Summary

A0A1B0GVM5

Homolog: Q3ZM63.
Function: Embryonic testis differentiation protein homolog A.

Statistics

Total GO Annotation: 6
Unique PROST Go: 6
Unique BLAST Go: 0

Total Homologs: 12
Unique PROST Homologs: 8
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q3ZM63 (Embryonic testis differentiation protein homolog A) with a FATCAT P-Value: 9.27e-07 and RMSD of 3.27 angstrom. The sequence alignment identity is 78.0%.
Structural alignment shown in left. Query protein A0A1B0GVM5 colored as red in alignment, homolog Q3ZM63 colored as blue. Query protein A0A1B0GVM5 is also shown in right top, homolog Q3ZM63 showed in right bottom. They are colored based on secondary structures. 

  A0A1B0GVM5 MDKELPKASPSEPALNIKKSGKSFKCKKPTKNVQVFLINRQLGRNRSDTDLSKWLWMLP 59
      Q3ZM63 MDKEVPKGSPREPALNIKKSDKSFKRKKPTENVLIFLINRQLGRHRSDIDLSRWVWMLS 59

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0140057 vacuole-mitochondria membrane tethering
2. P GO:0008285 negative regulation of cell population proliferation
2. P GO:1990816 vacuole-mitochondrion membrane contact site
2. P GO:0005742 mitochondrial outer membrane translocase complex
2. P GO:0030150 protein import into mitochondrial matrix
2. P GO:0048367 shoot system development

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q80SW5 Embryonic testis differentiation protein 1.03e-03 3.83e-11 1.20e-07
1. PB P0DPP9 Embryonic testis differentiation protein homolog B 9.44e-07 5.54e-39 6.75e-28
1. PB Q3ZM63 Embryonic testis differentiation protein homolog A 9.27e-07 5.54e-39 6.75e-28
1. PB A0A1B0GVM5 Embryonic testis differentiation protein homolog C 0 8.73e-184 3.62e-37
2. P P0CAI5 Uncharacterized protein C62L NA 2.82e-02 NA
2. P Q9UI25 Putative uncharacterized protein PRO0461 2.33e-01 1.10e-02 NA
2. P P0CU22 Uncharacterized protein SPAC823.17 3.63e-01 4.10e-03 NA
2. P Q54C51 Putative uncharacterized protein DDB_G0293256 1.18e-01 4.40e-02 NA
2. P Q6IM89 Small polypeptide DEVIL 12 6.91e-02 1.48e-02 NA
2. P P0CAI6 Uncharacterized protein C62L NA 2.82e-02 NA
2. P P40588 Putative uncharacterized protein YIR044C 3.54e-01 1.79e-04 NA
2. P O78459 Uncharacterized 7.8 kDa protein 5.17e-01 5.77e-03 NA