-02 NA
2. P P10305 Spanin, inner membrane subunit NA 2.96e-02 NA
2. P Q6PEB9 Coiled-coil domain-containing protein 127 2.02e-06 4.01e-08 NA
2. P Q6PL45 BRICHOS domain-containing protein 5 2.19e-01 8.30e-05 NA
2. P Q5R9L2 Protein ZNF365 1.42e-06 8.31e-03 NA
2. P Q70UQ0 Inhibitor of nuclear factor kappa-B kinase-interacting protein 1.82e-08 4.28e-05 NA
2. P Q5EAJ6 Inhibitor of nuclear factor kappa-B kinase-interacting protein 7.11e-09 2.09e-10 NA
2. P Q91VC4 Plasmalemma vesicle-associated protein 1.29e-06 4.48e-05 NA
2. P Q10589 Bone marrow stromal antigen 2 6.23e-08 3.00e-04 NA
2. P Q9WV78 Plasmalemma vesicle-associated protein 4.99e-07 8.44e-07 NA
2. P A2VE53 Inhibitor of nuclear factor kappa-B kinase-interacting protein 1.11e-07 1.63e-05 NA
2. P Q9BX97 Plasmalemma vesicle-associated protein 2.31e-07 2.56e-02 NA
2. P Q6GNT7 Golgin subfamily A member 5 2.56e-05 1.52e-02 NA
2. P Q8BGQ6 EF-hand calcium-binding domain-containing protein 14 3.70e-05 3.42e-02 NA
2. P P28907 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 2.04e-01 2.22e-04 NA
2. P Q96BQ5 Coiled-coil domain-containing protein 127 2.84e-06 2.59e-03 NA
2. P Q9DBZ1 Inhibitor of nuclear factor kappa-B kinase-interacting protein 1.82e-08 9.16e-11 NA
2. P P40695 Phospholipase C accessory protein PlcR 1.09e-02 3.80e-02 NA
2. P Q86W54 Spermatogenesis-associated protein 24 4.07e-12 3.69e-02 NA
2. P Q9QYE6 Golgin subfamily A member 5 1.87e-04 2.21e-02 NA
2. P Q8BMK4 Cytoskeleton-associated protein 4 3.37e-06 2.61e-02 NA
2. P Q3TC33 Coiled-coil domain-containing protein 127 1.78e-06 2.73e-08 NA
2. P Q5VAN0 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 2.31e-01 5.64e-04 NA
2. P Q6AZY7 Scavenger receptor class A member 3 1.35e-06 2.62e-03 NA
2. P P0C267 Coiled-coil domain-containing protein 127 5.22e-06 4.18e-05 NA
2. P Q3ZU82 Golgin subfamily A member 5 2.70e-05 1.18e-02 NA
2. P P51770 Probable spanin, inner membrane subunit NA 3.20e-02 NA
2. P P33737 Accessory gland-specific peptide 26Aa 9.82e-06 2.96e-02 NA
2. P Q8WV48 Coiled-coil domain-containing protein 107 4.02e-04 5.17e-04 NA
2. P Q9DCC3 Coiled-coil domain-containing protein 107 2.83e-05 1.46e-03 NA
3. B P24733 Myosin heavy chain, striated muscle 5.42e-02 NA 0.008