Summary

A0A1B0GVZ2

Homolog: A0A1B0GVR7.
Function: Protein FAM240C.

Statistics

Total GO Annotation: 37
Unique PROST Go: 30
Unique BLAST Go: 7

Total Homologs: 149
Unique PROST Homologs: 145
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was A0A1B0GVR7 (Protein FAM240C) with a FATCAT P-Value: 3.78e-09 and RMSD of 1.38 angstrom. The sequence alignment identity is 32.0%.
Structural alignment shown in left. Query protein A0A1B0GVZ2 colored as red in alignment, homolog A0A1B0GVR7 colored as blue. Query protein A0A1B0GVZ2 is also shown in right top, homolog A0A1B0GVR7 showed in right bottom. They are colored based on secondary structures. 

  A0A1B0GVZ2 -----MNNQY-IR---REVFCCGTCHELKSFWEKEISKQTFYRELE-ED-RQERSALKKLREEWRQRLERRLRMLDNPVE-KEK-PA-----HTAD---- 78
  A0A1B0GVR7 MVGKNMSKSLTLKNPGRVAYDSGG---IKMFWEKKIEHHA--RHLQNEDIRVRRSALNKLRVGWAEQLEGRNKMLQGPGRCPDRVPEATESLHTKDKKAA 95

  A0A1B0GVZ2  78
  A0A1B0GVR7  95

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0009306 protein secretion
2. P GO:0061564 axon development
2. P GO:0071470 cellular response to osmotic stress
2. P GO:0000408 EKC/KEOPS complex
2. P GO:0030436 asexual sporulation
2. P GO:0000781 chromosome, telomeric region
2. P GO:0044196 host cell nucleolus
2. P GO:0051028 mRNA transport
2. P GO:0000722 telomere maintenance via recombination
2. P GO:0050821 protein stabilization
2. P GO:0031083 BLOC-1 complex
2. P GO:0030430 host cell cytoplasm
2. P GO:0045177 apical part of cell
2. P GO:1905048 regulation of metallopeptidase activity
2. P GO:0005856 cytoskeleton
2. P GO:0008017 microtubule binding
2. P GO:0001522 pseudouridine synthesis
2. P GO:0007032 endosome organization
2. P GO:0030435 sporulation resulting in formation of a cellular spore
2. P GO:0030515 snoRNA binding
2. P GO:0006508 proteolysis
2. P GO:0000439 transcription factor TFIIH core complex
2. P GO:0010596 negative regulation of endothelial cell migration
2. P GO:0005506 iron ion binding
2. P GO:0034599 cellular response to oxidative stress
2. P GO:0039644 suppression by virus of host NF-kappaB cascade
2. P GO:0030492 hemoglobin binding
2. P GO:0000032 cell wall mannoprotein biosynthetic process
2. P GO:0031397 negative regulation of protein ubiquitination
2. P GO:0006417 regulation of translation
3. B GO:0045214 sarcomere organization
3. B GO:0043231 intracellular membrane-bounded organelle
3. B GO:0055008 cardiac muscle tissue morphogenesis
3. B GO:0007165 signal transduction
3. B GO:0060047 heart contraction
3. B GO:0004722 protein serine/threonine phosphatase activity
3. B GO:0031430 M band

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A0A1B0GVZ2 Protein FAM240B 0 7.09e-117 1.86e-52
1. PB A0A1B0GVK7 Protein FAM240A 4.51e-09 1.51e-17 9.59e-30
1. PB A0A1B0GVR7 Protein FAM240C 3.78e-09 3.02e-03 9.75e-06
2. P A5F9I5 Probable Fe(2+)-trafficking protein 5.49e-02 1.38e-02 NA
2. P Q7VWC4 Probable Fe(2+)-trafficking protein 4.23e-02 3.84e-02 NA
2. P Q72CS2 50S ribosomal protein L28 3.42e-01 1.81e-03 NA
2. P Q6MTC5 50S ribosomal protein L28 5.71e-01 4.77e-02 NA
2. P Q2FXV1 UPF0337 protein SAOUHSC_01730 1.86e-03 6.32e-03 NA
2. P B4EYB8 UPF0181 protein PMI1604 8.13e-06 1.22e-02 NA
2. P B6J775 Probable Fe(2+)-trafficking protein 4.00e-02 1.19e-04 NA
2. P B2SDR3 Probable Fe(2+)-trafficking protein 3.76e-02 3.27e-04 NA
2. P Q8QVM0 Uncharacterized ORF2 protein NA 3.08e-02 NA
2. P Q6G8U4 UPF0337 protein SAS1561 1.84e-03 6.32e-03 NA
2. P C3LRW8 Probable Fe(2+)-trafficking protein 4.47e-02 1.38e-02 NA
2. P Q6HFI9 Small, acid-soluble spore protein Tlp 1.61e-07 4.38e-02 NA
2. P Q99LQ4 Small vasohibin-binding protein 9.48e-05 1.98e-02 NA
2. P Q57K04 Probable Fe(2+)-trafficking protein 7.46e-02 2.53e-03 NA
2. P B6J0C7 Probable Fe(2+)-trafficking protein 3.97e-02 2.75e-04 NA
2. P Q6GG78 UPF0337 protein SAR1705 1.86e-03 6.32e-03 NA
2. P Q4L4S3 UPF0337 protein SH2043 1.46e-04 1.84e-03 NA
2. P Q7A1E3 UPF0337 protein MW0793 1.51e-04 1.73e-02 NA
2. P B5QY87 Probable Fe(2+)-trafficking protein 5.72e-02 2.53e-03 NA
2. P Q60AJ7 Probable Fe(2+)-trafficking protein 3.75e-02 1.30e-02 NA
2. P A6TDX0 Probable Fe(2+)-trafficking protein 5.44e-02 7.07e-04 NA
2. P B0TZ67 Probable Fe(2+)-trafficking protein 3.43e-02 1.23e-03 NA
2. P A9N4Q8 Probable Fe(2+)-trafficking protein 5.76e-02 2.53e-03 NA
2. P Q99VG5 UPF0337 protein SAV0840 1.46e-04 1.73e-02 NA
2. P Q81U95 UPF0337 protein BA_0987/GBAA_0987/BAS0923 2.15e-06 4.52e-03 NA
2. P B2A5M4 UPF0291 protein Nther_1806 1.08e-02 1.44e-03 NA
2. P P0C8M3 Small vasohibin-binding protein 2.45e-05 3.84e-02 NA
2. P B5F5N7 Probable Fe(2+)-trafficking protein 7.47e-02 2.53e-03 NA
2. P A7NDW6 Probable Fe(2+)-trafficking protein 3.44e-02 3.98e-02 NA
2. P O14181 54S ribosomal protein L28, mitochondrial 2.28e-03 6.99e-03 NA
2. P Q8CTA8 UPF0337 protein SE_0604 1.85e-04 3.48e-03 NA
2. P Q4KLG3 Small vasohibin-binding protein 9.51e-05 1.98e-02 NA
2. P C0PY89 Probable Fe(2+)-trafficking protein 5.85e-02 2.53e-03 NA
2. P Q5HQQ4 UPF0337 protein SERP0494 1.73e-04 3.48e-03 NA
2. P Q8E6G8 UPF0337 protein gbs0600 1.16e-04 2.26e-02 NA
2. P Q98176 Protein MC005 NA 5.29e-05 NA
2. P B1LD62 UPF0181 protein YoaH 7.67e-03 3.81e-02 NA
2. P Q81Y88 Small, acid-soluble spore protein Tlp 1.79e-07 4.38e-02 NA
2. P A5GTB8 50S ribosomal protein L33 6.97e-01 1.88e-02 NA
2. P Q9CY02 Alpha-hemoglobin-stabilizing protein 1.51e-03 1.80e-02 NA
2. P Q6B8L8 Putative DNA-directed RNA polymerase subunit omega 1.31e-03 7.58e-04 NA
2. P B2VEZ9 Probable Fe(2+)-trafficking protein 5.35e-02 2.20e-02 NA
2. P G2TRU3 Uncharacterized protein PB16A4.07 2.55e-03 3.82e-03 NA
2. P O31959 SPbeta prophage-derived uncharacterized protein YomY 1.24e-03 7.73e-03 NA
2. P I1JLC8 Protein SLE2 4.44e-02 2.15e-02 NA
2. P Q81H26 UPF0337 protein BC_0999 1.78e-06 6.37e-03 NA
2. P Q5NHJ8 Probable Fe(2+)-trafficking protein 3.78e-02 4.20e-03 NA
2. P P36339 Protein Rev NA 5.59e-04 NA
2. P Q32LJ0 Small vasohibin-binding protein 2.18e-05 3.51e-03 NA
2. P A9MQR4 Probable Fe(2+)-trafficking protein 5.75e-02 2.53e-03 NA
2. P C3L9C5 Small, acid-soluble spore protein Tlp 1.66e-07 4.38e-02 NA
2. P O34605 SPbeta prophage-derived uncharacterized protein YopM 1.00e-08 4.08e-02 NA
2. P C5D2I1 Small, acid-soluble spore protein Tlp 5.77e-06 9.04e-03 NA
2. P B5F8H5 UPF0270 protein YheU 8.57e-02 4.41e-02 NA
2. P P27971 Protein Rev NA 5.55e-03 NA
2. P Q6CXR4 EKC/KEOPS complex subunit GON7 1.52e-02 8.32e-03 NA
2. P B8F4R9 Exodeoxyribonuclease 7 small subunit 2.03e-06 3.81e-02 NA
2. P A6X972 EKC/KEOPS complex subunit gon7 7.91e-04 4.16e-03 NA
2. P Q02EL6 Probable Fe(2+)-trafficking protein 5.68e-02 5.30e-03 NA
2. P Q1LLM6 Probable Fe(2+)-trafficking protein 3.20e-02 1.80e-02 NA
2. P Q18LD6 Protein U62 NA 1.63e-02 NA
2. P Q5B601 Uncharacterized protein AN4029 1.35e-03 1.86e-02 NA
2. P Q6NG70 UPF0337 protein DIP1660 2.87e-06 6.87e-04 NA
2. P Q8P829 Probable Fe(2+)-trafficking protein 8.63e-03 1.98e-02 NA
2. P O07520 Sporulation protein YhaL 2.18e-05 2.07e-02 NA
2. P B5RE71 Probable Fe(2+)-trafficking protein 7.42e-02 2.53e-03 NA
2. P Q5HHH4 UPF0337 protein SACOL0912 1.47e-04 1.73e-02 NA
2. P P67617 Probable Fe(2+)-trafficking protein 7.40e-02 2.53e-03 NA
2. P Q9KUR4 Probable Fe(2+)-trafficking protein 5.57e-02 1.38e-02 NA
2. P O29163 Uncharacterized protein AF_1102 1.17e-05 4.94e-02 NA
2. P B9IUC0 Small, acid-soluble spore protein Tlp 1.88e-07 4.38e-02 NA
2. P Q7A593 UPF0337 protein SA1452 1.85e-03 6.32e-03 NA
2. P Q8DCC5 Probable Fe(2+)-trafficking protein 7.12e-02 9.46e-03 NA
2. P Q7WH06 Probable Fe(2+)-trafficking protein 6.07e-02 3.84e-02 NA
2. P B4TV80 Probable Fe(2+)-trafficking protein 7.55e-02 2.53e-03 NA
2. P B5BFR8 Probable Fe(2+)-trafficking protein 7.55e-02 2.53e-03 NA
2. P B4T5L9 Probable Fe(2+)-trafficking protein 7.62e-02 2.53e-03 NA
2. P A6VDR9 Probable Fe(2+)-trafficking protein 5.77e-02 5.30e-03 NA
2. P E4PJF6 Ribosome modulation factor 2.67e-02 2.27e-03 NA
2. P B7V3P2 Probable Fe(2+)-trafficking protein 4.31e-03 5.30e-03 NA
2. P Q6D8J9 Probable Fe(2+)-trafficking protein 6.41e-02 9.20e-03 NA
2. P Q8E0V1 UPF0337 protein SAG0619 1.14e-04 2.26e-02 NA
2. P Q9UTF0 SERF-like protein C1705.02 3.93e-04 4.28e-03 NA
2. P B7HAY0 Small, acid-soluble spore protein Tlp 1.35e-06 1.29e-02 NA
2. P Q2YWN8 UPF0337 protein SAB0772 1.41e-04 1.51e-02 NA
2. P P71066 Uncharacterized protein YvfG 1.12e-02 1.45e-07 NA
2. P Q88887 Putative movement protein NA 3.11e-03 NA
2. P Q54BA6 Putative uncharacterized protein DDB_G0293796 4.01e-03 1.70e-02 NA
2. P A9NCX7 Probable Fe(2+)-trafficking protein 4.17e-02 1.01e-02 NA
2. P Q8N300 Small vasohibin-binding protein 4.89e-08 1.49e-03 NA
2. P Q99TM4 UPF0337 protein SAV1625 3.66e-03 6.32e-03 NA
2. P Q6GIH6 UPF0337 protein SAR0874 1.41e-04 1.73e-02 NA
2. P B7I056 Small, acid-soluble spore protein Tlp 1.71e-07 4.38e-02 NA
2. P Q2FZY9 UPF0337 protein SAOUHSC_00845 1.44e-04 1.73e-02 NA
2. P Q07Z51 Probable Fe(2+)-trafficking protein 5.53e-02 2.50e-02 NA
2. P B4THJ7 Probable Fe(2+)-trafficking protein 7.57e-02 2.53e-03 NA
2. P Q4HYI0 General transcription and DNA repair factor IIH subunit TFB5 1.38e-02 1.69e-02 NA
2. P Q9HU36 Probable Fe(2+)-trafficking protein 3.90e-02 5.30e-03 NA
2. P Q757D4 Biogenesis of lysosome-related organelles complex 1 subunit BLS1 1.41e-04 9.72e-03 NA
2. P Q6HMH4 UPF0337 protein BT9727_0908 3.44e-06 4.20e-03 NA
2. P Q8TY85 Ribosome biogenesis protein Nop10 1.37e-01 2.93e-02 NA
2. P A4G419 Probable Fe(2+)-trafficking protein 2.73e-02 2.45e-02 NA
2. P P67618 Probable Fe(2+)-trafficking protein 7.39e-02 2.53e-03 NA
2. P A1VEJ7 50S ribosomal protein L28 4.15e-01 1.81e-03 NA
2. P A9KCK3 Probable Fe(2+)-trafficking protein 3.35e-02 1.19e-04 NA
2. P Q6GB15 UPF0337 protein SAS0782 1.48e-04 1.73e-02 NA
2. P B7JI37 Small, acid-soluble spore protein Tlp 1.85e-07 4.38e-02 NA
2. P B5FUX4 Probable Fe(2+)-trafficking protein 5.77e-02 2.53e-03 NA
2. P Q8YSC1 Probable 30S ribosomal protein PSRP-3 6.53e-02 1.16e-02 NA
2. P Q5PMM1 Probable Fe(2+)-trafficking protein 7.51e-02 2.53e-03 NA
2. P Q91FH8 Uncharacterized protein 346R NA 4.28e-03 NA
2. P Q81AG2 Small, acid-soluble spore protein Tlp 1.61e-07 1.29e-02 NA
2. P Q7MHI4 Probable Fe(2+)-trafficking protein 4.47e-02 9.46e-03 NA
2. P Q733N0 Small, acid-soluble spore protein Tlp 1.70e-07 4.38e-02 NA
2. P Q4UW14 Probable Fe(2+)-trafficking protein 4.64e-02 1.98e-02 NA
2. P P22379 Protein Rev NA 4.56e-03 NA
2. P Q5QY58 Probable Fe(2+)-trafficking protein 5.96e-02 1.48e-03 NA
2. P A4WE99 Probable Fe(2+)-trafficking protein 4.01e-02 1.29e-02 NA
2. P A0Q5C7 Probable Fe(2+)-trafficking protein 3.47e-02 4.20e-03 NA
2. P Q2A205 Probable Fe(2+)-trafficking protein 3.45e-02 3.98e-02 NA
2. P Q7A0R0 UPF0337 protein MW1575 1.87e-03 6.32e-03 NA
2. P B0RRL3 Probable Fe(2+)-trafficking protein 2.37e-02 1.98e-02 NA
2. P Q1QXW0 Ribosome modulation factor 1.00e-02 4.01e-02 NA
2. P A7MLY0 Probable Fe(2+)-trafficking protein 5.99e-02 8.10e-03 NA
2. P A8AAJ4 Ribosome biogenesis protein Nop10 1.81e-01 2.66e-02 NA
2. P B4S2L7 Probable Fe(2+)-trafficking protein 4.40e-02 2.98e-02 NA
2. P Q1MQ47 50S ribosomal protein L28 7.29e-01 5.10e-03 NA
2. P Q8EBX6 Probable Fe(2+)-trafficking protein 6.39e-02 2.35e-02 NA
2. P Q2FIG2 UPF0337 protein SAUSA300_0816 1.50e-04 1.73e-02 NA
2. P P85216 Anionic antimicrobial peptide 2 4.78e-04 7.80e-03 NA
2. P A7MKF0 UPF0181 protein ESA_01442 1.63e-02 2.73e-02 NA
2. P F2JWN1 Ribosome modulation factor 3.31e-04 2.15e-03 NA
2. P Q637L7 Small, acid-soluble spore protein Tlp 1.73e-07 4.38e-02 NA
2. P A0RH02 Small, acid-soluble spore protein Tlp 1.79e-07 4.38e-02 NA
2. P Q7A6L9 UPF0337 protein SA0772 1.59e-04 1.73e-02 NA
2. P P39427 Uncharacterized 8.1 kDa protein in modB-mrh intergenic region NA 3.18e-06 NA
2. P Q1I3G0 Probable Fe(2+)-trafficking protein 5.56e-02 2.05e-02 NA
2. P Q7W9Q2 Probable Fe(2+)-trafficking protein 5.53e-02 3.84e-02 NA
2. P C3P449 Small, acid-soluble spore protein Tlp 1.59e-07 4.38e-02 NA
2. P Q2V2P0 Uncharacterized protein YPR145C-A 1.60e-03 4.94e-02 NA
2. P Q83D06 Probable Fe(2+)-trafficking protein 3.64e-02 1.19e-04 NA
2. P C6DAC3 Probable Fe(2+)-trafficking protein 4.40e-02 2.07e-02 NA
2. P Q8FU23 UPF0337 protein CE0198 9.22e-04 2.94e-03 NA
2. P C1EN48 Small, acid-soluble spore protein Tlp 1.80e-07 4.38e-02 NA
2. P Q91FM3 Uncharacterized protein 301L NA 1.84e-02 NA
3. B F1R6I3 Leucine-rich repeat-containing protein 39 6.01e-04 NA 0.014