Summary

A0A494C0Y3

Homolog: A0A494C0N9.
Function: Protein FAM246B.

Statistics

Total GO Annotation: 18
Unique PROST Go: 18
Unique BLAST Go: 0

Total Homologs: 13
Unique PROST Homologs: 10
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was A0A494C0N9 (Protein FAM246B) with a FATCAT P-Value: 5.61e-09 and RMSD of 2.24 angstrom. The sequence alignment identity is 98.3%.
Structural alignment shown in left. Query protein A0A494C0Y3 colored as red in alignment, homolog A0A494C0N9 colored as blue. Query protein A0A494C0Y3 is also shown in right top, homolog A0A494C0N9 showed in right bottom. They are colored based on secondary structures. 

  A0A494C0Y3 MATPGRPWAQARSAYRASEVLRRVTGRRRDPGPQSNGPGQEDARAPGRLARLLGQLRAEAASRSEVPRLLKLVERAGAGAAGAGERTGAHSRGSVCSVCG 100
  A0A494C0N9 MATPGRPWAQARSAYRASEVLRRVTGRRRDPGPQSNGPGREDARAPGRLARLLRQLRAEAASRSEVPRLLKLVERAGAGAAGAGERTGAHSRGSVCSVCG 100

  A0A494C0Y3 EPRGRATYPAGVLEVSERRLQEGLAAVREELGAEIEALRAELRAELDALRALLPPPPPSPPARREPRAVPRATPRGPTLLRTLGTVSALVAASRPADDAP 200
  A0A494C0N9 EPRGRATYPAGVLEVSERRLQEGLAAVREELGAEIEALRAELRAELDALRALLPPPPPSPPARREPRAVPRAAPRGPTLLRTLGTVSALVAASRPADDAP 200

  A0A494C0Y3 DGPAECGAHRAPVRKNHKKMPVPPGAPQGGGD 232
  A0A494C0N9 DGPAECGAHRAPARKNHKKMPVPPGAPQGGGD 232

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0005815 microtubule organizing center
2. P GO:0030474 spindle pole body duplication
2. P GO:0044196 host cell nucleolus
2. P GO:0140059 dendrite arborization
2. P GO:0051028 mRNA transport
2. P GO:0009968 negative regulation of signal transduction
2. P GO:0010977 negative regulation of neuron projection development
2. P GO:0010569 regulation of double-strand break repair via homologous recombination
2. P GO:0030430 host cell cytoplasm
2. P GO:0110026 regulation of DNA strand resection involved in replication fork processing
2. P GO:0019033 viral tegument
2. P GO:0021687 cerebellar molecular layer morphogenesis
2. P GO:0005200 structural constituent of cytoskeleton
2. P GO:0060997 dendritic spine morphogenesis
2. P GO:0000723 telomere maintenance
2. P GO:0005823 central plaque of spindle pole body
2. P GO:0044177 host cell Golgi apparatus
2. P GO:0048714 positive regulation of oligodendrocyte differentiation

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A0A494C0Y3 Protein FAM246A 0 9.16e-142 3.35e-156
1. PB A0A494C0N9 Protein FAM246B 5.61e-09 1.12e-87 1.67e-152
2. P P24097 Protein Rev NA 2.22e-02 NA
2. P Q6ZSJ8 Uncharacterized protein C1orf122 4.77e-03 3.57e-03 NA
2. P Q66JV7 Uncharacterized protein C8orf58 homolog 8.90e-02 2.48e-04 NA
2. P Q9HDT8 UPF0612 protein P20C8.01c 1.75e-03 2.04e-02 NA
2. P Q6GPM0 Regulator of G-protein signaling 7-binding protein 1.54e-03 3.27e-02 NA
2. P Q85227 Tegument protein UL51 NA 1.43e-03 NA
2. P Q6AXY9 Spermatogenic leucine zipper protein 1 1.23e-03 2.59e-02 NA
2. P Q5R9L2 Protein ZNF365 7.57e-03 4.17e-02 NA
2. P Q82855 Protein Rev NA 1.27e-02 NA
2. P Q75BW4 Spindle pole component 29 1.24e-02 2.27e-02 NA
3. B P0DSO1 Protein FAM246C 5.33e-04 NA 5.06e-37