Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q4R881
(Leukemia NUP98 fusion partner 1 homolog) with a FATCAT P-Value: 0.000694 and RMSD of 4.12 angstrom. The sequence alignment identity is 87.8%.
Structural alignment shown in left. Query protein A1A4G5 colored as red in alignment, homolog Q4R881 colored as blue.
Query protein A1A4G5 is also shown in right top, homolog Q4R881 showed in right bottom. They are colored based on secondary structures.
A1A4G5 MEHKDDDDDDVSFAKWMSSFWGHSWREEDQRGLRERHRLQATSHRKTSLPCPLPVLPRIPSSD--------------CH-----PRRHSHEDQEFRCRSH 81 Q4R881 MEHKDDDDDDVSFAKWMSSFWGHSWREEDQRGLRERHRPQATSHRKTSLPCPLPVLPRIPSSDRHPRRHSHEDQEFRCRSSDRLPRRHSHEDQKFRCRSH 100 A1A4G5 VRDYRKYSEDGSFKEPLESKGRSHSKIEKFSESFERQLCFRTKRSASLGPESRKERNERECLRMEIKSRKKVEEERSSRKEEHGEAHMAPLFEKGPE 178 Q4R881 VRDYGEYSEDGSFKEPLESKGRSHSKIEKFSESFERQLCFRTKRSASLGPESRKERNERECLRMEIKSRKKVEEERSSRKEEHGEAHMAPLFEKGPE 197
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0005929 | cilium |
| 2. P | GO:0010719 | negative regulation of epithelial to mesenchymal transition |
| 2. P | GO:0016055 | Wnt signaling pathway |
| 2. P | GO:0090090 | negative regulation of canonical Wnt signaling pathway |
| 2. P | GO:0070097 | delta-catenin binding |
| 2. P | GO:0051018 | protein kinase A binding |
| 2. P | GO:0030178 | negative regulation of Wnt signaling pathway |
| 2. P | GO:0060271 | cilium assembly |
| 2. P | GO:0030308 | negative regulation of cell growth |
| 2. P | GO:0005080 | protein kinase C binding |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q4R881 | Leukemia NUP98 fusion partner 1 homolog | 6.94e-04 | 2.01e-23 | 2.08e-116 |
| 1. PB | A1A4G5 | Leukemia NUP98 fusion partner 1 | 0 | 1.93e-158 | 8.37e-127 |
| 2. P | Q9Y5U2 | Protein TSSC4 | 3.98e-01 | 7.48e-03 | NA |
| 2. P | Q06813 | Uncharacterized protein YPR078C | 2.46e-01 | 2.09e-03 | NA |
| 2. P | A5PN52 | Cilia- and flagella-associated protein HOATZ | 9.99e-02 | 4.82e-05 | NA |
| 2. P | Q96B18 | Dapper homolog 3 | 4.50e-01 | 5.89e-03 | NA |
| 2. P | Q1LZD3 | Protein TSSC4 | 3.04e-01 | 3.44e-02 | NA |
| 2. P | Q8IV56 | Proline-rich protein 15 | 6.05e-01 | 3.54e-02 | NA |