Summary

A1L4L8

Homolog: Q9BYD5.
Function: Cornifelin.

Statistics

Total GO Annotation: 28
Unique PROST Go: 16
Unique BLAST Go: 10

Total Homologs: 26
Unique PROST Homologs: 13
Unique BLAST Homologs: 3

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q9BYD5 (Cornifelin) with a FATCAT P-Value: 4.28e-11 and RMSD of 1.12 angstrom. The sequence alignment identity is 27.6%.
Structural alignment shown in left. Query protein A1L4L8 colored as red in alignment, homolog Q9BYD5 colored as blue. Query protein A1L4L8 is also shown in right top, homolog Q9BYD5 showed in right bottom. They are colored based on secondary structures. 

  A1L4L8 MNWFGSNFFRCPEDLSLLNIYSPLLSHMSSEDEHFISNLRGHVPASAVVKQPVRGASGRTTITAIVQTG-GGWSTGLFSVCRDRRICFCGLFCPMCLECD 99
  Q9BYD5 ------------------------------------------------MSYPVTSQPQCAT-TSCYQTQLSDWHTGLTDCCNDMPVCLCGTFAPLCLACR 51

  A1L4L8 IARHYGECLCWPLLPGSTFALRIGTRERHKIQGTLCEDWLAV-HC--CWAFSICQVARELKMRTSQVYEICAVPMTKDTLV 177
  Q9BYD5 ISDDFGECCCAPYLPGGLHSIRTGMRERYHIQGSVGHDWAALTFCLPC---ALCQMARELKIRE----------------- 112

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0031424 keratinization
1. PB GO:0001533 cornified envelope
2. P GO:0048513 animal organ development
2. P GO:0061564 axon development
2. P GO:0070373 negative regulation of ERK1 and ERK2 cascade
2. P GO:1990830 cellular response to leukemia inhibitory factor
2. P GO:0043409 negative regulation of MAPK cascade
2. P GO:0016020 membrane
2. P GO:0040037 negative regulation of fibroblast growth factor receptor signaling pathway
2. P GO:0150013 negative regulation of neuron projection arborization
2. P GO:0004860 protein kinase inhibitor activity
2. P GO:1900025 negative regulation of substrate adhesion-dependent cell spreading
2. P GO:0008285 negative regulation of cell population proliferation
2. P GO:0046580 negative regulation of Ras protein signal transduction
2. P GO:0016021 integral component of membrane
2. P GO:0043407 negative regulation of MAP kinase activity
2. P GO:0007275 multicellular organism development
2. P GO:0032587 ruffle membrane
3. B GO:0009409 response to cold
3. B GO:0120162 positive regulation of cold-induced thermogenesis
3. B GO:0003682 chromatin binding
3. B GO:0045944 positive regulation of transcription by RNA polymerase II
3. B GO:0042742 defense response to bacterium
3. B GO:0040015 negative regulation of multicellular organism growth
3. B GO:0050873 brown fat cell differentiation
3. B GO:0043066 negative regulation of apoptotic process
3. B GO:0035578 azurophil granule lumen
3. B GO:0008284 positive regulation of cell population proliferation

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A1L4L8 PLAC8-like protein 1 0 1.05e-137 1.97e-131
1. PB Q6DK93 Cornifelin homolog 6.97e-11 3.24e-04 1.28e-23
1. PB Q6DK99 Cornifelin homolog B 3.99e-10 4.60e-05 2.92e-23
1. PB Q6PCW6 Cornifelin 4.88e-09 1.04e-03 9.70e-25
1. PB Q0VBW2 Cornifelin 1.97e-09 5.65e-04 1.32e-25
1. PB Q3ZCB2 Placenta-specific gene 8 protein 1.59e-07 1.95e-02 1.16e-14
1. PB Q9BYD5 Cornifelin 4.28e-11 1.27e-03 1.35e-24
1. PB Q6NUC1 Cornifelin homolog A 1.57e-10 4.11e-04 6.49e-23
1. PB Q66I68 Cornifelin homolog 7.67e-09 2.45e-04 2.83e-16
1. PB Q08EJ0 PLAC8-like protein 1 1.32e-10 8.74e-56 2.61e-99
2. P B4FUS3 Cell number regulator 8 2.69e-05 6.97e-07 NA
2. P B6TYV8 Cell number regulator 2 2.42e-05 1.11e-03 NA
2. P O43610 Protein sprouty homolog 3 1.67e-01 7.49e-03 NA
2. P B4FF80 Cell number regulator 5 1.31e-05 4.58e-07 NA
2. P Q3UUD2 Protein sprouty homolog 3 2.14e-01 7.54e-05 NA
2. P Q9M815 Protein PLANT CADMIUM RESISTANCE 8 1.12e-04 2.50e-06 NA
2. P D9HP27 Cell number regulator 11 5.93e-05 3.13e-05 NA
2. P B6TZ45 Cell number regulator 1 3.28e-04 7.37e-04 NA
2. P Q9LS44 Protein PLANT CADMIUM RESISTANCE 4 3.26e-05 3.93e-05 NA
2. P Q8S8T8 Protein PLANT CADMIUM RESISTANCE 10 2.21e-04 1.46e-09 NA
2. P A2VDU1 Protein sprouty homolog 4 1.34e-01 2.40e-02 NA
2. P Q9LS45 Protein PLANT CADMIUM RESISTANCE 5 7.09e-05 8.10e-06 NA
2. P Q9M9A5 Protein PLANT CADMIUM RESISTANCE 6 3.02e-05 7.21e-09 NA
3. B Q9JI48 Placenta-specific gene 8 protein 4.84e-09 NA 2.88e-11
3. B Q9NZF1 Placenta-specific gene 8 protein 2.98e-08 NA 1.02e-12
3. B Q5REK4 Placenta-specific gene 8 protein 1.04e-06 NA 6.27e-13