Summary

A1A4G5

Homolog: Q4R881.
Function: Leukemia NUP98 fusion partner 1 homolog.

Statistics

Total GO Annotation: 10
Unique PROST Go: 10
Unique BLAST Go: 0

Total Homologs: 8
Unique PROST Homologs: 6
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q4R881 (Leukemia NUP98 fusion partner 1 homolog) with a FATCAT P-Value: 0.000694 and RMSD of 4.12 angstrom. The sequence alignment identity is 87.8%.
Structural alignment shown in left. Query protein A1A4G5 colored as red in alignment, homolog Q4R881 colored as blue. Query protein A1A4G5 is also shown in right top, homolog Q4R881 showed in right bottom. They are colored based on secondary structures. 

  A1A4G5 MEHKDDDDDDVSFAKWMSSFWGHSWREEDQRGLRERHRLQATSHRKTSLPCPLPVLPRIPSSD--------------CH-----PRRHSHEDQEFRCRSH 81
  Q4R881 MEHKDDDDDDVSFAKWMSSFWGHSWREEDQRGLRERHRPQATSHRKTSLPCPLPVLPRIPSSDRHPRRHSHEDQEFRCRSSDRLPRRHSHEDQKFRCRSH 100

  A1A4G5 VRDYRKYSEDGSFKEPLESKGRSHSKIEKFSESFERQLCFRTKRSASLGPESRKERNERECLRMEIKSRKKVEEERSSRKEEHGEAHMAPLFEKGPE 178
  Q4R881 VRDYGEYSEDGSFKEPLESKGRSHSKIEKFSESFERQLCFRTKRSASLGPESRKERNERECLRMEIKSRKKVEEERSSRKEEHGEAHMAPLFEKGPE 197

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0005929 cilium
2. P GO:0010719 negative regulation of epithelial to mesenchymal transition
2. P GO:0016055 Wnt signaling pathway
2. P GO:0090090 negative regulation of canonical Wnt signaling pathway
2. P GO:0070097 delta-catenin binding
2. P GO:0051018 protein kinase A binding
2. P GO:0030178 negative regulation of Wnt signaling pathway
2. P GO:0060271 cilium assembly
2. P GO:0030308 negative regulation of cell growth
2. P GO:0005080 protein kinase C binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q4R881 Leukemia NUP98 fusion partner 1 homolog 6.94e-04 2.01e-23 2.08e-116
1. PB A1A4G5 Leukemia NUP98 fusion partner 1 0 1.93e-158 8.37e-127
2. P Q9Y5U2 Protein TSSC4 3.98e-01 7.48e-03 NA
2. P Q06813 Uncharacterized protein YPR078C 2.46e-01 2.09e-03 NA
2. P A5PN52 Cilia- and flagella-associated protein HOATZ 9.99e-02 4.82e-05 NA
2. P Q96B18 Dapper homolog 3 4.50e-01 5.89e-03 NA
2. P Q1LZD3 Protein TSSC4 3.04e-01 3.44e-02 NA
2. P Q8IV56 Proline-rich protein 15 6.05e-01 3.54e-02 NA