Summary

A0A1B0GVK7

Homolog: A0A1B0GVZ2.
Function: Protein FAM240B.

Statistics

Total GO Annotation: 23
Unique PROST Go: 23
Unique BLAST Go: 0

Total Homologs: 92
Unique PROST Homologs: 89
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was A0A1B0GVZ2 (Protein FAM240B) with a FATCAT P-Value: 4.51e-09 and RMSD of 3.40 angstrom. The sequence alignment identity is 64.1%.
Structural alignment shown in left. Query protein A0A1B0GVK7 colored as red in alignment, homolog A0A1B0GVZ2 colored as blue. Query protein A0A1B0GVK7 is also shown in right top, homolog A0A1B0GVZ2 showed in right bottom. They are colored based on secondary structures. 

  A0A1B0GVK7 MNNQYTRREVFCRNTCHDLKHFWEREIGKQTYYRESEERRLGRSALRKLREEWKQRLETKLRLRNNPEDTEKRTNVG- 77
  A0A1B0GVZ2 MNNQYIRREVFCCGTCHELKSFWEKEISKQTFYRELEEDRQERSALKKLREEWRQRLERRLRMLDNPVEKEKPAHTAD 78

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0007202 activation of phospholipase C activity
2. P GO:0023035 CD40 signaling pathway
2. P GO:0035632 mitochondrial prohibitin complex
2. P GO:0019076 viral release from host cell
2. P GO:0032740 positive regulation of interleukin-17 production
2. P GO:0072538 T-helper 17 type immune response
2. P GO:0005762 mitochondrial large ribosomal subunit
2. P GO:0032543 mitochondrial translation
2. P GO:0071897 DNA biosynthetic process
2. P GO:0030218 erythrocyte differentiation
2. P GO:0051897 positive regulation of protein kinase B signaling
2. P GO:0048661 positive regulation of smooth muscle cell proliferation
2. P GO:0002639 positive regulation of immunoglobulin production
2. P GO:0005743 mitochondrial inner membrane
2. P GO:0019073 viral DNA genome packaging
2. P GO:0034599 cellular response to oxidative stress
2. P GO:0005506 iron ion binding
2. P GO:0003735 structural constituent of ribosome
2. P GO:0030492 hemoglobin binding
2. P GO:1901224 positive regulation of NIK/NF-kappaB signaling
2. P GO:0042113 B cell activation
2. P GO:0005761 mitochondrial ribosome
2. P GO:1990051 activation of protein kinase C activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A0A1B0GVZ2 Protein FAM240B 4.51e-09 1.14e-13 1.05e-29
1. PB A0A1B0GVK7 Protein FAM240A 0 4.43e-36 7.33e-51
1. PB A0A1B0GVR7 Protein FAM240C 1.29e-05 3.15e-04 0.001
2. P Q21WM7 Probable Fe(2+)-trafficking protein 2.65e-02 4.28e-03 NA
2. P Q7VWC4 Probable Fe(2+)-trafficking protein 3.49e-02 1.11e-03 NA
2. P A4SIF7 Probable Fe(2+)-trafficking protein 8.64e-03 3.31e-02 NA
2. P B9MJP2 Probable Fe(2+)-trafficking protein 3.03e-02 1.96e-04 NA
2. P A6VDR9 Probable Fe(2+)-trafficking protein 3.38e-02 4.44e-05 NA
2. P B4T5L9 Probable Fe(2+)-trafficking protein 2.23e-02 5.01e-03 NA
2. P B7V3P2 Probable Fe(2+)-trafficking protein 3.42e-02 4.44e-05 NA
2. P Q1IJI6 Probable Fe(2+)-trafficking protein 4.52e-02 7.93e-05 NA
2. P B5BFR8 Probable Fe(2+)-trafficking protein 2.18e-02 5.01e-03 NA
2. P Q6D8J9 Probable Fe(2+)-trafficking protein 1.98e-02 2.37e-02 NA
2. P P86220 Prohibitin (Fragments) 1.15e-02 4.68e-02 NA
2. P A4VRX0 Probable Fe(2+)-trafficking protein 3.48e-02 1.09e-02 NA
2. P B6J775 Probable Fe(2+)-trafficking protein 3.23e-02 2.72e-03 NA
2. P Q3ZC04 Ribosomal protein 63, mitochondrial 4.61e-03 3.15e-04 NA
2. P A0KPN5 Probable Fe(2+)-trafficking protein 1.14e-02 1.88e-02 NA
2. P P57618 Probable Fe(2+)-trafficking protein 3.48e-02 3.84e-03 NA
2. P C5CNX5 Probable Fe(2+)-trafficking protein 3.02e-02 4.72e-03 NA
2. P Q3J8X0 Probable Fe(2+)-trafficking protein 4.25e-02 2.44e-02 NA
2. P B2SDR3 Probable Fe(2+)-trafficking protein 3.32e-02 2.37e-03 NA
2. P Q92H23 30S ribosomal protein S21 2.40e-03 4.94e-02 NA
2. P A9NCX7 Probable Fe(2+)-trafficking protein 3.34e-02 4.60e-02 NA
2. P C1DJC2 Probable Fe(2+)-trafficking protein 3.68e-02 3.22e-02 NA
2. P A4TI59 Probable Fe(2+)-trafficking protein 4.00e-02 8.78e-03 NA
2. P C1F8R9 Probable Fe(2+)-trafficking protein 5.73e-02 9.74e-04 NA
2. P B0VMC8 Probable Fe(2+)-trafficking protein 3.52e-02 2.28e-02 NA
2. P B5XU89 Probable Fe(2+)-trafficking protein 5.21e-02 2.77e-02 NA
2. P Q57K04 Probable Fe(2+)-trafficking protein 2.18e-02 5.01e-03 NA
2. P A4Y091 Probable Fe(2+)-trafficking protein 3.57e-02 2.02e-02 NA
2. P Q07Z51 Probable Fe(2+)-trafficking protein 4.84e-02 7.02e-04 NA
2. P B6J0C7 Probable Fe(2+)-trafficking protein 3.11e-02 5.42e-04 NA
2. P B5EPX1 Probable Fe(2+)-trafficking protein 2.98e-02 1.16e-02 NA
2. P B1JNM8 Probable Fe(2+)-trafficking protein 3.88e-02 8.78e-03 NA
2. P B5QY87 Probable Fe(2+)-trafficking protein 2.14e-02 5.01e-03 NA
2. P Q60AJ7 Probable Fe(2+)-trafficking protein 4.12e-02 1.60e-04 NA
2. P B4THJ7 Probable Fe(2+)-trafficking protein 2.17e-02 5.01e-03 NA
2. P Q9HU36 Probable Fe(2+)-trafficking protein 3.55e-02 4.44e-05 NA
2. P B0TZ67 Probable Fe(2+)-trafficking protein 4.02e-02 2.64e-03 NA
2. P A9N4Q8 Probable Fe(2+)-trafficking protein 2.16e-02 5.01e-03 NA
2. P A6TDX0 Probable Fe(2+)-trafficking protein 5.44e-02 1.26e-02 NA
2. P P03636 C protein NA 4.27e-02 NA
2. P Q8SVP4 UPF0329 protein ECU04_1650 1.20e-04 2.00e-02 NA
2. P A4G419 Probable Fe(2+)-trafficking protein 3.37e-02 1.02e-02 NA
2. P P67618 Probable Fe(2+)-trafficking protein 2.17e-02 5.01e-03 NA
2. P A9KCK3 Probable Fe(2+)-trafficking protein 3.33e-02 2.72e-03 NA
2. P B5F5N7 Probable Fe(2+)-trafficking protein 2.13e-02 5.01e-03 NA
2. P Q8YSC1 Probable 30S ribosomal protein PSRP-3 5.49e-02 8.80e-04 NA
2. P B5FUX4 Probable Fe(2+)-trafficking protein 2.16e-02 5.01e-03 NA
2. P A7NDW6 Probable Fe(2+)-trafficking protein 3.32e-02 2.16e-02 NA
2. P Q15ZT1 Probable Fe(2+)-trafficking protein 2.92e-02 3.28e-02 NA
2. P Q9BQC6 Ribosomal protein 63, mitochondrial 4.81e-03 6.60e-04 NA
2. P C0PY89 Probable Fe(2+)-trafficking protein 4.26e-02 5.01e-03 NA
2. P Q5PMM1 Probable Fe(2+)-trafficking protein 2.17e-02 5.01e-03 NA
2. P Q9CY02 Alpha-hemoglobin-stabilizing protein 1.23e-03 1.27e-02 NA
2. P Q7MHI4 Probable Fe(2+)-trafficking protein 3.07e-02 2.72e-03 NA
2. P B4EUQ7 Probable Fe(2+)-trafficking protein 4.31e-02 1.66e-02 NA
2. P B2IUK8 Probable 30S ribosomal protein PSRP-3 5.90e-02 2.46e-02 NA
2. P Q5QY58 Probable Fe(2+)-trafficking protein 2.89e-02 5.95e-04 NA
2. P Q82XF2 Probable Fe(2+)-trafficking protein 3.77e-02 8.05e-03 NA
2. P A0Q5C7 Probable Fe(2+)-trafficking protein 3.35e-02 1.95e-02 NA
2. P Q2A205 Probable Fe(2+)-trafficking protein 3.32e-02 2.16e-02 NA
2. P Q2JXD5 Probable 30S ribosomal protein PSRP-3 6.65e-02 4.72e-03 NA
2. P Q5NHJ8 Probable Fe(2+)-trafficking protein 3.34e-02 1.95e-02 NA
2. P A6SX71 Probable Fe(2+)-trafficking protein 4.05e-02 1.19e-02 NA
2. P A9MQR4 Probable Fe(2+)-trafficking protein 5.50e-02 5.01e-03 NA
2. P C3PP58 30S ribosomal protein S21 2.40e-03 4.94e-02 NA
2. P Q666M3 Probable Fe(2+)-trafficking protein 4.00e-02 8.78e-03 NA
2. P C5BCF0 Probable Fe(2+)-trafficking protein 3.93e-02 2.47e-04 NA
2. P B2K0V1 Probable Fe(2+)-trafficking protein 4.70e-02 8.78e-03 NA
2. P A9R6R1 Probable Fe(2+)-trafficking protein 3.97e-02 8.78e-03 NA
2. P Q02EL6 Probable Fe(2+)-trafficking protein 3.41e-02 4.44e-05 NA
2. P F5H9W4 Tripartite terminase subunit 2 NA 1.89e-02 NA
2. P Q1LLM6 Probable Fe(2+)-trafficking protein 3.99e-02 5.68e-03 NA
2. P Q1I3G0 Probable Fe(2+)-trafficking protein 3.64e-02 3.25e-04 NA
2. P P39427 Uncharacterized 8.1 kDa protein in modB-mrh intergenic region NA 2.80e-02 NA
2. P Q0A551 Probable Fe(2+)-trafficking protein 3.80e-02 2.88e-02 NA
2. P Q7W9Q2 Probable Fe(2+)-trafficking protein 3.48e-02 1.11e-03 NA
2. P A7FEX4 Probable Fe(2+)-trafficking protein 3.88e-02 8.78e-03 NA
2. P Q2V2P0 Uncharacterized protein YPR145C-A 5.63e-03 3.66e-02 NA
2. P B5RE71 Probable Fe(2+)-trafficking protein 2.13e-02 5.01e-03 NA
2. P A1W6W1 Probable Fe(2+)-trafficking protein 3.95e-02 1.96e-04 NA
2. P Q3M6B5 Probable 30S ribosomal protein PSRP-3 5.48e-02 3.73e-02 NA
2. P P67617 Probable Fe(2+)-trafficking protein 2.19e-02 5.01e-03 NA
2. P Q12B25 Probable Fe(2+)-trafficking protein 3.36e-02 7.75e-03 NA
2. P Q83D06 Probable Fe(2+)-trafficking protein 3.28e-02 2.72e-03 NA
2. P C6DAC3 Probable Fe(2+)-trafficking protein 5.07e-02 2.50e-02 NA
2. P B7J9T2 Probable Fe(2+)-trafficking protein 4.74e-02 1.16e-02 NA
2. P Q8DCC5 Probable Fe(2+)-trafficking protein 2.70e-02 2.72e-03 NA
2. P Q7WH06 Probable Fe(2+)-trafficking protein 4.74e-02 1.11e-03 NA
2. P B4TV80 Probable Fe(2+)-trafficking protein 2.19e-02 5.01e-03 NA