Summary
A0A1B0GVR7
Homolog: A0A1B0GVZ2.
Function: Protein FAM240B.
Statistics
Total GO Annotation: 5
Unique PROST Go: 5
Unique BLAST Go: 0
Total Homologs: 6
Unique PROST Homologs: 3
Unique BLAST Homologs: 0
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
A0A1B0GVZ2
(Protein FAM240B) with a FATCAT P-Value: 3.78e-09 and RMSD of 1.38 angstrom. The sequence alignment identity is 32.0%.
Structural alignment shown in left. Query protein A0A1B0GVR7 colored as red in alignment, homolog A0A1B0GVZ2 colored as blue.
Query protein A0A1B0GVR7 is also shown in right top, homolog A0A1B0GVZ2 showed in right bottom. They are colored based on secondary structures.
A0A1B0GVR7 MVGKNMSKSLTLKNPGRVAYDSGG---IKMFWEKKIEHHA--RHLQNEDIRVRRSALNKLRVGWAEQLEGRNKMLQGPGRCPDRVPEATESLHTKDKKAA 95 A0A1B0GVZ2 -----MNNQY-IR---REVFCCGTCHELKSFWEKEISKQTFYRELE-ED-RQERSALKKLREEWRQRLERRLRMLDNPVE-KEK-PA-----HTAD---- 78 A0A1B0GVR7 95 A0A1B0GVZ2 78
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0032543 | mitochondrial translation |
| 2. P | GO:0005762 | mitochondrial large ribosomal subunit |
| 2. P | GO:0051018 | protein kinase A binding |
| 2. P | GO:0031333 | negative regulation of protein-containing complex assembly |
| 2. P | GO:0008104 | protein localization |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | A0A1B0GVZ2 | Protein FAM240B | 3.78e-09 | 6.76e-05 | 1.19e-05 |
| 1. PB | A0A1B0GVK7 | Protein FAM240A | 1.29e-05 | 7.58e-05 | 0.001 |
| 1. PB | A0A1B0GVR7 | Protein FAM240C | 0 | 4.80e-125 | 5.89e-67 |
| 2. P | O14181 | 54S ribosomal protein L28, mitochondrial | 4.63e-03 | 8.56e-03 | NA |
| 2. P | G3UWD5 | A-kinase anchor protein inhibitor 1 | 7.67e-04 | 4.81e-03 | NA |
| 2. P | Q65371 | Uncharacterized 8.6 kDa protein | NA | 3.27e-02 | NA |