Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 3. B was
Q9H560
(Putative ankyrin repeat domain-containing protein 19) with a FATCAT P-Value: 0.0 and RMSD of 1.41 angstrom. The sequence alignment identity is 23.0%.
Structural alignment shown in left. Query protein A2A2Z9 colored as red in alignment, homolog Q9H560 colored as blue.
Query protein A2A2Z9 is also shown in right top, homolog Q9H560 showed in right bottom. They are colored based on secondary structures.
A2A2Z9 MRKLLSFGRRLGQALLSSMDQEYAGRGYHIRDWELRKIHRAAIKGDAAEVEHCLTRRFRDLDVRDRKDRTVLHLACAHGRVQVVTLLLDRKCQINICDRL 100 Q9H560 MRKLFSFGRRLGQALLDSMDQEYAGRGYHIRDWELRKIHRAAIKGDAAEVEHCLTRRFRDLDARDRKDRTVLHLTCAHGRVEVVTLLLSRRCQINIYDRL 100 A2A2Z9 NRTPLMKAVHCQEEACAIILLKRGANPNIKDIYGNTALHYAVYNEGTSLAERLLSHHANIEALNKEGNTPLLFAINSRRQHMVEFLLKNQANIHAVDNFK 200 Q9H560 NRTPLMKAVHCQEEACAIILLEHGANPNIKDIYSNTALHYAVYNKGTSLAEKLLSHHANIEALNEEGNTPLLFAINSRRQQIVEFLLKNQANLHAIDNFR 200 A2A2Z9 RTALILAVQHNLSSIVTLLLQQNIHISSQDMFGQTAEDYAFCCDLRSIQQQILEHKNKMLKNHLRNDNQETAAMKPENLKKRKKRKKLKKRKEGAKAEHN 300 Q9H560 RTALMLAVQHNSSSIVSLLLQQNINIFSQDLFGQTAEDYAVCYNFRSIQQQILEHKNKILKSHL------------------------------------ 264 A2A2Z9 LKVASEEKQERLERSENKQPQDSQSYGKKKDEMFGNFMLKRDIAMLKEELYAIKNDSLRKEKKYIQEIKSITEINANFEKSVRLNEEMITKKVAQYSQQL 400 Q9H560 ---------------------------------------------------------------------------------------------------- 264 A2A2Z9 NDLKAENARLNSKLEKEKHNKERLEAEVESLHSNLATAINEYNEILERKDLELVLWRADDVSRHETMGSNISQLTDKNELLTEQVHKARVKFNTLKGKLR 500 Q9H560 ---------------------------------------------------------------------------------------------------- 264 A2A2Z9 ETRDALREKTLALESVQLDLKQAQHRIKEMKQMHPNGEAKESQSIGKQNSSEERIRQRELENLLLERQLEDARKEGDNKEIVINIHRDCLENGKEDLLEE 600 Q9H560 ---------------------------------------------------------------------------------------------------- 264 A2A2Z9 RNKELMNEYNYLKEKLLQYEKEKAEREVIVREFQEELVDHLKKFSMSESPLEGTSHCHINLDETWTSKKKLFQVEIQPEEKHEEFRKVFELISLLNYTAD 700 Q9H560 ---------------------------------------------------------------------------------------------------- 264 A2A2Z9 QIRKKNRELEEEATGYKKCLEMTINMLNAFANEDFSCHGDLNTDQLKMDILFKKLKQKFDDLMAEKEAVSSKCVNLAKDNEVLHQELLSMGKVQEKCEKL 800 Q9H560 ---------------------------------------------------------------------------------------------------- 264 A2A2Z9 EKDKKMLEEKVLNLKTHMEKDMVELGKVQEYKSELDERAMQAIEKLEEIHLQKQAEYEKQLEQLNKDNTASLKKKELTLKDVECKFSKMKTAYEDVTTEL 900 Q9H560 ---------------------------------------------------------------------------------------------------- 264 A2A2Z9 EEYKEAFAVALKANSSMSEKITKSDKKIAVISTKLFMEKERMEYFLSTLPMRPDPELPCVENLNSIELNRKYIPKMAIRIPTSNPQTSNNCKNSLTELLL 1000 Q9H560 ---------------------------------------------------------------------------------------------------- 264 A2A2Z9 RWALAPIYFLL 1011 Q9H560 ----------- 264
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0043063 | intercellular bridge organization |
| 1. PB | GO:0030155 | regulation of cell adhesion |
| 1. PB | GO:0032426 | stereocilium tip |
| 1. PB | GO:1901223 | negative regulation of NIK/NF-kappaB signaling |
| 1. PB | GO:0030154 | cell differentiation |
| 1. PB | GO:0004857 | enzyme inhibitor activity |
| 1. PB | GO:0051306 | mitotic sister chromatid separation |
| 1. PB | GO:0019901 | protein kinase binding |
| 1. PB | GO:0072357 | PTW/PP1 phosphatase complex |
| 1. PB | GO:0019208 | phosphatase regulator activity |
| 1. PB | GO:0090090 | negative regulation of canonical Wnt signaling pathway |
| 1. PB | GO:0007283 | spermatogenesis |
| 1. PB | GO:0043280 | positive regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| 1. PB | GO:0001650 | fibrillar center |
| 1. PB | GO:0045171 | intercellular bridge |
| 1. PB | GO:0032466 | negative regulation of cytokinesis |
| 1. PB | GO:0007605 | sensory perception of sound |
| 1. PB | GO:0051017 | actin filament bundle assembly |
| 1. PB | GO:0005829 | cytosol |
| 1. PB | GO:0071889 | 14-3-3 protein binding |
| 1. PB | GO:0097190 | apoptotic signaling pathway |
| 1. PB | GO:0035508 | positive regulation of myosin-light-chain-phosphatase activity |
| 1. PB | GO:0031672 | A band |
| 1. PB | GO:2000096 | positive regulation of Wnt signaling pathway, planar cell polarity pathway |
| 1. PB | GO:0005856 | cytoskeleton |
| 1. PB | GO:0005929 | cilium |
| 1. PB | GO:0007140 | male meiotic nuclear division |
| 1. PB | GO:0030018 | Z disc |
| 1. PB | GO:0005938 | cell cortex |
| 1. PB | GO:0007165 | signal transduction |
| 1. PB | GO:0035507 | regulation of myosin-light-chain-phosphatase activity |
| 1. PB | GO:0005654 | nucleoplasm |
| 2. P | GO:0097539 | ciliary transition fiber |
| 2. P | GO:0050772 | positive regulation of axonogenesis |
| 2. P | GO:0051015 | actin filament binding |
| 2. P | GO:0008608 | attachment of spindle microtubules to kinetochore |
| 2. P | GO:0060050 | positive regulation of protein glycosylation |
| 2. P | GO:0007094 | mitotic spindle assembly checkpoint signaling |
| 2. P | GO:0030705 | cytoskeleton-dependent intracellular transport |
| 2. P | GO:0046621 | negative regulation of organ growth |
| 2. P | GO:0097730 | non-motile cilium |
| 2. P | GO:0042307 | positive regulation of protein import into nucleus |
| 2. P | GO:0005628 | prospore membrane |
| 2. P | GO:0090161 | Golgi ribbon formation |
| 2. P | GO:0008356 | asymmetric cell division |
| 2. P | GO:0005874 | microtubule |
| 2. P | GO:0030054 | cell junction |
| 2. P | GO:0045022 | early endosome to late endosome transport |
| 2. P | GO:0010507 | negative regulation of autophagy |
| 2. P | GO:0006937 | regulation of muscle contraction |
| 2. P | GO:0005814 | centriole |
| 2. P | GO:0070056 | prospore membrane leading edge |
| 2. P | GO:0007098 | centrosome cycle |
| 2. P | GO:0000922 | spindle pole |
| 2. P | GO:0046330 | positive regulation of JNK cascade |
| 2. P | GO:0031122 | cytoplasmic microtubule organization |
| 2. P | GO:0008630 | intrinsic apoptotic signaling pathway in response to DNA damage |
| 2. P | GO:0000001 | mitochondrion inheritance |
| 2. P | GO:0032091 | negative regulation of protein binding |
| 2. P | GO:0046627 | negative regulation of insulin receptor signaling pathway |
| 2. P | GO:0005813 | centrosome |
| 2. P | GO:0043293 | apoptosome |
| 2. P | GO:0040015 | negative regulation of multicellular organism growth |
| 2. P | GO:0090306 | meiotic spindle assembly |
| 2. P | GO:0007040 | lysosome organization |
| 2. P | GO:0003779 | actin binding |
| 2. P | GO:0030476 | ascospore wall assembly |
| 2. P | GO:0019217 | regulation of fatty acid metabolic process |
| 2. P | GO:0070695 | FHF complex |
| 2. P | GO:0005816 | spindle pole body |
| 2. P | GO:0032120 | ascospore-type prospore membrane formation |
| 2. P | GO:0045599 | negative regulation of fat cell differentiation |
| 2. P | GO:0000137 | Golgi cis cisterna |
| 2. P | GO:1905515 | non-motile cilium assembly |
| 2. P | GO:0008017 | microtubule binding |
| 2. P | GO:0008631 | intrinsic apoptotic signaling pathway in response to oxidative stress |
| 2. P | GO:0007020 | microtubule nucleation |
| 2. P | GO:0051645 | Golgi localization |
| 2. P | GO:0007032 | endosome organization |
| 2. P | GO:0061676 | importin-alpha family protein binding |
| 2. P | GO:0008333 | endosome to lysosome transport |
| 2. P | GO:0019216 | regulation of lipid metabolic process |
| 2. P | GO:0060259 | regulation of feeding behavior |
| 2. P | GO:0090307 | mitotic spindle assembly |
| 2. P | GO:0090166 | Golgi disassembly |
| 2. P | GO:0051225 | spindle assembly |
| 3. B | GO:0005770 | late endosome |
| 3. B | GO:0034765 | regulation of ion transmembrane transport |
| 3. B | GO:0071625 | vocalization behavior |
| 3. B | GO:0042994 | cytoplasmic sequestering of transcription factor |
| 3. B | GO:0000122 | negative regulation of transcription by RNA polymerase II |
| 3. B | GO:0050729 | positive regulation of inflammatory response |
| 3. B | GO:0048337 | positive regulation of mesodermal cell fate specification |
| 3. B | GO:0090037 | positive regulation of protein kinase C signaling |
| 3. B | GO:0051835 | positive regulation of synapse structural plasticity |
| 3. B | GO:0048709 | oligodendrocyte differentiation |
| 3. B | GO:0006511 | ubiquitin-dependent protein catabolic process |
| 3. B | GO:0043011 | myeloid dendritic cell differentiation |
| 3. B | GO:0035148 | tube formation |
| 3. B | GO:0032456 | endocytic recycling |
| 3. B | GO:0007507 | heart development |
| 3. B | GO:0001701 | in utero embryonic development |
| 3. B | GO:0072104 | glomerular capillary formation |
| 3. B | GO:1903779 | regulation of cardiac conduction |
| 3. B | GO:0042088 | T-helper 1 type immune response |
| 3. B | GO:0070563 | negative regulation of vitamin D receptor signaling pathway |
| 3. B | GO:0030334 | regulation of cell migration |
| 3. B | GO:0032421 | stereocilium bundle |
| 3. B | GO:0003270 | Notch signaling pathway involved in regulation of secondary heart field cardioblast proliferation |
| 3. B | GO:0010812 | negative regulation of cell-substrate adhesion |
| 3. B | GO:0001756 | somitogenesis |
| 3. B | GO:2001259 | positive regulation of cation channel activity |
| 3. B | GO:0051247 | positive regulation of protein metabolic process |
| 3. B | GO:0021514 | ventral spinal cord interneuron differentiation |
| 3. B | GO:1903522 | regulation of blood circulation |
| 3. B | GO:0070372 | regulation of ERK1 and ERK2 cascade |
| 3. B | GO:0060412 | ventricular septum morphogenesis |
| 3. B | GO:0045663 | positive regulation of myoblast differentiation |
| 3. B | GO:0014044 | Schwann cell development |
| 3. B | GO:0006306 | DNA methylation |
| 3. B | GO:0019903 | protein phosphatase binding |
| 3. B | GO:0106310 | protein serine kinase activity |
| 3. B | GO:0003252 | negative regulation of cell proliferation involved in heart valve morphogenesis |
| 3. B | GO:0085020 | protein K6-linked ubiquitination |
| 3. B | GO:0006959 | humoral immune response |
| 3. B | GO:0004842 | ubiquitin-protein transferase activity |
| 3. B | GO:0047499 | calcium-independent phospholipase A2 activity |
| 3. B | GO:0043403 | skeletal muscle tissue regeneration |
| 3. B | GO:0001837 | epithelial to mesenchymal transition |
| 3. B | GO:0051494 | negative regulation of cytoskeleton organization |
| 3. B | GO:0048259 | regulation of receptor-mediated endocytosis |
| 3. B | GO:0045070 | positive regulation of viral genome replication |
| 3. B | GO:0003950 | NAD+ ADP-ribosyltransferase activity |
| 3. B | GO:0050885 | neuromuscular process controlling balance |
| 3. B | GO:0021519 | spinal cord association neuron specification |
| 3. B | GO:0035264 | multicellular organism growth |
| 3. B | GO:0015095 | magnesium ion transmembrane transporter activity |
| 3. B | GO:0045611 | negative regulation of hemocyte differentiation |
| 3. B | GO:0051489 | regulation of filopodium assembly |
| 3. B | GO:0035622 | intrahepatic bile duct development |
| 3. B | GO:2000822 | regulation of behavioral fear response |
| 3. B | GO:0045737 | positive regulation of cyclin-dependent protein serine/threonine kinase activity |
| 3. B | GO:0045036 | protein targeting to chloroplast |
| 3. B | GO:0033257 | Bcl3/NF-kappaB2 complex |
| 3. B | GO:0016571 | histone methylation |
| 3. B | GO:0043254 | regulation of protein-containing complex assembly |
| 3. B | GO:0070588 | calcium ion transmembrane transport |
| 3. B | GO:0035304 | regulation of protein dephosphorylation |
| 3. B | GO:0010765 | positive regulation of sodium ion transport |
| 3. B | GO:0071546 | pi-body |
| 3. B | GO:0010557 | positive regulation of macromolecule biosynthetic process |
| 3. B | GO:0003162 | atrioventricular node development |
| 3. B | GO:0035690 | |
| 3. B | GO:0007492 | endoderm development |
| 3. B | GO:0048549 | positive regulation of pinocytosis |
| 3. B | GO:2001214 | positive regulation of vasculogenesis |
| 3. B | GO:0010956 | negative regulation of calcidiol 1-monooxygenase activity |
| 3. B | GO:0030534 | adult behavior |
| 3. B | GO:0034976 | response to endoplasmic reticulum stress |
| 3. B | GO:0031069 | hair follicle morphogenesis |
| 3. B | GO:0086015 | SA node cell action potential |
| 3. B | GO:1990404 | protein ADP-ribosylase activity |
| 3. B | GO:0005903 | brush border |
| 3. B | GO:0061073 | ciliary body morphogenesis |
| 3. B | GO:0097107 | postsynaptic density assembly |
| 3. B | GO:0051092 | positive regulation of NF-kappaB transcription factor activity |
| 3. B | GO:0007520 | myoblast fusion |
| 3. B | GO:0003151 | outflow tract morphogenesis |
| 3. B | GO:1902807 | negative regulation of cell cycle G1/S phase transition |
| 3. B | GO:0006913 | nucleocytoplasmic transport |
| 3. B | GO:0072014 | proximal tubule development |
| 3. B | GO:0002437 | inflammatory response to antigenic stimulus |
| 3. B | GO:0002039 | p53 binding |
| 3. B | GO:0002052 | positive regulation of neuroblast proliferation |
| 3. B | GO:0071354 | cellular response to interleukin-6 |
| 3. B | GO:0042734 | presynaptic membrane |
| 3. B | GO:0050953 | sensory perception of light stimulus |
| 3. B | GO:1902309 | negative regulation of peptidyl-serine dephosphorylation |
| 3. B | GO:0070417 | cellular response to cold |
| 3. B | GO:0031462 | Cul2-RING ubiquitin ligase complex |
| 3. B | GO:0048715 | negative regulation of oligodendrocyte differentiation |
| 3. B | GO:0034142 | toll-like receptor 4 signaling pathway |
| 3. B | GO:1990433 | CSL-Notch-Mastermind transcription factor complex |
| 3. B | GO:0005123 | death receptor binding |
| 3. B | GO:0043409 | negative regulation of MAPK cascade |
| 3. B | GO:0043008 | ATP-dependent protein binding |
| 3. B | GO:0048056 | R3/R4 cell differentiation |
| 3. B | GO:0003160 | endocardium morphogenesis |
| 3. B | GO:0043086 | negative regulation of catalytic activity |
| 3. B | GO:0022011 | myelination in peripheral nervous system |
| 3. B | GO:0007249 | I-kappaB kinase/NF-kappaB signaling |
| 3. B | GO:0050894 | determination of affect |
| 3. B | GO:0045638 | negative regulation of myeloid cell differentiation |
| 3. B | GO:0001709 | cell fate determination |
| 3. B | GO:0000209 | protein polyubiquitination |
| 3. B | GO:0097546 | ciliary base |
| 3. B | GO:0001947 | heart looping |
| 3. B | GO:0035116 | embryonic hindlimb morphogenesis |
| 3. B | GO:0090201 | negative regulation of release of cytochrome c from mitochondria |
| 3. B | GO:0002027 | regulation of heart rate |
| 3. B | GO:2000178 | negative regulation of neural precursor cell proliferation |
| 3. B | GO:1904970 | brush border assembly |
| 3. B | GO:0044325 | transmembrane transporter binding |
| 3. B | GO:0008593 | regulation of Notch signaling pathway |
| 3. B | GO:0030496 | midbody |
| 3. B | GO:0005634 | nucleus |
| 3. B | GO:0072116 | pronephros formation |
| 3. B | GO:0072574 | hepatocyte proliferation |
| 3. B | GO:1990760 | osmolarity-sensing cation channel activity |
| 3. B | GO:0010629 | negative regulation of gene expression |
| 3. B | GO:0019888 | protein phosphatase regulator activity |
| 3. B | GO:0046875 | ephrin receptor binding |
| 3. B | GO:0010366 | negative regulation of ethylene biosynthetic process |
| 3. B | GO:0001763 | morphogenesis of a branching structure |
| 3. B | GO:0030660 | Golgi-associated vesicle membrane |
| 3. B | GO:0002789 | negative regulation of antifungal peptide production |
| 3. B | GO:0072044 | collecting duct development |
| 3. B | GO:0046826 | negative regulation of protein export from nucleus |
| 3. B | GO:1900246 | positive regulation of RIG-I signaling pathway |
| 3. B | GO:1904901 | positive regulation of myosin II filament organization |
| 3. B | GO:0070528 | protein kinase C signaling |
| 3. B | GO:0097129 | cyclin D2-CDK4 complex |
| 3. B | GO:0007253 | cytoplasmic sequestering of NF-kappaB |
| 3. B | GO:0060999 | positive regulation of dendritic spine development |
| 3. B | GO:0005516 | calmodulin binding |
| 3. B | GO:0045603 | positive regulation of endothelial cell differentiation |
| 3. B | GO:0010875 | positive regulation of cholesterol efflux |
| 3. B | GO:0045746 | negative regulation of Notch signaling pathway |
| 3. B | GO:0035774 | positive regulation of insulin secretion involved in cellular response to glucose stimulus |
| 3. B | GO:0051289 | protein homotetramerization |
| 3. B | GO:0097604 | temperature-gated cation channel activity |
| 3. B | GO:0070213 | protein auto-ADP-ribosylation |
| 3. B | GO:0004672 | protein kinase activity |
| 3. B | GO:0046427 | positive regulation of receptor signaling pathway via JAK-STAT |
| 3. B | GO:0043330 | response to exogenous dsRNA |
| 3. B | GO:0055016 | hypochord development |
| 3. B | GO:0031877 | somatostatin receptor binding |
| 3. B | GO:0048812 | neuron projection morphogenesis |
| 3. B | GO:0033292 | T-tubule organization |
| 3. B | GO:0006967 | positive regulation of antifungal peptide biosynthetic process |
| 3. B | GO:0005769 | early endosome |
| 3. B | GO:0071356 | cellular response to tumor necrosis factor |
| 3. B | GO:0045665 | negative regulation of neuron differentiation |
| 3. B | GO:0055074 | calcium ion homeostasis |
| 3. B | GO:0006816 | calcium ion transport |
| 3. B | GO:0071372 | cellular response to follicle-stimulating hormone stimulus |
| 3. B | GO:0061629 | RNA polymerase II-specific DNA-binding transcription factor binding |
| 3. B | GO:1904108 | protein localization to ciliary inversin compartment |
| 3. B | GO:0009950 | dorsal/ventral axis specification |
| 3. B | GO:0005525 | GTP binding |
| 3. B | GO:0042405 | nuclear inclusion body |
| 3. B | GO:1900245 | positive regulation of MDA-5 signaling pathway |
| 3. B | GO:0045747 | positive regulation of Notch signaling pathway |
| 3. B | GO:0006915 | apoptotic process |
| 3. B | GO:0035898 | parathyroid hormone secretion |
| 3. B | GO:0035924 | cellular response to vascular endothelial growth factor stimulus |
| 3. B | GO:0097114 | NMDA glutamate receptor clustering |
| 3. B | GO:0106311 | |
| 3. B | GO:0014832 | urinary bladder smooth muscle contraction |
| 3. B | GO:1990166 | protein localization to site of double-strand break |
| 3. B | GO:0090521 | glomerular visceral epithelial cell migration |
| 3. B | GO:0031436 | BRCA1-BARD1 complex |
| 3. B | GO:0045944 | positive regulation of transcription by RNA polymerase II |
| 3. B | GO:0050768 | negative regulation of neurogenesis |
| 3. B | GO:0030307 | positive regulation of cell growth |
| 3. B | GO:0099092 | postsynaptic density, intracellular component |
| 3. B | GO:0045893 | positive regulation of transcription, DNA-templated |
| 3. B | GO:0005249 | voltage-gated potassium channel activity |
| 3. B | GO:0045211 | postsynaptic membrane |
| 3. B | GO:0010838 | positive regulation of keratinocyte proliferation |
| 3. B | GO:0014070 | response to organic cyclic compound |
| 3. B | GO:0010976 | positive regulation of neuron projection development |
| 3. B | GO:0030017 | sarcomere |
| 3. B | GO:0032270 | positive regulation of cellular protein metabolic process |
| 3. B | GO:0043491 | protein kinase B signaling |
| 3. B | GO:0005902 | microvillus |
| 3. B | GO:0036336 | dendritic cell migration |
| 3. B | GO:0016055 | Wnt signaling pathway |
| 3. B | GO:0048873 | homeostasis of number of cells within a tissue |
| 3. B | GO:0051967 | negative regulation of synaptic transmission, glutamatergic |
| 3. B | GO:0061195 | taste bud formation |
| 3. B | GO:0018345 | protein palmitoylation |
| 3. B | GO:1904106 | protein localization to microvillus |
| 3. B | GO:0032288 | myelin assembly |
| 3. B | GO:0021515 | cell differentiation in spinal cord |
| 3. B | GO:1900127 | positive regulation of hyaluronan biosynthetic process |
| 3. B | GO:0015271 | outward rectifier potassium channel activity |
| 3. B | GO:0002011 | morphogenesis of an epithelial sheet |
| 3. B | GO:0071212 | subsynaptic reticulum |
| 3. B | GO:0014807 | regulation of somitogenesis |
| 3. B | GO:0031670 | cellular response to nutrient |
| 3. B | GO:0030279 | negative regulation of ossification |
| 3. B | GO:0048663 | neuron fate commitment |
| 3. B | GO:0030016 | myofibril |
| 3. B | GO:0006584 | catecholamine metabolic process |
| 3. B | GO:0060743 | epithelial cell maturation involved in prostate gland development |
| 3. B | GO:0003182 | coronary sinus valve morphogenesis |
| 3. B | GO:0055117 | regulation of cardiac muscle contraction |
| 3. B | GO:1902339 | positive regulation of apoptotic process involved in morphogenesis |
| 3. B | GO:0044605 | phosphocholine transferase activity |
| 3. B | GO:0006929 | substrate-dependent cell migration |
| 3. B | GO:0071345 | cellular response to cytokine stimulus |
| 3. B | GO:0030424 | axon |
| 3. B | GO:0035307 | positive regulation of protein dephosphorylation |
| 3. B | GO:0007409 | axonogenesis |
| 3. B | GO:0051146 | striated muscle cell differentiation |
| 3. B | GO:0035255 | ionotropic glutamate receptor binding |
| 3. B | GO:0003714 | transcription corepressor activity |
| 3. B | GO:0043069 | negative regulation of programmed cell death |
| 3. B | GO:1902260 | negative regulation of delayed rectifier potassium channel activity |
| 3. B | GO:0031013 | troponin I binding |
| 3. B | GO:0031430 | M band |
| 3. B | GO:0043046 | DNA methylation involved in gamete generation |
| 3. B | GO:0070198 | protein localization to chromosome, telomeric region |
| 3. B | GO:0090238 | positive regulation of arachidonic acid secretion |
| 3. B | GO:0045751 | negative regulation of Toll signaling pathway |
| 3. B | GO:0072576 | liver morphogenesis |
| 3. B | GO:0007030 | Golgi organization |
| 3. B | GO:0045838 | positive regulation of membrane potential |
| 3. B | GO:1902263 | apoptotic process involved in embryonic digit morphogenesis |
| 3. B | GO:0036371 | protein localization to T-tubule |
| 3. B | GO:0035172 | hemocyte proliferation |
| 3. B | GO:0003344 | pericardium morphogenesis |
| 3. B | GO:0044030 | regulation of DNA methylation |
| 3. B | GO:0060076 | excitatory synapse |
| 3. B | GO:0070742 | C2H2 zinc finger domain binding |
| 3. B | GO:0140627 | ubiquitin-dependent protein catabolic process via the C-end degron rule pathway |
| 3. B | GO:0003208 | cardiac ventricle morphogenesis |
| 3. B | GO:0003214 | cardiac left ventricle morphogenesis |
| 3. B | GO:2000812 | regulation of barbed-end actin filament capping |
| 3. B | GO:0010424 | DNA methylation on cytosine within a CG sequence |
| 3. B | GO:0051101 | regulation of DNA binding |
| 3. B | GO:0014731 | spectrin-associated cytoskeleton |
| 3. B | GO:0044309 | neuron spine |
| 3. B | GO:0005737 | cytoplasm |
| 3. B | GO:0098978 | glutamatergic synapse |
| 3. B | GO:2000001 | regulation of DNA damage checkpoint |
| 3. B | GO:0055013 | cardiac muscle cell development |
| 3. B | GO:0072114 | pronephros morphogenesis |
| 3. B | GO:0061630 | ubiquitin protein ligase activity |
| 3. B | GO:0010882 | regulation of cardiac muscle contraction by calcium ion signaling |
| 3. B | GO:0043005 | neuron projection |
| 3. B | GO:0098871 | postsynaptic actin cytoskeleton |
| 3. B | GO:0097435 | supramolecular fiber organization |
| 3. B | GO:1904385 | cellular response to angiotensin |
| 3. B | GO:0035153 | epithelial cell type specification, open tracheal system |
| 3. B | GO:0046331 | lateral inhibition |
| 3. B | GO:0014704 | intercalated disc |
| 3. B | GO:0097113 | AMPA glutamate receptor clustering |
| 3. B | GO:0042995 | cell projection |
| 3. B | GO:2000321 | positive regulation of T-helper 17 cell differentiation |
| 3. B | GO:0046959 | habituation |
| 3. B | GO:0001955 | blood vessel maturation |
| 3. B | GO:0010225 | response to UV-C |
| 3. B | GO:0099519 | dense core granule cytoskeletal transport |
| 3. B | GO:0007219 | Notch signaling pathway |
| 3. B | GO:0035994 | response to muscle stretch |
| 3. B | GO:0038023 | signaling receptor activity |
| 3. B | GO:0060354 | negative regulation of cell adhesion molecule production |
| 3. B | GO:0031441 | negative regulation of mRNA 3'-end processing |
| 3. B | GO:0032232 | negative regulation of actin filament bundle assembly |
| 3. B | GO:0034638 | phosphatidylcholine catabolic process |
| 3. B | GO:0021546 | rhombomere development |
| 3. B | GO:0003332 | negative regulation of extracellular matrix constituent secretion |
| 3. B | GO:0033280 | response to vitamin D |
| 3. B | GO:0046976 | histone methyltransferase activity (H3-K27 specific) |
| 3. B | GO:1905274 | regulation of modification of postsynaptic actin cytoskeleton |
| 3. B | GO:0045794 | negative regulation of cell volume |
| 3. B | GO:1904717 | regulation of AMPA glutamate receptor clustering |
| 3. B | GO:0031047 | gene silencing by RNA |
| 3. B | GO:0042048 | olfactory behavior |
| 3. B | GO:0071222 | cellular response to lipopolysaccharide |
| 3. B | GO:0071447 | cellular response to hydroperoxide |
| 3. B | GO:0032580 | Golgi cisterna membrane |
| 3. B | GO:0035914 | skeletal muscle cell differentiation |
| 3. B | GO:0000731 | DNA synthesis involved in DNA repair |
| 3. B | GO:0016529 | sarcoplasmic reticulum |
| 3. B | GO:0071800 | podosome assembly |
| 3. B | GO:0060288 | formation of a compartment boundary |
| 3. B | GO:0051497 | negative regulation of stress fiber assembly |
| 3. B | GO:0140374 | antiviral innate immune response |
| 3. B | GO:0000082 | G1/S transition of mitotic cell cycle |
| 3. B | GO:0005096 | GTPase activator activity |
| 3. B | GO:0030034 | microvillar actin bundle assembly |
| 3. B | GO:1901222 | regulation of NIK/NF-kappaB signaling |
| 3. B | GO:0045672 | positive regulation of osteoclast differentiation |
| 3. B | GO:1904743 | negative regulation of telomeric DNA binding |
| 3. B | GO:0071347 | cellular response to interleukin-1 |
| 3. B | GO:1900383 | regulation of synaptic plasticity by receptor localization to synapse |
| 3. B | GO:0003241 | growth involved in heart morphogenesis |
| 3. B | GO:0072660 | maintenance of protein location in plasma membrane |
| 3. B | GO:0015629 | actin cytoskeleton |
| 3. B | GO:0009967 | positive regulation of signal transduction |
| 3. B | GO:0071359 | cellular response to dsRNA |
| 3. B | GO:0055007 | cardiac muscle cell differentiation |
| 3. B | GO:0060289 | compartment boundary maintenance |
| 3. B | GO:0031674 | I band |
| 3. B | GO:2000134 | negative regulation of G1/S transition of mitotic cell cycle |
| 3. B | GO:0043197 | dendritic spine |
| 3. B | GO:0005112 | Notch binding |
| 3. B | GO:0003198 | epithelial to mesenchymal transition involved in endocardial cushion formation |
| 3. B | GO:0102991 | myristoyl-CoA hydrolase activity |
| 3. B | GO:1901187 | regulation of ephrin receptor signaling pathway |
| 3. B | GO:0008285 | negative regulation of cell population proliferation |
| 3. B | GO:0061028 | establishment of endothelial barrier |
| 3. B | GO:0001889 | liver development |
| 3. B | GO:0045197 | establishment or maintenance of epithelial cell apical/basal polarity |
| 3. B | GO:0060674 | placenta blood vessel development |
| 3. B | GO:0039529 | RIG-I signaling pathway |
| 3. B | GO:0033209 | tumor necrosis factor-mediated signaling pathway |
| 3. B | GO:0036309 | protein localization to M-band |
| 3. B | GO:0065001 | specification of axis polarity |
| 3. B | GO:0060317 | cardiac epithelial to mesenchymal transition |
| 3. B | GO:0060948 | cardiac vascular smooth muscle cell development |
| 3. B | GO:0086069 | bundle of His cell to Purkinje myocyte communication |
| 3. B | GO:0045732 | positive regulation of protein catabolic process |
| 3. B | GO:0098919 | structural constituent of postsynaptic density |
| 3. B | GO:0097117 | guanylate kinase-associated protein clustering |
| 3. B | GO:0034446 | substrate adhesion-dependent cell spreading |
| 3. B | GO:0002357 | defense response to tumor cell |
| 3. B | GO:0002070 | epithelial cell maturation |
| 3. B | GO:0031432 | titin binding |
| 3. B | GO:0034112 | positive regulation of homotypic cell-cell adhesion |
| 3. B | GO:0060442 | branching involved in prostate gland morphogenesis |
| 3. B | GO:0006471 | protein ADP-ribosylation |
| 3. B | GO:0070531 | BRCA1-A complex |
| 3. B | GO:0060842 | arterial endothelial cell differentiation |
| 3. B | GO:0086070 | SA node cell to atrial cardiac muscle cell communication |
| 3. B | GO:1900452 | regulation of long-term synaptic depression |
| 3. B | GO:0042327 | positive regulation of phosphorylation |
| 3. B | GO:0045955 | negative regulation of calcium ion-dependent exocytosis |
| 3. B | GO:0070972 | protein localization to endoplasmic reticulum |
| 3. B | GO:0090160 | Golgi to lysosome transport |
| 3. B | GO:2001027 | negative regulation of endothelial cell chemotaxis |
| 3. B | GO:0043268 | positive regulation of potassium ion transport |
| 3. B | GO:0035518 | histone H2A monoubiquitination |
| 3. B | GO:0016021 | integral component of membrane |
| 3. B | GO:0031267 | small GTPase binding |
| 3. B | GO:0060035 | notochord cell development |
| 3. B | GO:0002193 | MAML1-RBP-Jkappa- ICN1 complex |
| 3. B | GO:0046579 | positive regulation of Ras protein signal transduction |
| 3. B | GO:0045685 | regulation of glial cell differentiation |
| 3. B | GO:0030513 | positive regulation of BMP signaling pathway |
| 3. B | GO:2000737 | negative regulation of stem cell differentiation |
| 3. B | GO:0048754 | branching morphogenesis of an epithelial tube |
| 3. B | GO:2001279 | regulation of unsaturated fatty acid biosynthetic process |
| 3. B | GO:0004861 | cyclin-dependent protein serine/threonine kinase inhibitor activity |
| 3. B | GO:0010001 | glial cell differentiation |
| 3. B | GO:1902531 | regulation of intracellular signal transduction |
| 3. B | GO:0000062 | fatty-acyl-CoA binding |
| 3. B | GO:1900827 | positive regulation of membrane depolarization during cardiac muscle cell action potential |
| 3. B | GO:0031960 | response to corticosteroid |
| 3. B | GO:0060074 | synapse maturation |
| 3. B | GO:0003256 | regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation |
| 3. B | GO:1901201 | regulation of extracellular matrix assembly |
| 3. B | GO:0048892 | lateral line nerve development |
| 3. B | GO:0032049 | cardiolipin biosynthetic process |
| 3. B | GO:0008093 | cytoskeletal anchor activity |
| 3. B | GO:0010667 | negative regulation of cardiac muscle cell apoptotic process |
| 3. B | GO:0038061 | NIK/NF-kappaB signaling |
| 3. B | GO:0019730 | antimicrobial humoral response |
| 3. B | GO:0042802 | identical protein binding |
| 3. B | GO:0048708 | astrocyte differentiation |
| 3. B | GO:0030674 | protein-macromolecule adaptor activity |
| 3. B | GO:0034058 | endosomal vesicle fusion |
| 3. B | GO:0003222 | ventricular trabecula myocardium morphogenesis |
| 3. B | GO:0030326 | embryonic limb morphogenesis |
| 3. B | GO:0060740 | prostate gland epithelium morphogenesis |
| 3. B | GO:0030837 | negative regulation of actin filament polymerization |
| 3. B | GO:0071286 | cellular response to magnesium ion |
| 3. B | GO:0090309 | positive regulation of DNA methylation-dependent heterochromatin assembly |
| 3. B | GO:0060411 | cardiac septum morphogenesis |
| 3. B | GO:0050775 | positive regulation of dendrite morphogenesis |
| 3. B | GO:0032717 | negative regulation of interleukin-8 production |
| 3. B | GO:0060113 | inner ear receptor cell differentiation |
| 3. B | GO:0045967 | negative regulation of growth rate |
| 3. B | GO:0043034 | costamere |
| 3. B | GO:0021986 | habenula development |
| 3. B | GO:0018230 | peptidyl-L-cysteine S-palmitoylation |
| 3. B | GO:0032791 | lead ion binding |
| 3. B | GO:0031297 | replication fork processing |
| 3. B | GO:0030046 | parallel actin filament bundle assembly |
| 3. B | GO:0046843 | dorsal appendage formation |
| 3. B | GO:0016567 | protein ubiquitination |
| 3. B | GO:0051059 | NF-kappaB binding |
| 3. B | GO:0036166 | phenotypic switching |
| 3. B | GO:0046469 | platelet activating factor metabolic process |
| 3. B | GO:0044877 | protein-containing complex binding |
| 3. B | GO:0070986 | left/right axis specification |
| 3. B | GO:1990416 | cellular response to brain-derived neurotrophic factor stimulus |
| 3. B | GO:0005576 | extracellular region |
| 3. B | GO:0019887 | protein kinase regulator activity |
| 3. B | GO:0046974 | histone methyltransferase activity (H3-K9 specific) |
| 3. B | GO:0098908 | regulation of neuronal action potential |
| 3. B | GO:0018024 | histone-lysine N-methyltransferase activity |
| 3. B | GO:0010468 | regulation of gene expression |
| 3. B | GO:0045814 | negative regulation of gene expression, epigenetic |
| 3. B | GO:0021915 | neural tube development |
| 3. B | GO:0042805 | actinin binding |
| 3. B | GO:0002467 | germinal center formation |
| 3. B | GO:0036377 | arbuscular mycorrhizal association |
| 3. B | GO:0046473 | phosphatidic acid metabolic process |
| 3. B | GO:0007221 | positive regulation of transcription of Notch receptor target |
| 3. B | GO:0099612 | protein localization to axon |
| 3. B | GO:0061419 | positive regulation of transcription from RNA polymerase II promoter in response to hypoxia |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:1902041 | regulation of extrinsic apoptotic signaling pathway via death domain receptors |
| 3. B | GO:0098703 | calcium ion import across plasma membrane |
| 3. B | GO:0045669 | positive regulation of osteoblast differentiation |
| 3. B | GO:0042686 | regulation of cardioblast cell fate specification |
| 3. B | GO:0046338 | phosphatidylethanolamine catabolic process |
| 3. B | GO:0071260 | cellular response to mechanical stimulus |
| 3. B | GO:0097422 | tubular endosome |
| 3. B | GO:0071316 | cellular response to nicotine |
| 3. B | GO:0018027 | peptidyl-lysine dimethylation |
| 3. B | GO:0035176 | social behavior |
| 3. B | GO:0010960 | magnesium ion homeostasis |
| 3. B | GO:0005216 | ion channel activity |
| 3. B | GO:2001204 | regulation of osteoclast development |
| 3. B | GO:0048536 | spleen development |
| 3. B | GO:0042826 | histone deacetylase binding |
| 3. B | GO:1990090 | cellular response to nerve growth factor stimulus |
| 3. B | GO:0140261 | BCOR complex |
| 3. B | GO:0035418 | protein localization to synapse |
| 3. B | GO:0005886 | plasma membrane |
| 3. B | GO:0042325 | regulation of phosphorylation |
| 3. B | GO:0010614 | negative regulation of cardiac muscle hypertrophy |
| 3. B | GO:0021675 | nerve development |
| 3. B | GO:0035646 | endosome to melanosome transport |
| 3. B | GO:0044232 | organelle membrane contact site |
| 3. B | GO:0048899 | anterior lateral line development |
| 3. B | GO:0033147 | negative regulation of intracellular estrogen receptor signaling pathway |
| 3. B | GO:0062043 | positive regulation of cardiac epithelial to mesenchymal transition |
| 3. B | GO:0001222 | transcription corepressor binding |
| 3. B | GO:0045316 | negative regulation of compound eye photoreceptor development |
| 3. B | GO:0007009 | plasma membrane organization |
| 3. B | GO:0045607 | regulation of inner ear auditory receptor cell differentiation |
| 3. B | GO:0043292 | contractile fiber |
| 3. B | GO:0032996 | Bcl3-Bcl10 complex |
| 3. B | GO:0043517 | positive regulation of DNA damage response, signal transduction by p53 class mediator |
| 3. B | GO:0019843 | rRNA binding |
| 3. B | GO:0070212 | protein poly-ADP-ribosylation |
| 3. B | GO:2000048 | negative regulation of cell-cell adhesion mediated by cadherin |
| 3. B | GO:1904058 | positive regulation of sensory perception of pain |
| 3. B | GO:0060979 | vasculogenesis involved in coronary vascular morphogenesis |
| 3. B | GO:0007160 | cell-matrix adhesion |
| 3. B | GO:0000151 | ubiquitin ligase complex |
| 3. B | GO:0030160 | synaptic receptor adaptor activity |
| 3. B | GO:2000209 | regulation of anoikis |
| 3. B | GO:0045662 | negative regulation of myoblast differentiation |
| 3. B | GO:0019228 | neuronal action potential |
| 3. B | GO:0072017 | distal tubule development |
| 3. B | GO:0007440 | foregut morphogenesis |
| 3. B | GO:0048711 | positive regulation of astrocyte differentiation |
| 3. B | GO:0072073 | kidney epithelium development |
| 3. B | GO:0045859 | regulation of protein kinase activity |
| 3. B | GO:0004622 | lysophospholipase activity |
| 3. B | GO:0035023 | regulation of Rho protein signal transduction |
| 3. B | GO:0007386 | compartment pattern specification |
| 3. B | GO:0009925 | basal plasma membrane |
| 3. B | GO:0008022 | protein C-terminus binding |
| 3. B | GO:0010650 | positive regulation of cell communication by electrical coupling |
| 3. B | GO:0003181 | atrioventricular valve morphogenesis |
| 3. B | GO:0090051 | negative regulation of cell migration involved in sprouting angiogenesis |
| 3. B | GO:0021773 | striatal medium spiny neuron differentiation |
| 3. B | GO:0010638 | positive regulation of organelle organization |
| 3. B | GO:0060768 | regulation of epithelial cell proliferation involved in prostate gland development |
| 3. B | GO:0060998 | regulation of dendritic spine development |
| 3. B | GO:2000811 | negative regulation of anoikis |
| 3. B | GO:0048102 | autophagic cell death |
| 3. B | GO:0032934 | sterol binding |
| 3. B | GO:0045608 | negative regulation of inner ear auditory receptor cell differentiation |
| 3. B | GO:0055008 | cardiac muscle tissue morphogenesis |
| 3. B | GO:1901339 | regulation of store-operated calcium channel activity |
| 3. B | GO:2000630 | positive regulation of miRNA metabolic process |
| 3. B | GO:0014066 | regulation of phosphatidylinositol 3-kinase signaling |
| 3. B | GO:0006887 | exocytosis |
| 3. B | GO:0071314 | cellular response to cocaine |
| 3. B | GO:0000242 | pericentriolar material |
| 3. B | GO:0003197 | endocardial cushion development |
| 3. B | GO:0016604 | nuclear body |
| 3. B | GO:0003723 | RNA binding |
| 3. B | GO:0098685 | Schaffer collateral - CA1 synapse |
| 3. B | GO:0042665 | regulation of ectodermal cell fate specification |
| 3. B | GO:1903589 | positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis |
| 3. B | GO:0098907 | regulation of SA node cell action potential |
| 3. B | GO:0003203 | endocardial cushion morphogenesis |
| 3. B | GO:0008157 | protein phosphatase 1 binding |
| 3. B | GO:1900026 | positive regulation of substrate adhesion-dependent cell spreading |
| 3. B | GO:0035965 | cardiolipin acyl-chain remodeling |
| 3. B | GO:0003677 | DNA binding |
| 3. B | GO:0048471 | perinuclear region of cytoplasm |
| 3. B | GO:0086014 | atrial cardiac muscle cell action potential |
| 3. B | GO:0016409 | palmitoyltransferase activity |
| 3. B | GO:0008270 | zinc ion binding |
| 3. B | GO:0003184 | pulmonary valve morphogenesis |
| 3. B | GO:0030507 | spectrin binding |
| 3. B | GO:0032695 | negative regulation of interleukin-12 production |
| 3. B | GO:0003169 | coronary vein morphogenesis |
| 3. B | GO:0043518 | negative regulation of DNA damage response, signal transduction by p53 class mediator |
| 3. B | GO:1904908 | negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric |
| 3. B | GO:0060528 | secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development |
| 3. B | GO:0047389 | glycerophosphocholine phosphodiesterase activity |
| 3. B | GO:0002315 | marginal zone B cell differentiation |
| 3. B | GO:0010832 | negative regulation of myotube differentiation |
| 3. B | GO:0071532 | ankyrin repeat binding |
| 3. B | GO:0070682 | proteasome regulatory particle assembly |
| 3. B | GO:0070936 | protein K48-linked ubiquitination |
| 3. B | GO:0070412 | R-SMAD binding |
| 3. B | GO:0140439 | protein-cysteine S-stearoyltransferase activity |
| 3. B | GO:0051438 | regulation of ubiquitin-protein transferase activity |
| 3. B | GO:0045648 | positive regulation of erythrocyte differentiation |
| 3. B | GO:0031143 | pseudopodium |
| 3. B | GO:0032495 | response to muramyl dipeptide |
| 3. B | GO:0007368 | determination of left/right symmetry |
| 3. B | GO:0071244 | cellular response to carbon dioxide |
| 3. B | GO:0060982 | coronary artery morphogenesis |
| 3. B | GO:0007616 | long-term memory |
| 3. B | GO:0014069 | postsynaptic density |
| 3. B | GO:0045687 | positive regulation of glial cell differentiation |
| 3. B | GO:0070431 | nucleotide-binding oligomerization domain containing 2 signaling pathway |
| 3. B | GO:0001954 | positive regulation of cell-matrix adhesion |
| 3. B | GO:0051726 | regulation of cell cycle |
| 3. B | GO:0002268 | follicular dendritic cell differentiation |
| 3. B | GO:0001818 | negative regulation of cytokine production |
| 3. B | GO:0014912 | negative regulation of smooth muscle cell migration |
| 3. B | GO:0031359 | integral component of chloroplast outer membrane |
| 3. B | GO:0010780 | meiotic DNA double-strand break formation involved in reciprocal meiotic recombination |
| 3. B | GO:0071407 | cellular response to organic cyclic compound |
| 3. B | GO:0031867 | EP4 subtype prostaglandin E2 receptor binding |
| 3. B | GO:0015248 | sterol transporter activity |
| 3. B | GO:0048103 | somatic stem cell division |
| 3. B | GO:1902412 | regulation of mitotic cytokinesis |
| 3. B | GO:0043266 | regulation of potassium ion transport |
| 3. B | GO:0050955 | thermoception |
| 3. B | GO:0060843 | venous endothelial cell differentiation |
| 3. B | GO:0001838 | embryonic epithelial tube formation |
| 3. B | GO:2000651 | positive regulation of sodium ion transmembrane transporter activity |
| 3. B | GO:0006528 | asparagine metabolic process |
| 3. B | GO:0032496 | response to lipopolysaccharide |
| 3. B | GO:0140031 | phosphorylation-dependent protein binding |
| 3. B | GO:0050957 | equilibrioception |
| 3. B | GO:0003207 | cardiac chamber formation |
| 3. B | GO:0061384 | heart trabecula morphogenesis |
| 3. B | GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress |
| 3. B | GO:0048060 | negative gravitaxis |
| 3. B | GO:0072015 | glomerular visceral epithelial cell development |
| 3. B | GO:2000304 | positive regulation of ceramide biosynthetic process |
| 3. B | GO:0070171 | negative regulation of tooth mineralization |
| 3. B | GO:0030315 | T-tubule |
| 3. B | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process |
| 3. B | GO:0003209 | cardiac atrium morphogenesis |
| 3. B | GO:0090263 | positive regulation of canonical Wnt signaling pathway |
| 3. B | GO:0048052 | R1/R6 cell differentiation |
| 3. B | GO:1903670 | regulation of sprouting angiogenesis |
| 3. B | GO:0021531 | spinal cord radial glial cell differentiation |
| 3. B | GO:0010888 | negative regulation of lipid storage |
| 3. B | GO:0010761 | fibroblast migration |
| 3. B | GO:0005262 | calcium channel activity |
| 3. B | GO:2000969 | positive regulation of AMPA receptor activity |
| 3. B | GO:0017020 | myosin phosphatase regulator activity |
| 3. B | GO:0008290 | F-actin capping protein complex |
| 3. B | GO:0102545 | phosphatidyl phospholipase B activity |
| 3. B | GO:0097062 | dendritic spine maintenance |
| 3. B | GO:0031901 | early endosome membrane |
| 3. B | GO:0003213 | cardiac right atrium morphogenesis |
| 3. B | GO:0045869 | negative regulation of single stranded viral RNA replication via double stranded DNA intermediate |
| 3. B | GO:0045602 | negative regulation of endothelial cell differentiation |
| 3. B | GO:0050793 | regulation of developmental process |
| 3. B | GO:0098910 | regulation of atrial cardiac muscle cell action potential |
| 3. B | GO:0043194 | axon initial segment |
| 3. B | GO:0009912 | auditory receptor cell fate commitment |
| 3. B | GO:0030941 | chloroplast targeting sequence binding |
| 3. B | GO:0099527 | postsynapse to nucleus signaling pathway |
| 3. B | GO:0046849 | bone remodeling |
| 3. B | GO:2000249 | regulation of actin cytoskeleton reorganization |
| 3. B | GO:0048265 | response to pain |
| 3. B | GO:0016279 | protein-lysine N-methyltransferase activity |
| 3. B | GO:0043066 | negative regulation of apoptotic process |
| 3. B | GO:1904355 | positive regulation of telomere capping |
| 3. B | GO:0010745 | negative regulation of macrophage derived foam cell differentiation |
| 3. B | GO:0001895 | retina homeostasis |
| 3. B | GO:0031466 | Cul5-RING ubiquitin ligase complex |
| 3. B | GO:0097543 | ciliary inversin compartment |
| 3. B | GO:0017124 | SH3 domain binding |
| 3. B | GO:0003847 | 1-alkyl-2-acetylglycerophosphocholine esterase activity |
| 3. B | GO:0046822 | regulation of nucleocytoplasmic transport |
| 3. B | GO:0048170 | positive regulation of long-term neuronal synaptic plasticity |
| 3. B | GO:0003219 | cardiac right ventricle formation |
| 3. B | GO:0001658 | branching involved in ureteric bud morphogenesis |
| 3. B | GO:0017171 | serine hydrolase activity |
| 3. B | GO:0072144 | glomerular mesangial cell development |
| 3. B | GO:0016235 | aggresome |
| 3. B | GO:0060956 | endocardial cell differentiation |
| 3. B | GO:1904632 | cellular response to glucoside |
| 3. B | GO:1902230 | negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage |
| 3. B | GO:0042383 | sarcolemma |
| 3. B | GO:0071322 | cellular response to carbohydrate stimulus |
| 3. B | GO:1901189 | positive regulation of ephrin receptor signaling pathway |
| 3. B | GO:0070427 | nucleotide-binding oligomerization domain containing 1 signaling pathway |
| 3. B | GO:0034704 | calcium channel complex |
| 3. B | GO:0030030 | cell projection organization |
| 3. B | GO:0060038 | cardiac muscle cell proliferation |
| 3. B | GO:0030029 | actin filament-based process |
| 3. B | GO:0032212 | positive regulation of telomere maintenance via telomerase |
| 3. B | GO:0042297 | vocal learning |
| 3. B | GO:0002040 | sprouting angiogenesis |
| 3. B | GO:0061001 | regulation of dendritic spine morphogenesis |
| 3. B | GO:0045064 | T-helper 2 cell differentiation |
| 3. B | GO:0060236 | regulation of mitotic spindle organization |
| 3. B | GO:2000279 | negative regulation of DNA biosynthetic process |
| 3. B | GO:0045596 | negative regulation of cell differentiation |
| 3. B | GO:0061025 | membrane fusion |
| 3. B | GO:0051386 | regulation of neurotrophin TRK receptor signaling pathway |
| 3. B | GO:0097110 | scaffold protein binding |
| 3. B | GO:1990393 | 3M complex |
| 3. B | GO:0034184 | positive regulation of maintenance of mitotic sister chromatid cohesion |
| 3. B | GO:0060803 | BMP signaling pathway involved in mesodermal cell fate specification |
| 3. B | GO:0045618 | positive regulation of keratinocyte differentiation |
| 3. B | GO:0003180 | aortic valve morphogenesis |
| 3. B | GO:1990705 | cholangiocyte proliferation |
| 3. B | GO:0060013 | righting reflex |
| 3. B | GO:0050968 | detection of chemical stimulus involved in sensory perception of pain |
| 3. B | GO:0042246 | tissue regeneration |
| 3. B | GO:0003157 | endocardium development |
| 3. B | GO:0007229 | integrin-mediated signaling pathway |
| 3. B | GO:0002455 | humoral immune response mediated by circulating immunoglobulin |
| 3. B | GO:1900451 | positive regulation of glutamate receptor signaling pathway |
| 3. B | GO:1903343 | positive regulation of meiotic DNA double-strand break formation |
| 3. B | GO:0090029 | negative regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion |
| 3. B | GO:0046533 | negative regulation of photoreceptor cell differentiation |
| 3. B | GO:0097150 | neuronal stem cell population maintenance |
| 3. B | GO:0060045 | positive regulation of cardiac muscle cell proliferation |
| 3. B | GO:0048013 | ephrin receptor signaling pathway |
| 3. B | GO:1901019 | regulation of calcium ion transmembrane transporter activity |
| 3. B | GO:0035171 | lamellocyte differentiation |
| 3. B | GO:0031625 | ubiquitin protein ligase binding |
| 3. B | GO:0004067 | asparaginase activity |
| 3. B | GO:1903849 | positive regulation of aorta morphogenesis |
| 3. B | GO:0003713 | transcription coactivator activity |
| 3. B | GO:0045162 | clustering of voltage-gated sodium channels |
| 3. B | GO:0060413 | atrial septum morphogenesis |
| 3. B | GO:0051865 | protein autoubiquitination |
| 3. B | GO:0050728 | negative regulation of inflammatory response |
| 3. B | GO:0003192 | mitral valve formation |
| 3. B | GO:0043065 | positive regulation of apoptotic process |
| 3. B | GO:0008139 | nuclear localization sequence binding |
| 3. B | GO:0030027 | lamellipodium |
| 3. B | GO:0000415 | negative regulation of histone H3-K36 methylation |
| 3. B | GO:0033268 | node of Ranvier |
| 3. B | GO:0048665 | neuron fate specification |
| 3. B | GO:0090200 | positive regulation of release of cytochrome c from mitochondria |
| 3. B | GO:1904630 | cellular response to diterpene |
| 3. B | GO:0003264 | regulation of cardioblast proliferation |
| 3. B | GO:0019705 | protein-cysteine S-myristoyltransferase activity |
| 3. B | GO:0010613 | positive regulation of cardiac muscle hypertrophy |
| 3. B | GO:0043596 | nuclear replication fork |
| 3. B | GO:0001835 | blastocyst hatching |
| 3. B | GO:0050807 | regulation of synapse organization |
| 3. B | GO:0061314 | Notch signaling involved in heart development |
| 3. B | GO:0008361 | regulation of cell size |
| 3. B | GO:0071709 | membrane assembly |
| 3. B | GO:0015278 | calcium-release channel activity |
| 3. B | GO:0045921 | positive regulation of exocytosis |
| 3. B | GO:1990756 | ubiquitin ligase-substrate adaptor activity |
| 3. B | GO:0060992 | response to fungicide |
| 3. B | GO:2000463 | positive regulation of excitatory postsynaptic potential |
| 3. B | GO:0016290 | palmitoyl-CoA hydrolase activity |
| 3. B | GO:0014732 | skeletal muscle atrophy |
| 3. B | GO:0019899 | enzyme binding |
| 3. B | GO:0099173 | postsynapse organization |
| 3. B | GO:0051570 | regulation of histone H3-K9 methylation |
| 3. B | GO:0034587 | piRNA metabolic process |
| 3. B | GO:2000974 | negative regulation of pro-B cell differentiation |
| 3. B | GO:0060997 | dendritic spine morphogenesis |
| 3. B | GO:0048845 | venous blood vessel morphogenesis |
| 3. B | GO:1901018 | positive regulation of potassium ion transmembrane transporter activity |
| 3. B | GO:0050714 | positive regulation of protein secretion |
| 3. B | GO:0060135 | maternal process involved in female pregnancy |
| 3. B | GO:0031663 | lipopolysaccharide-mediated signaling pathway |
| 3. B | GO:2000311 | regulation of AMPA receptor activity |
| 3. B | GO:0086066 | atrial cardiac muscle cell to AV node cell communication |
| 3. B | GO:1901021 | positive regulation of calcium ion transmembrane transporter activity |
| 3. B | GO:1901224 | positive regulation of NIK/NF-kappaB signaling |
| 3. B | GO:0060253 | negative regulation of glial cell proliferation |
| 3. B | GO:0005925 | focal adhesion |
| 3. B | GO:0050966 | detection of mechanical stimulus involved in sensory perception of pain |
| 3. B | GO:0006621 | protein retention in ER lumen |
| 3. B | GO:0021707 | cerebellar granule cell differentiation |
| 3. B | GO:0033256 | I-kappaB/NF-kappaB complex |
| 3. B | GO:0014031 | mesenchymal cell development |
| 3. B | GO:0051151 | negative regulation of smooth muscle cell differentiation |
| 3. B | GO:0032991 | protein-containing complex |
| 3. B | GO:0046872 | metal ion binding |
| 3. B | GO:0035544 | negative regulation of SNARE complex assembly |
| 3. B | GO:0097553 | calcium ion transmembrane import into cytosol |
| 3. B | GO:2000821 | regulation of grooming behavior |
| 3. B | GO:0000139 | Golgi membrane |
| 3. B | GO:0035556 | intracellular signal transduction |
| 3. B | GO:0042326 | negative regulation of phosphorylation |
| 3. B | GO:0019706 | protein-cysteine S-palmitoyltransferase activity |
| 3. B | GO:0003273 | cell migration involved in endocardial cushion formation |
| 3. B | GO:0051572 | negative regulation of histone H3-K4 methylation |
| 3. B | GO:1903793 | positive regulation of anion transport |
| 3. B | GO:0070168 | negative regulation of biomineral tissue development |
| 3. B | GO:0044354 | macropinosome |
| 3. B | GO:1904357 | negative regulation of telomere maintenance via telomere lengthening |
| 3. B | GO:0061344 | regulation of cell adhesion involved in heart morphogenesis |
| 3. B | GO:0032088 | negative regulation of NF-kappaB transcription factor activity |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q6ZW76 | Ankyrin repeat and SAM domain-containing protein 3 | 3.55e-03 | 2.72e-02 | 1.35e-14 |
| 1. PB | Q9Y2G4 | Ankyrin repeat domain-containing protein 6 | 4.67e-06 | 9.38e-08 | 5.47e-12 |
| 1. PB | Q5U312 | Ankycorbin | 7.35e-05 | 3.44e-21 | 5.23e-14 |
| 1. PB | A2RUR9 | Coiled-coil domain-containing protein 144A | 7.37e-05 | 2.68e-05 | 5.42e-50 |
| 1. PB | Q5VUR7 | Putative ankyrin repeat domain-containing protein 20A3 | 6.56e-03 | 3.09e-11 | 8.97e-107 |
| 1. PB | Q8IYA2 | Putative coiled-coil domain-containing protein 144C | 8.98e-06 | 2.47e-02 | 1.22e-50 |
| 1. PB | Q5TYW2 | Ankyrin repeat domain-containing protein 20A1 | 2.07e-07 | 1.39e-11 | 3.60e-106 |
| 1. PB | Q9BZF9 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 7.74e-06 | 3.80e-13 | 1.02e-16 |
| 1. PB | Q3UUF8 | Ankyrin repeat domain-containing protein 34B | 1.65e-04 | 3.12e-05 | 0.038 |
| 1. PB | Q80VM7 | Ankyrin repeat domain-containing protein 24 | 7.25e-07 | 3.90e-05 | 9.14e-12 |
| 1. PB | Q8N283 | Ankyrin repeat domain-containing protein 35 | 1.33e-06 | 5.98e-21 | 1.34e-15 |
| 1. PB | Q9EP71 | Ankycorbin | 4.95e-08 | 7.59e-20 | 7.69e-16 |
| 1. PB | Q5PQ89 | Ankyrin repeat domain-containing protein 34B | 3.08e-03 | 1.87e-02 | 0.002 |
| 1. PB | Q69ZU8 | Ankyrin repeat domain-containing protein 6 | 2.79e-06 | 6.42e-05 | 1.22e-12 |
| 1. PB | Q8HYY4 | Uveal autoantigen with coiled-coil domains and ankyrin repeats protein | 7.71e-11 | 3.13e-11 | 3.94e-16 |
| 1. PB | Q4UJ75 | Putative ankyrin repeat domain-containing protein 20A4 | 6.81e-10 | 2.06e-10 | 4.43e-106 |
| 1. PB | Q8CGB3 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 1.44e-05 | 4.98e-15 | 2.69e-14 |
| 1. PB | Q90623 | Protein phosphatase 1 regulatory subunit 12A | 6.51e-04 | 6.13e-03 | 3.58e-07 |
| 1. PB | Q5CZ79 | Ankyrin repeat domain-containing protein 20B | 1.60e-05 | 1.35e-10 | 2.32e-114 |
| 1. PB | Q811D2 | Ankyrin repeat domain-containing protein 26 | 8.81e-06 | 5.76e-16 | 4.60e-98 |
| 1. PB | Q9GL21 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 1.63e-07 | 1.66e-10 | 6.16e-17 |
| 1. PB | Q9UPS8 | Ankyrin repeat domain-containing protein 26 | 7.07e-03 | 1.16e-12 | 3.04e-162 |
| 1. PB | Q5SQ80 | Putative ankyrin repeat domain-containing protein 20A2 | 1.34e-08 | 4.22e-11 | 8.88e-107 |
| 1. PB | Q9P0K7 | Ankycorbin | 5.35e-07 | 1.18e-22 | 1.64e-15 |
| 1. PB | O60237 | Protein phosphatase 1 regulatory subunit 12B | 3.76e-03 | 5.53e-03 | 8.66e-05 |
| 1. PB | Q3UYR4 | Espin-like protein | 7.27e-04 | 1.59e-05 | 1.31e-04 |
| 1. PB | A2A2Z9 | Ankyrin repeat domain-containing protein 18B | 0 | 1.53e-157 | 0.0 |
| 1. PB | Q8BG95 | Protein phosphatase 1 regulatory subunit 12B | 3.67e-03 | 1.99e-03 | 3.31e-05 |
| 1. PB | Q6ZVH7 | Espin-like protein | 6.57e-04 | 3.43e-06 | 0.006 |
| 1. PB | Q5M9H0 | Ankyrin repeat and SAM domain-containing protein 3 | 2.56e-04 | 2.19e-02 | 8.70e-15 |
| 1. PB | Q8IVF6 | Ankyrin repeat domain-containing protein 18A | 1.33e-15 | 3.07e-96 | 0.0 |
| 2. P | Q6NRB0 | Protein Hook homolog 2 | 1.04e-06 | 2.64e-02 | NA |
| 2. P | Q07732 | Accumulates dyads protein 3 | 5.53e-06 | 2.59e-03 | NA |
| 2. P | A6H5Y1 | M-phase phosphoprotein 9 | 1.50e-01 | 1.02e-02 | NA |
| 2. P | Q17AF4 | Protein hook | 2.58e-04 | 4.01e-02 | NA |
| 2. P | A6NC57 | Ankyrin repeat domain-containing protein 62 | 2.56e-09 | 6.57e-24 | NA |
| 2. P | Q62839 | Golgin subfamily A member 2 | 3.74e-05 | 1.01e-02 | NA |
| 2. P | Q69YU3 | Ankyrin repeat domain-containing protein 34A | 2.65e-03 | 1.33e-04 | NA |
| 2. P | Q96ST8 | Centrosomal protein of 89 kDa | 2.86e-04 | 1.02e-02 | NA |
| 2. P | P0C6C1 | Ankyrin repeat domain-containing protein 34C | 2.87e-03 | 8.40e-03 | NA |
| 2. P | Q5BJT1 | Ankyrin repeat domain-containing protein 34A | 4.77e-04 | 3.20e-04 | NA |
| 2. P | A5PLL1 | Ankyrin repeat domain-containing protein 34B | 2.81e-03 | 4.97e-04 | NA |
| 2. P | Q9UTR7 | Meiotic coiled-coil protein 3 | 3.42e-05 | 4.27e-03 | NA |
| 2. P | P41467 | Protein Ac66 | NA | 8.02e-04 | NA |
| 2. P | F1M5M3 | Inactive serine/threonine-protein kinase TEX14 | NA | 3.66e-03 | NA |
| 3. B | Q9H560 | Putative ankyrin repeat domain-containing protein 19 | 0.00e+00 | NA | 4.51e-169 |
| 3. B | Q8N9V6 | Ankyrin repeat domain-containing protein 53 | 4.69e-04 | NA | 1.42e-04 |
| 3. B | Q8VHS6 | Ankyrin repeat and SOCS box protein 15 | 2.86e-03 | NA | 8.79e-07 |
| 3. B | Q8BX02 | KN motif and ankyrin repeat domain-containing protein 2 | 8.83e-03 | NA | 1.23e-05 |
| 3. B | Q9J5H9 | Putative ankyrin repeat protein FPV022 | NA | NA | 5.36e-04 |
| 3. B | Q8IUH5 | Palmitoyltransferase ZDHHC17 | 2.65e-05 | NA | 1.05e-15 |
| 3. B | Q54KA7 | Ankyrin repeat, PH and SEC7 domain containing protein secG | 7.76e-04 | NA | 3.46e-21 |
| 3. B | Q0V8G2 | GA-binding protein subunit beta-2 | 1.26e-04 | NA | 3.38e-07 |
| 3. B | P59672 | Ankyrin repeat and SAM domain-containing protein 1A | 3.84e-03 | NA | 0.002 |
| 3. B | O14974 | Protein phosphatase 1 regulatory subunit 12A | 6.72e-04 | NA | 2.04e-06 |
| 3. B | Q99NH0 | Ankyrin repeat domain-containing protein 17 | 2.29e-02 | NA | 2.04e-15 |
| 3. B | Q7ZYD9 | Ankyrin repeat domain-containing protein 13C-B | 2.31e-01 | NA | 0.013 |
| 3. B | Q2QL84 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.25e-04 | NA | 8.45e-04 |
| 3. B | A9JR78 | Tonsoku-like protein | 4.88e-01 | NA | 4.58e-07 |
| 3. B | P57078 | Receptor-interacting serine/threonine-protein kinase 4 | 2.13e-04 | NA | 1.20e-09 |
| 3. B | Q6P9J5 | KN motif and ankyrin repeat domain-containing protein 4 | 1.63e-01 | NA | 8.55e-07 |
| 3. B | Q499M5 | Ankyrin repeat domain-containing protein 16 | 2.29e-05 | NA | 4.02e-05 |
| 3. B | Q3TYL0 | IQ motif and ankyrin repeat domain-containing protein 1 | 2.13e-03 | NA | 0.009 |
| 3. B | Q9Y575 | Ankyrin repeat and SOCS box protein 3 | 2.19e-03 | NA | 2.32e-06 |
| 3. B | Q2QLB5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.14e-04 | NA | 2.31e-05 |
| 3. B | Q1LZC5 | Ankyrin repeat domain-containing protein 54 | 3.47e-03 | NA | 6.31e-05 |
| 3. B | P0C6P7 | Protein fem-1 homolog B | 4.25e-03 | NA | 1.37e-06 |
| 3. B | Q8CEF1 | Protein fem-1 homolog C | 5.11e-05 | NA | 2.18e-06 |
| 3. B | Q9WV74 | Ankyrin repeat and SOCS box protein 1 | 5.87e-05 | NA | 0.002 |
| 3. B | Q9J5H8 | Putative ankyrin repeat protein FPV023 | NA | NA | 1.86e-07 |
| 3. B | D3J162 | Protein VAPYRIN | 2.44e-04 | NA | 1.41e-07 |
| 3. B | Q0P5B9 | Ankyrin repeat domain-containing protein 39 | 2.42e-06 | NA | 3.90e-07 |
| 3. B | Q06527 | Ankyrin homolog | 4.62e-05 | NA | 3.91e-09 |
| 3. B | Q8N7Z5 | Ankyrin repeat domain-containing protein 31 | 6.59e-02 | NA | 6.90e-05 |
| 3. B | Q01317 | Ankyrin repeat protein nuc-2 | 2.35e-02 | NA | 2.77e-06 |
| 3. B | Q566C8 | Ankyrin repeat domain-containing protein 54 | 7.26e-03 | NA | 1.61e-05 |
| 3. B | Q641X1 | Ankyrin repeat domain-containing protein 61 | 3.84e-06 | NA | 4.43e-04 |
| 3. B | P14585 | Protein lin-12 | 1.40e-04 | NA | 0.001 |
| 3. B | Q96T49 | Protein phosphatase 1 regulatory inhibitor subunit 16B | 3.63e-06 | NA | 6.93e-04 |
| 3. B | O14593 | DNA-binding protein RFXANK | 1.53e-05 | NA | 0.008 |
| 3. B | Q8LSQ2 | Probable signal recognition particle 43 kDa protein, chloroplastic | 3.37e-02 | NA | 1.29e-04 |
| 3. B | Q9H1D0 | Transient receptor potential cation channel subfamily V member 6 | 1.76e-04 | NA | 0.014 |
| 3. B | Q99466 | Neurogenic locus notch homolog protein 4 | 6.68e-04 | NA | 3.18e-04 |
| 3. B | Q8K4M9 | Oxysterol-binding protein-related protein 1 | 1.44e-03 | NA | 0.003 |
| 3. B | Q00PJ3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.35e-05 | NA | 3.58e-05 |
| 3. B | P62774 | Myotrophin | 2.61e-05 | NA | 0.001 |
| 3. B | Q07E41 | Cortactin-binding protein 2 | 6.29e-02 | NA | 0.002 |
| 3. B | Q9Y576 | Ankyrin repeat and SOCS box protein 1 | 1.95e-05 | NA | 0.004 |
| 3. B | Q9Z2X2 | 26S proteasome non-ATPase regulatory subunit 10 | 1.16e-11 | NA | 6.36e-13 |
| 3. B | Q95N27 | Protein phosphatase 1 regulatory inhibitor subunit 16B | 2.56e-06 | NA | 6.76e-04 |
| 3. B | P97819 | 85/88 kDa calcium-independent phospholipase A2 | 8.65e-03 | NA | 7.73e-08 |
| 3. B | Q8N6S4 | Ankyrin repeat domain-containing protein 13C | 3.80e-01 | NA | 0.031 |
| 3. B | Q9WV06 | Ankyrin repeat domain-containing protein 2 | 2.20e-03 | NA | 6.61e-11 |
| 3. B | Q02357 | Ankyrin-1 | 6.77e-03 | NA | 7.61e-12 |
| 3. B | O44997 | Death-associated protein kinase dapk-1 | 7.15e-02 | NA | 2.37e-05 |
| 3. B | Q5FVC7 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 8.40e-03 | NA | 0.001 |
| 3. B | P41412 | Cell division cycle-related protein res2/pct1 | 3.24e-04 | NA | 2.69e-06 |
| 3. B | Q2QLC6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.02e-04 | NA | 4.03e-04 |
| 3. B | Q4ULZ2 | Putative ankyrin repeat protein RF_0580 | 8.30e-06 | NA | 1.43e-08 |
| 3. B | Q8N8A2 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 1.71e-02 | NA | 6.78e-13 |
| 3. B | Q9D504 | Ankyrin repeat domain-containing protein 7 | 1.72e-12 | NA | 1.85e-64 |
| 3. B | Q9NU02 | Ankyrin repeat and EF-hand domain-containing protein 1 | 8.27e-03 | NA | 1.49e-04 |
| 3. B | Q29RM5 | Protein fem-1 homolog A | 6.41e-05 | NA | 1.05e-05 |
| 3. B | Q9ZU96 | Ankyrin repeat-containing protein At2g01680 | 1.65e-07 | NA | 1.48e-04 |
| 3. B | Q5ZK62 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 4.21e-03 | NA | 2.58e-04 |
| 3. B | Q5TYM7 | CARD- and ANK-domain containing inflammasome adapter protein | 2.23e-03 | NA | 2.30e-11 |
| 3. B | Q21920 | Ankyrin repeat and KH domain-containing protein mask-1 | 9.08e-02 | NA | 7.18e-09 |
| 3. B | Q65XV2 | E3 ubiquitin-protein ligase XB3 | 8.35e-06 | NA | 6.08e-07 |
| 3. B | Q5R6D7 | Ankyrin repeat and SOCS box protein 8 | 2.97e-04 | NA | 4.92e-12 |
| 3. B | S0DPL8 | Apicidin F cluster transcription factor apf2 | 4.11e-02 | NA | 1.72e-04 |
| 3. B | A1ZBY1 | Protein fem-1 homolog B | 8.94e-03 | NA | 8.17e-05 |
| 3. B | Q08353 | NF-kappa-B inhibitor alpha | 9.74e-07 | NA | 3.05e-07 |
| 3. B | Q554E7 | Putative ZDHHC-type palmitoyltransferase 5 | 4.34e-05 | NA | 1.07e-04 |
| 3. B | Q14DN9 | Ankyrin repeat and death domain-containing protein 1B | 8.81e-04 | NA | 5.12e-10 |
| 3. B | A6QL64 | Ankyrin repeat domain-containing protein 36A | 2.78e-04 | NA | 5.88e-64 |
| 3. B | Q9VUX2 | E3 ubiquitin-protein ligase mind-bomb | 9.13e-03 | NA | 1.36e-08 |
| 3. B | Q4JHE0 | Probable E3 ubiquitin-protein ligase XBOS36 | 5.08e-04 | NA | 0.004 |
| 3. B | P53356 | Tyrosine-protein kinase HTK16 | 1.95e-02 | NA | 0.001 |
| 3. B | Q9SQK3 | Ankyrin repeat domain-containing protein EMB506, chloroplastic | 4.48e-05 | NA | 6.07e-11 |
| 3. B | Q7T0Q1 | Myotrophin | 3.88e-05 | NA | 0.017 |
| 3. B | Q6NRD0 | Ankyrin repeat domain-containing protein 13C-A | 1.49e-01 | NA | 0.021 |
| 3. B | Q6P6B7 | Ankyrin repeat domain-containing protein 16 | 1.61e-05 | NA | 9.88e-05 |
| 3. B | A2AQH4 | BCL-6 corepressor-like protein 1 | 4.83e-01 | NA | 9.70e-05 |
| 3. B | O70511 | Ankyrin-3 | 3.04e-02 | NA | 9.68e-16 |
| 3. B | Q3U0D9 | E3 ubiquitin-protein ligase HACE1 | 6.50e-03 | NA | 3.69e-12 |
| 3. B | Q5R8C8 | Ankyrin repeat domain-containing protein 46 | 7.50e-03 | NA | 0.007 |
| 3. B | Q9Z2X3 | 26S proteasome non-ATPase regulatory subunit 10 | 9.76e-12 | NA | 1.04e-10 |
| 3. B | P24769 | Ankyrin repeat protein B4 | NA | NA | 0.023 |
| 3. B | Q9TXQ1 | Poly [ADP-ribose] polymerase tankyrase | 4.70e-03 | NA | 1.79e-05 |
| 3. B | Q7Z8U2 | Palmitoyltransferase akr1 | 2.76e-04 | NA | 7.37e-07 |
| 3. B | Q7T163 | Kinase D-interacting substrate of 220 kDa B | 8.68e-05 | NA | 6.89e-13 |
| 3. B | Q9NQA5 | Transient receptor potential cation channel subfamily V member 5 | 1.07e-03 | NA | 0.005 |
| 3. B | Q68DC2 | Ankyrin repeat and SAM domain-containing protein 6 | 1.71e-03 | NA | 2.19e-04 |
| 3. B | Q9J505 | Putative ankyrin repeat protein FPV230 | NA | NA | 0.005 |
| 3. B | A1X154 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.34e-04 | NA | 2.97e-05 |
| 3. B | Q7XUW4 | Potassium channel KOR2 | 1.15e-01 | NA | 8.51e-06 |
| 3. B | Q6RI86 | Transient receptor potential cation channel subfamily A member 1 | 2.45e-04 | NA | 2.52e-05 |
| 3. B | Q15057 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 5.97e-03 | NA | 0.001 |
| 3. B | Q1RMI3 | GA-binding protein subunit beta-1 | 2.30e-04 | NA | 2.36e-08 |
| 3. B | Q9WV48 | SH3 and multiple ankyrin repeat domains protein 1 | 2.37e-02 | NA | 1.85e-04 |
| 3. B | Q8N2N9 | Ankyrin repeat domain-containing protein 36B | 2.08e-05 | NA | 1.40e-66 |
| 3. B | Q63369 | Nuclear factor NF-kappa-B p105 subunit (Fragment) | 1.41e-04 | NA | 1.07e-06 |
| 3. B | Q28C34 | Ankyrin repeat domain-containing protein 13C | 4.33e-01 | NA | 0.032 |
| 3. B | Q10311 | Ankyrin repeat-containing protein C6C3.08 | 1.55e-08 | NA | 6.11e-06 |
| 3. B | A2A690 | Protein TANC2 | 2.52e-02 | NA | 7.69e-10 |
| 3. B | A5A3E0 | POTE ankyrin domain family member F | 1.38e-07 | NA | 5.12e-65 |
| 3. B | Q07DW4 | Cortactin-binding protein 2 | 6.98e-02 | NA | 8.53e-05 |
| 3. B | Q4R3S3 | Ankyrin repeat domain-containing protein 7 | 3.48e-10 | NA | 3.91e-65 |
| 3. B | Q38898 | Potassium channel AKT2/3 | 1.44e-01 | NA | 6.56e-05 |
| 3. B | Q8CGN4 | BCL-6 corepressor | 1.06e-01 | NA | 6.54e-04 |
| 3. B | Q61982 | Neurogenic locus notch homolog protein 3 | 1.34e-03 | NA | 0.002 |
| 3. B | Q7T3P8 | Protein fem-1 homolog C | 7.91e-04 | NA | 2.24e-05 |
| 3. B | Q5UPX1 | Putative ankyrin repeat protein L289 | NA | NA | 7.53e-04 |
| 3. B | Q9Z2F6 | B-cell lymphoma 3 protein homolog | 1.03e-07 | NA | 1.97e-08 |
| 3. B | P17221 | Sex-determining protein fem-1 | 4.33e-04 | NA | 6.22e-06 |
| 3. B | O83515 | Putative ankyrin repeat-containing protein TP_0502 | 1.46e-04 | NA | 0.002 |
| 3. B | A7MB89 | Protein fem-1 homolog C | 7.27e-04 | NA | 2.07e-06 |
| 3. B | Q9WTT2 | Caseinolytic peptidase B protein homolog | 6.49e-02 | NA | 2.84e-04 |
| 3. B | Q80T11 | Usher syndrome type-1G protein homolog | 2.89e-04 | NA | 7.55e-05 |
| 3. B | Q9D2J7 | Ankyrin repeat and EF-hand domain-containing protein 1 | 1.36e-03 | NA | 6.39e-06 |
| 3. B | Q5UPH1 | Putative ankyrin repeat protein L99 | NA | NA | 0.010 |
| 3. B | Q9H2K2 | Poly [ADP-ribose] polymerase tankyrase-2 | 1.17e-01 | NA | 3.09e-09 |
| 3. B | Q9D061 | Acyl-CoA-binding domain-containing protein 6 | 5.94e-03 | NA | 2.86e-04 |
| 3. B | Q2TB02 | NF-kappa-B inhibitor delta | 7.00e-06 | NA | 0.006 |
| 3. B | Q8VHA6 | Ankyrin repeat and SOCS box protein 18 | 6.83e-04 | NA | 0.003 |
| 3. B | Q9BXX2 | Ankyrin repeat domain-containing protein 30B | 7.99e-05 | NA | 3.45e-60 |
| 3. B | Q06547 | GA-binding protein subunit beta-1 | 3.34e-05 | NA | 2.78e-08 |
| 3. B | A6NHY2 | Ankyrin repeat and death domain-containing protein 1B | 3.97e-04 | NA | 5.37e-10 |
| 3. B | Q91ZT7 | Ankyrin repeat and SOCS box protein 10 | 4.18e-04 | NA | 4.37e-09 |
| 3. B | P55273 | Cyclin-dependent kinase 4 inhibitor D | 2.39e-05 | NA | 1.34e-07 |
| 3. B | Q5RCK5 | Ankyrin repeat and SOCS box protein 7 | 2.41e-05 | NA | 1.47e-09 |
| 3. B | Q8UVC1 | Inversin | 8.62e-05 | NA | 5.52e-12 |
| 3. B | P0CG39 | POTE ankyrin domain family member J | 2.01e-04 | NA | 4.56e-65 |
| 3. B | P46530 | Neurogenic locus notch homolog protein 1 | 1.50e-02 | NA | 0.003 |
| 3. B | Q6ZVZ8 | Ankyrin repeat and SOCS box protein 18 | 2.54e-05 | NA | 1.30e-07 |
| 3. B | Q6TGW5 | Osteoclast-stimulating factor 1 | 2.22e-04 | NA | 0.002 |
| 3. B | Q2IBE3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 8.17e-05 | NA | 0.004 |
| 3. B | Q63618 | Espin | 2.42e-04 | NA | 0.002 |
| 3. B | Q1RIZ4 | Putative ankyrin repeat protein RBE_0589 | 3.02e-03 | NA | 8.49e-09 |
| 3. B | B9EJA2 | Cortactin-binding protein 2 | 9.27e-02 | NA | 0.026 |
| 3. B | Q8IWB6 | Inactive serine/threonine-protein kinase TEX14 | 4.07e-01 | NA | 0.028 |
| 3. B | Q3UES3 | Poly [ADP-ribose] polymerase tankyrase-2 | 2.01e-02 | NA | 2.39e-09 |
| 3. B | A5WVX9 | Palmitoyltransferase ZDHHC17 | 2.87e-05 | NA | 2.59e-15 |
| 3. B | Q9J504 | Putative ankyrin repeat protein FPV231 | NA | NA | 1.71e-12 |
| 3. B | Q91ZT9 | Ankyrin repeat and SOCS box protein 8 | 3.20e-05 | NA | 1.10e-12 |
| 3. B | Q6W2J9 | BCL-6 corepressor | 8.48e-02 | NA | 6.43e-04 |
| 3. B | F1LTE0 | Protein TANC2 | 5.90e-02 | NA | 7.43e-10 |
| 3. B | B1AK53 | Espin | 3.19e-03 | NA | 0.012 |
| 3. B | Q495M9 | Usher syndrome type-1G protein | 1.67e-02 | NA | 8.16e-05 |
| 3. B | Q9ERC1 | Unconventional myosin-XVI | 1.51e-02 | NA | 3.20e-07 |
| 3. B | Q9P2R3 | Rabankyrin-5 | 2.16e-02 | NA | 1.40e-09 |
| 3. B | Q8BZ25 | Ankyrin repeat and protein kinase domain-containing protein 1 | 2.23e-05 | NA | 2.69e-11 |
| 3. B | Q8UVC3 | Inversin | 1.26e-04 | NA | 8.29e-12 |
| 3. B | Q9SCX5 | Probable potassium channel AKT5 | 2.42e-01 | NA | 1.44e-05 |
| 3. B | Q2QLG0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.28e-05 | NA | 8.05e-04 |
| 3. B | Q05823 | 2-5A-dependent ribonuclease | 1.39e-02 | NA | 9.30e-07 |
| 3. B | P57044 | Integrin-linked protein kinase | 1.86e-02 | NA | 4.26e-09 |
| 3. B | Q8ZWC4 | Putative ankyrin repeat protein PAE1861 | 8.14e-08 | NA | 2.21e-07 |
| 3. B | Q91XL9 | Oxysterol-binding protein-related protein 1 | 3.23e-04 | NA | 0.002 |
| 3. B | O54910 | NF-kappa-B inhibitor epsilon | 1.31e-08 | NA | 9.70e-09 |
| 3. B | Q75HP9 | Potassium channel AKT2 | 1.11e-01 | NA | 0.002 |
| 3. B | Q4X251 | Palmitoyltransferase akr1 | 1.37e-04 | NA | 9.19e-08 |
| 3. B | Q12013 | Probable palmitoyltransferase AKR2 | 2.30e-04 | NA | 2.61e-04 |
| 3. B | Q8WMX7 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 4.18e-06 | NA | 0.001 |
| 3. B | Q08E43 | Ankyrin repeat and SOCS box protein 8 | 2.81e-05 | NA | 7.95e-12 |
| 3. B | Q5UPG6 | Putative ankyrin repeat protein L92 | NA | NA | 8.68e-06 |
| 3. B | Q8VBX0 | Ankyrin repeat and SOCS box protein 13 | 1.73e-07 | NA | 4.81e-08 |
| 3. B | B7WN72 | Protein shank | 4.06e-03 | NA | 1.87e-05 |
| 3. B | Q14678 | KN motif and ankyrin repeat domain-containing protein 1 | 2.09e-01 | NA | 4.28e-04 |
| 3. B | Q9Z205 | DNA-binding protein RFXANK | 1.45e-05 | NA | 0.002 |
| 3. B | Q9BXW6 | Oxysterol-binding protein-related protein 1 | 1.49e-03 | NA | 0.002 |
| 3. B | Q00653 | Nuclear factor NF-kappa-B p100 subunit | 1.14e-03 | NA | 2.24e-07 |
| 3. B | Q5ZLC8 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 4.76e-02 | NA | 6.35e-12 |
| 3. B | Q68LP1 | E3 ubiquitin-protein ligase MIB2 | 4.27e-04 | NA | 5.75e-05 |
| 3. B | Q01484 | Ankyrin-2 | NA | NA | 2.99e-15 |
| 3. B | Q9UK73 | Protein fem-1 homolog B | 3.07e-05 | NA | 1.37e-06 |
| 3. B | F8W2M1 | E3 ubiquitin-protein ligase HACE1 | 3.00e-03 | NA | 1.81e-14 |
| 3. B | Q9WV71 | Ankyrin repeat and SOCS box protein 4 | 9.30e-04 | NA | 1.85e-07 |
| 3. B | Q2QLH1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.18e-04 | NA | 0.001 |
| 3. B | Q4R739 | Ankyrin repeat domain-containing protein 53 | 5.23e-04 | NA | 1.05e-04 |
| 3. B | Q9J513 | Putative ankyrin repeat protein FPV222 | NA | NA | 1.11e-05 |
| 3. B | Q9DBR7 | Protein phosphatase 1 regulatory subunit 12A | 8.26e-04 | NA | 3.66e-06 |
| 3. B | Q9U518 | L-asparaginase | 1.68e-03 | NA | 1.24e-04 |
| 3. B | Q9Y283 | Inversin | 1.35e-04 | NA | 7.52e-11 |
| 3. B | Q495B1 | Ankyrin repeat and death domain-containing protein 1A | 7.93e-04 | NA | 2.72e-11 |
| 3. B | Q9M8S6 | Potassium channel SKOR | 1.95e-01 | NA | 1.02e-08 |
| 3. B | Q9ULH0 | Kinase D-interacting substrate of 220 kDa | 1.51e-04 | NA | 2.28e-12 |
| 3. B | G3I6Z6 | Neurogenic locus notch homolog protein 1 | NA | NA | 0.001 |
| 3. B | Q9BGT9 | Ankyrin repeat and SOCS box protein 7 | 2.38e-05 | NA | 2.03e-09 |
| 3. B | P14360 | Putative ankyrin repeat protein FPV240 | NA | NA | 2.55e-08 |
| 3. B | O70445 | BRCA1-associated RING domain protein 1 | 1.65e-02 | NA | 1.96e-09 |
| 3. B | Q4UKJ3 | Putative ankyrin repeat protein RF_1087 | 1.03e-03 | NA | 4.39e-07 |
| 3. B | Q09YK6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 4.79e-04 | NA | 8.78e-04 |
| 3. B | Q5UPG5 | Putative ankyrin repeat protein L93 | NA | NA | 1.02e-12 |
| 3. B | Q86SG2 | Ankyrin repeat domain-containing protein 23 | 2.22e-05 | NA | 3.68e-09 |
| 3. B | Q9J502 | Putative ankyrin repeat protein FPV233 | NA | NA | 5.68e-08 |
| 3. B | Q91WK7 | Ankyrin repeat domain-containing protein 54 | 1.24e-02 | NA | 1.64e-05 |
| 3. B | Q876L4 | Probable palmitoyltransferase AKR2 | 3.04e-04 | NA | 6.35e-05 |
| 3. B | Q9WV72 | Ankyrin repeat and SOCS box protein 3 | 1.43e-04 | NA | 1.69e-04 |
| 3. B | Q5U2S6 | Ankyrin repeat and SOCS box protein 2 | 4.34e-04 | NA | 1.81e-06 |
| 3. B | Q80SY4 | E3 ubiquitin-protein ligase MIB1 | 1.18e-03 | NA | 2.69e-12 |
| 3. B | Q876L5 | Palmitoyltransferase AKR1 | 7.75e-05 | NA | 5.83e-06 |
| 3. B | Q4I8B6 | Palmitoyltransferase AKR1 | 1.24e-05 | NA | 2.77e-04 |
| 3. B | P16157 | Ankyrin-1 | 7.04e-03 | NA | 1.79e-13 |
| 3. B | O88202 | 60 kDa lysophospholipase | 1.04e-02 | NA | 0.001 |
| 3. B | Q502M6 | Ankyrin repeat domain-containing protein 29 | 5.16e-06 | NA | 2.17e-06 |
| 3. B | Q6S8J3 | POTE ankyrin domain family member E | 5.40e-03 | NA | 6.63e-65 |
| 3. B | Q96I34 | Protein phosphatase 1 regulatory subunit 16A | 3.45e-05 | NA | 2.07e-04 |
| 3. B | Q0VGY8 | Protein TANC1 | 3.37e-02 | NA | 8.35e-12 |
| 3. B | P0C0T2 | Ankyrin repeat and SAM domain-containing protein 6 | 1.84e-03 | NA | 3.76e-05 |
| 3. B | O95271 | Poly [ADP-ribose] polymerase tankyrase-1 | 3.94e-02 | NA | 2.08e-09 |
| 3. B | G0LXV8 | Alpha-latrotoxin-Lh1a (Fragment) | 5.11e-02 | NA | 1.91e-10 |
| 3. B | Q8WWX0 | Ankyrin repeat and SOCS box protein 5 | 6.39e-07 | NA | 6.86e-06 |
| 3. B | Q15027 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 | 1.76e-03 | NA | 0.002 |
| 3. B | Q9Y566 | SH3 and multiple ankyrin repeat domains protein 1 | 1.96e-02 | NA | 7.98e-04 |
| 3. B | Q653P0 | Potassium channel KOR1 | 4.17e-02 | NA | 6.69e-08 |
| 3. B | Q6PFX9 | Poly [ADP-ribose] polymerase tankyrase-1 | 4.75e-02 | NA | 1.65e-09 |
| 3. B | Q9J5I3 | Putative ankyrin repeat protein FPV018 | NA | NA | 3.20e-07 |
| 3. B | Q2IBG0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 5.87e-05 | NA | 2.26e-04 |
| 3. B | Q94B55 | Putative E3 ubiquitin-protein ligase XBAT31 | 9.60e-06 | NA | 1.11e-05 |
| 3. B | Q6P1S6 | Myotrophin | 3.13e-05 | NA | 0.015 |
| 3. B | C7B178 | Protein VAPYRIN | 2.87e-06 | NA | 1.68e-08 |
| 3. B | Q9D1A4 | Ankyrin repeat and SOCS box protein 5 | 1.15e-06 | NA | 8.44e-07 |
| 3. B | Q5R4M7 | Ankyrin repeat and SOCS box protein 6 | 1.74e-03 | NA | 0.030 |
| 3. B | Q875M2 | Palmitoyltransferase AKR1 | 1.52e-05 | NA | 2.95e-05 |
| 3. B | Q71S21 | Inversin-B | 4.85e-04 | NA | 4.26e-13 |
| 3. B | Q8VHK2 | Caskin-1 | 1.06e-02 | NA | 1.32e-08 |
| 3. B | Q29Q26 | Ankyrin repeat domain-containing protein 2B | 2.07e-02 | NA | 1.66e-06 |
| 3. B | Q7Z020 | Transient receptor potential cation channel subfamily A member 1 | 9.96e-04 | NA | 0.004 |
| 3. B | Q5JPF3 | Ankyrin repeat domain-containing protein 36C | 1.61e-01 | NA | 8.63e-65 |
| 3. B | Q4P6L3 | Palmitoyltransferase AKR1 | 8.59e-04 | NA | 2.71e-07 |
| 3. B | Q3V096 | Ankyrin repeat domain-containing protein 42 | 2.99e-06 | NA | 1.35e-04 |
| 3. B | Q6DGX3 | Ankyrin repeat domain-containing protein 54 | 3.15e-03 | NA | 6.87e-04 |
| 3. B | O13987 | Ankyrin and IPT/TIG repeat-containing protein C26H5.05 | 1.10e-01 | NA | 0.002 |
| 3. B | Q96AX9 | E3 ubiquitin-protein ligase MIB2 | 2.56e-03 | NA | 8.24e-06 |
| 3. B | A0A3L7I2I8 | 85/88 kDa calcium-independent phospholipase A2 | 1.81e-02 | NA | 5.14e-08 |
| 3. B | Q5RFS1 | Ankyrin repeat and SOCS box protein 11 | 9.43e-06 | NA | 7.09e-05 |
| 3. B | Q5DU14 | Unconventional myosin-XVI | 1.22e-02 | NA | 1.14e-07 |
| 3. B | Q7Z5J8 | Ankyrin and armadillo repeat-containing protein | 3.71e-02 | NA | 0.004 |
| 3. B | Q86YR6 | POTE ankyrin domain family member D | 1.33e-08 | NA | 2.54e-65 |
| 3. B | Q923M0 | Protein phosphatase 1 regulatory subunit 16A | 2.64e-05 | NA | 7.20e-04 |
| 3. B | Q6F3J0 | Nuclear factor NF-kappa-B p105 subunit | 5.48e-04 | NA | 1.34e-09 |
| 3. B | Q94527 | Nuclear factor NF-kappa-B p110 subunit | 2.73e-02 | NA | 0.004 |
| 3. B | Q8N9B4 | Ankyrin repeat domain-containing protein 42 | 6.94e-05 | NA | 0.002 |
| 3. B | O00522 | Krev interaction trapped protein 1 | 9.19e-02 | NA | 0.034 |
| 3. B | Q07E28 | Cortactin-binding protein 2 | 1.86e-02 | NA | 0.002 |
| 3. B | Q5H9F3 | BCL-6 corepressor-like protein 1 | 5.37e-01 | NA | 2.33e-04 |
| 3. B | Q8WXK3 | Ankyrin repeat and SOCS box protein 13 | 2.19e-07 | NA | 7.87e-08 |
| 3. B | Q55A55 | Probable serine/threonine-protein kinase DDB_G0272092 | 1.56e-02 | NA | 1.77e-07 |
| 3. B | Q5GIG6 | Serine/threonine-protein kinase TNNI3K | 5.69e-03 | NA | 3.28e-07 |
| 3. B | Q92625 | Ankyrin repeat and SAM domain-containing protein 1A | 2.13e-03 | NA | 7.97e-04 |
| 3. B | Q09YI3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.33e-05 | NA | 4.67e-04 |
| 3. B | Q9J5I9 | Putative ankyrin repeat protein FPV012 | NA | NA | 1.47e-04 |
| 3. B | A0M8T5 | Cortactin-binding protein 2 | 4.53e-02 | NA | 0.002 |
| 3. B | Q5ZM55 | Protein fem-1 homolog B | 7.79e-03 | NA | 1.15e-05 |
| 3. B | Q2KI79 | Ankyrin repeat family A protein 2 | 2.21e-04 | NA | 3.19e-05 |
| 3. B | Q6UB98 | Ankyrin repeat domain-containing protein 12 | 5.40e-01 | NA | 4.15e-06 |
| 3. B | Q07E15 | Cortactin-binding protein 2 | 4.25e-02 | NA | 0.001 |
| 3. B | A6QPE7 | Ankyrin repeat domain-containing protein 65 | 2.35e-05 | NA | 2.18e-14 |
| 3. B | Q9XZC0 | Alpha-latrocrustotoxin-Lt1a (Fragment) | 9.25e-03 | NA | 1.03e-09 |
| 3. B | Q9NVP4 | Double zinc ribbon and ankyrin repeat-containing protein 1 | 2.51e-02 | NA | 0.011 |
| 3. B | Q94A76 | Potassium channel GORK | 6.95e-02 | NA | 9.01e-09 |
| 3. B | P41882 | Ankyrin repeat-containing protein F37A4.4 | 1.66e-02 | NA | 0.029 |
| 3. B | Q8Q0U0 | Putative ankyrin repeat protein MM_0045 | 1.36e-06 | NA | 2.21e-14 |
| 3. B | Q93650 | Putative glutaminase 3 | 4.53e-01 | NA | 1.15e-04 |
| 3. B | O35516 | Neurogenic locus notch homolog protein 2 | 9.12e-02 | NA | 0.031 |
| 3. B | Q5VYY1 | Ankyrin repeat domain-containing protein 22 | 7.29e-07 | NA | 8.75e-04 |
| 3. B | Q755Y0 | Palmitoyltransferase AKR1 | 6.48e-06 | NA | 1.51e-06 |
| 3. B | Q03017 | NF-kappa-B inhibitor cactus | 4.03e-05 | NA | 2.32e-06 |
| 3. B | Q91WD2 | Transient receptor potential cation channel subfamily V member 6 | 4.84e-05 | NA | 0.012 |
| 3. B | O75762 | Transient receptor potential cation channel subfamily A member 1 | 5.25e-04 | NA | 5.62e-09 |
| 3. B | Q8VD46 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.04e-04 | NA | 2.10e-04 |
| 3. B | Q9CQM6 | Ankyrin repeat domain-containing protein 61 | 4.23e-06 | NA | 2.35e-04 |
| 3. B | Q6NY19 | KN motif and ankyrin repeat domain-containing protein 3 | 1.55e-03 | NA | 2.75e-05 |
| 3. B | P19838 | Nuclear factor NF-kappa-B p105 subunit | 4.91e-04 | NA | 1.06e-07 |
| 3. B | A0M8S4 | Cortactin-binding protein 2 | 6.23e-02 | NA | 1.86e-04 |
| 3. B | Q9Z1E3 | NF-kappa-B inhibitor alpha | 3.41e-06 | NA | 1.41e-05 |
| 3. B | Q24145 | Tyrosine-protein kinase Shark | 5.20e-02 | NA | 2.39e-04 |
| 3. B | Q9TU71 | Ankyrin repeat domain-containing protein 1 | 1.29e-05 | NA | 4.17e-12 |
| 3. B | Q18297 | Transient receptor potential cation channel subfamily A member 1 homolog | 4.68e-04 | NA | 1.75e-07 |
| 3. B | E9Q4F7 | Ankyrin repeat domain-containing protein 11 | 6.79e-01 | NA | 3.04e-06 |
| 3. B | Q8WWH4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.86e-05 | NA | 0.005 |
| 3. B | Q1RJN6 | Putative ankyrin repeat protein RBE_0347 | 5.64e-03 | NA | 1.41e-04 |
| 3. B | A6QR20 | SMC5-SMC6 complex localization factor protein 1 | 1.30e-01 | NA | 0.002 |
| 3. B | P98150 | Nuclear factor NF-kappa-B p100 subunit | 2.16e-02 | NA | 1.22e-09 |
| 3. B | Q5RF15 | Serine/threonine-protein kinase TNNI3K | 1.73e-03 | NA | 1.26e-07 |
| 3. B | Q9VFD5 | Protein fem-1 homolog CG6966 | 3.08e-03 | NA | 1.18e-06 |
| 3. B | Q6P9K8 | Caskin-1 | 2.00e-02 | NA | 1.06e-08 |
| 3. B | Q7ZUV0 | Ankyrin repeat domain-containing protein 13C | 1.40e-01 | NA | 0.004 |
| 3. B | Q9BZL4 | Protein phosphatase 1 regulatory subunit 12C | 1.76e-04 | NA | 0.004 |
| 3. B | Q2IBA2 | Cortactin-binding protein 2 | 3.08e-02 | NA | 1.88e-04 |
| 3. B | Q812A3 | Ankyrin repeat domain-containing protein 23 | 3.15e-05 | NA | 2.44e-08 |
| 3. B | Q3SWY2 | Integrin-linked protein kinase | 5.58e-03 | NA | 5.50e-09 |
| 3. B | A5PMU4 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 4.23e-04 | NA | 1.05e-04 |
| 3. B | Q876A6 | Palmitoyltransferase AKR1 | 3.54e-05 | NA | 9.58e-10 |
| 3. B | Q96KQ7 | Histone-lysine N-methyltransferase EHMT2 | 4.52e-03 | NA | 3.26e-09 |
| 3. B | P25799 | Nuclear factor NF-kappa-B p105 subunit | 5.59e-04 | NA | 3.34e-07 |
| 3. B | Q6GNY1 | E3 ubiquitin-protein ligase mib1 | 2.15e-03 | NA | 8.28e-12 |
| 3. B | Q91ZU0 | Ankyrin repeat and SOCS box protein 7 | 2.54e-05 | NA | 1.98e-09 |
| 3. B | Q5UPV1 | Putative ankyrin repeat protein L271 | NA | NA | 2.11e-04 |
| 3. B | Q9JLU4 | SH3 and multiple ankyrin repeat domains protein 3 | 1.31e-02 | NA | 0.004 |
| 3. B | Q8NI38 | NF-kappa-B inhibitor delta | 3.73e-06 | NA | 4.46e-04 |
| 3. B | Q9J5H7 | Putative ankyrin repeat protein FPV024 | NA | NA | 2.93e-08 |
| 3. B | Q09701 | Palmitoyltransferase akr1 | 4.93e-05 | NA | 1.62e-04 |
| 3. B | Q8WXI3 | Ankyrin repeat and SOCS box protein 10 | 2.84e-04 | NA | 3.12e-06 |
| 3. B | Q01705 | Neurogenic locus notch homolog protein 1 | 1.71e-02 | NA | 0.002 |
| 3. B | Q9Z2G1 | Protein fem-1 homolog A-A | 6.61e-05 | NA | 2.62e-07 |
| 3. B | P0C550 | Potassium channel AKT1 | 6.63e-02 | NA | 4.12e-05 |
| 3. B | Q8WXK1 | Ankyrin repeat and SOCS box protein 15 | 4.10e-04 | NA | 1.20e-04 |
| 3. B | Q2IBF8 | Cortactin-binding protein 2 | 3.35e-02 | NA | 0.001 |
| 3. B | Q2T9K6 | Protein fem-1 homolog C | 8.51e-04 | NA | 1.18e-07 |
| 3. B | Q9ULJ7 | Ankyrin repeat domain-containing protein 50 | 2.97e-03 | NA | 1.18e-10 |
| 3. B | P0C927 | Ankyrin repeat and SOCS box protein 14 | 9.03e-04 | NA | 3.56e-07 |
| 3. B | Q07DX6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.25e-04 | NA | 0.004 |
| 3. B | Q8VHK1 | Caskin-2 | 5.83e-04 | NA | 0.006 |
| 3. B | Q9Y6X6 | Unconventional myosin-XVI | 3.62e-04 | NA | 3.66e-08 |
| 3. B | Q9ZCL3 | Putative ankyrin repeat protein RP714 | 4.26e-05 | NA | 1.57e-06 |
| 3. B | Q8K2H4 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 | 1.57e-02 | NA | 0.001 |
| 3. B | P46531 | Neurogenic locus notch homolog protein 1 | 3.13e-02 | NA | 0.004 |
| 3. B | Q2IBE6 | Cortactin-binding protein 2 | 5.45e-02 | NA | 3.33e-04 |
| 3. B | Q3ZBX7 | Ankyrin repeat domain-containing protein 1 | 9.53e-06 | NA | 5.12e-11 |
| 3. B | Q4V869 | Acyl-CoA-binding domain-containing protein 6 | 1.27e-02 | NA | 8.24e-07 |
| 3. B | Q09YG9 | Cortactin-binding protein 2 | 6.41e-02 | NA | 0.002 |
| 3. B | Q8HXA6 | Ankyrin repeat and SOCS box protein 15 | 1.77e-04 | NA | 1.04e-04 |
| 3. B | Q0P5G1 | Tonsoku-like protein | 4.75e-01 | NA | 1.19e-05 |
| 3. B | Q52T38 | Protein S-acyltransferase 24 | 4.17e-05 | NA | 0.001 |
| 3. B | Q9C6C3 | ADP-ribosylation factor GTPase-activating protein AGD2 | 1.96e-02 | NA | 1.99e-05 |
| 3. B | Q96JP0 | Protein fem-1 homolog C | 9.90e-04 | NA | 1.93e-06 |
| 3. B | P0C6S7 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 1.57e-03 | NA | 0.002 |
| 3. B | F1N6G5 | E3 ubiquitin-protein ligase HACE1 | 1.34e-03 | NA | 6.16e-13 |
| 3. B | Q8NFD2 | Ankyrin repeat and protein kinase domain-containing protein 1 | 3.37e-04 | NA | 4.35e-13 |
| 3. B | Q865U8 | Ankyrin repeat domain-containing protein 1 | 1.00e-05 | NA | 2.14e-11 |
| 3. B | Q9DF58 | Integrin-linked protein kinase | 7.63e-03 | NA | 1.16e-09 |
| 3. B | Q3SZE4 | Ankyrin repeat and SOCS box protein 11 | 7.65e-06 | NA | 8.10e-05 |
| 3. B | Q6NZL6 | Tonsoku-like protein | 4.22e-01 | NA | 5.81e-05 |
| 3. B | Q9SMX5 | ADP-ribosylation factor GTPase-activating protein AGD4 | 7.23e-03 | NA | 2.23e-04 |
| 3. B | Q1LZH7 | KN motif and ankyrin repeat domain-containing protein 2 | 7.65e-03 | NA | 3.24e-06 |
| 3. B | Q8WVL7 | Ankyrin repeat domain-containing protein 49 | 2.30e-03 | NA | 6.82e-04 |
| 3. B | Q3UX43 | Ankyrin repeat domain-containing protein 13C | 2.44e-01 | NA | 0.020 |
| 3. B | Q8NF67 | Putative ankyrin repeat domain-containing protein 20A12 pseudogene | 5.76e-06 | NA | 5.48e-50 |
| 3. B | A2VDR2 | Acyl-CoA-binding domain-containing protein 6 | 2.67e-02 | NA | 2.91e-06 |
| 3. B | Q00PJ1 | Cortactin-binding protein 2 | 3.26e-02 | NA | 1.83e-04 |
| 3. B | Q54BA2 | Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 | 3.85e-03 | NA | 9.53e-12 |
| 3. B | Q9VCA8 | Ankyrin repeat and KH domain-containing protein mask | NA | NA | 1.37e-13 |
| 3. B | Q04861 | Nuclear factor NF-kappa-B p105 subunit | 3.68e-04 | NA | 2.37e-06 |
| 3. B | A2ARS0 | Ankyrin repeat domain-containing protein 63 | 1.10e-02 | NA | 0.001 |
| 3. B | F1MJR8 | Inactive serine/threonine-protein kinase TEX14 | 2.89e-01 | NA | 0.011 |
| 3. B | Q15327 | Ankyrin repeat domain-containing protein 1 | 1.87e-05 | NA | 3.66e-11 |
| 3. B | Q25338 | Delta-latroinsectotoxin-Lt1a | 1.12e-03 | NA | 4.01e-08 |
| 3. B | Q5EA33 | Ankyrin repeat domain-containing protein 49 | 9.16e-04 | NA | 1.87e-04 |
| 3. B | Q9BXX3 | Ankyrin repeat domain-containing protein 30A | 3.76e-03 | NA | 1.67e-65 |
| 3. B | Q86YT6 | E3 ubiquitin-protein ligase MIB1 | 5.38e-04 | NA | 2.97e-12 |
| 3. B | Q94CT7 | Probable E3 ubiquitin-protein ligase XBOS31 | 3.43e-05 | NA | 1.12e-07 |
| 3. B | Q9TZC4 | Integrin-linked protein kinase homolog pat-4 | 3.05e-02 | NA | 1.20e-08 |
| 3. B | O89019 | Inversin | 1.46e-04 | NA | 4.14e-11 |
| 3. B | Q66JD7 | Acyl-CoA-binding domain-containing protein 6 | 1.29e-02 | NA | 2.91e-06 |
| 3. B | Q53RE8 | Ankyrin repeat domain-containing protein 39 | 3.49e-06 | NA | 5.75e-08 |
| 3. B | Q54HW1 | 26S proteasome non-ATPase regulatory subunit 10 | 4.89e-11 | NA | 2.41e-16 |
| 3. B | Q8WMX8 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.03e-05 | NA | 5.79e-04 |
| 3. B | Q07DZ7 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.08e-04 | NA | 5.69e-06 |
| 3. B | Q0JKV1 | Potassium channel AKT1 | 3.08e-01 | NA | 4.12e-05 |
| 3. B | Q09YH1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 4.81e-05 | NA | 6.61e-04 |
| 3. B | Q60773 | Cyclin-dependent kinase 4 inhibitor D | 1.99e-06 | NA | 5.18e-09 |
| 3. B | Q5UPG7 | Putative ankyrin repeat protein L91 | NA | NA | 1.12e-04 |
| 3. B | Q2IBB2 | Cortactin-binding protein 2 | 6.07e-02 | NA | 0.014 |
| 3. B | Q9EQG6 | Kinase D-interacting substrate of 220 kDa | 7.27e-03 | NA | 1.30e-12 |
| 3. B | Q5ZLC6 | Ankyrin repeat domain-containing protein 10 | 1.72e-05 | NA | 8.27e-04 |
| 3. B | Q4KL97 | Ankyrin repeat domain-containing protein 1 | 1.83e-06 | NA | 1.84e-09 |
| 3. B | Q91955 | Myotrophin | 3.36e-05 | NA | 3.80e-05 |
| 3. B | P14368 | Putative ankyrin repeat protein FPV234 | NA | NA | 3.33e-04 |
| 3. B | P58546 | Myotrophin | 2.61e-05 | NA | 0.003 |
| 3. B | Q2QLG9 | Cortactin-binding protein 2 | 5.48e-02 | NA | 0.017 |
| 3. B | Q4R544 | Ankyrin repeat and SOCS box protein 8 | 4.36e-05 | NA | 8.02e-12 |
| 3. B | Q9J4Z6 | Putative ankyrin repeat protein FPV244 | NA | NA | 4.29e-08 |
| 3. B | Q9J5A7 | Putative ankyrin repeat protein FPV115 | NA | NA | 2.39e-06 |
| 3. B | B2RU33 | POTE ankyrin domain family member C | 2.79e-07 | NA | 4.11e-65 |
| 3. B | Q60772 | Cyclin-dependent kinase 4 inhibitor C | 1.82e-06 | NA | 3.93e-06 |
| 3. B | Q9UVH3 | Palmitoyltransferase AKR1 (Fragment) | 6.63e-04 | NA | 7.13e-06 |
| 3. B | Q07E17 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.01e-04 | NA | 2.51e-04 |
| 3. B | Q6NSI1 | Putative ankyrin repeat domain-containing protein 26-like protein | 1.19e-06 | NA | 5.49e-56 |
| 3. B | P0CG38 | POTE ankyrin domain family member I | 2.77e-03 | NA | 7.62e-65 |
| 3. B | A0JP26 | POTE ankyrin domain family member B3 | 1.36e-09 | NA | 1.63e-66 |
| 3. B | O74205 | Transcription factor TOXE | 3.17e-02 | NA | 0.001 |
| 3. B | Q09YJ5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 8.88e-06 | NA | 4.66e-04 |
| 3. B | Q8WMX6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 7.92e-06 | NA | 0.004 |
| 3. B | Q6S5H5 | POTE ankyrin domain family member G | 1.42e-09 | NA | 3.98e-68 |
| 3. B | P77736 | Putative ankyrin repeat protein YahD | 2.36e-09 | NA | 3.93e-10 |
| 3. B | Q5F478 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 3.65e-02 | NA | 1.82e-12 |
| 3. B | Q8K3X6 | Ankyrin repeat and SAM domain-containing protein 4B | 9.09e-04 | NA | 1.69e-08 |
| 3. B | Q9J507 | Putative ankyrin repeat protein FPV228 | NA | NA | 1.82e-09 |
| 3. B | Q7TQP6 | Serine/threonine-protein kinase TNNI3K | 8.72e-03 | NA | 1.15e-06 |
| 3. B | P0CS67 | Palmitoyltransferase AKR1 | 9.93e-05 | NA | 1.70e-10 |
| 3. B | Q9Z2G0 | Protein fem-1 homolog B | 1.58e-04 | NA | 1.30e-06 |
| 3. B | G5E8K5 | Ankyrin-3 | 3.57e-03 | NA | 9.80e-16 |
| 3. B | Q8K0L0 | Ankyrin repeat and SOCS box protein 2 | 1.91e-02 | NA | 2.31e-06 |
| 3. B | A0PJZ0 | Putative ankyrin repeat domain-containing protein 20A5 | 7.00e-05 | NA | 4.84e-70 |
| 3. B | Q6DD51 | Caskin-2 | 5.11e-02 | NA | 2.52e-04 |
| 3. B | Q3TYA6 | M-phase phosphoprotein 8 | 8.87e-03 | NA | 0.002 |
| 3. B | P21783 | Neurogenic locus notch homolog protein 1 | 2.33e-03 | NA | 0.007 |
| 3. B | Q8TF21 | Ankyrin repeat domain-containing protein 24 | 2.60e-04 | NA | 2.49e-09 |
| 3. B | A0A0A6YYL3 | POTE ankyrin domain family member B | 1.99e-09 | NA | 3.99e-67 |
| 3. B | A0A0R4IQZ2 | Putative palmitoyltransferase ZDHHC13 | 1.56e-05 | NA | 8.76e-09 |
| 3. B | Q96HA7 | Tonsoku-like protein | 5.90e-01 | NA | 7.44e-05 |
| 3. B | Q9H765 | Ankyrin repeat and SOCS box protein 8 | 6.08e-04 | NA | 4.92e-12 |
| 3. B | Q3KP44 | Ankyrin repeat domain-containing protein 55 | 1.60e-04 | NA | 9.64e-09 |
| 3. B | Q99549 | M-phase phosphoprotein 8 | 9.40e-03 | NA | 0.002 |
| 3. B | Q1RJR6 | Putative ankyrin repeat protein RBE_0317 | 1.02e-04 | NA | 1.78e-06 |
| 3. B | Q63746 | NF-kappa-B inhibitor alpha | 3.66e-06 | NA | 8.15e-06 |
| 3. B | Q10728 | Protein phosphatase 1 regulatory subunit 12A | 7.51e-04 | NA | 3.70e-06 |
| 3. B | Q9R186 | Transient receptor potential cation channel subfamily V member 6 | 7.70e-05 | NA | 0.012 |
| 3. B | P07207 | Neurogenic locus Notch protein | NA | NA | 1.21e-04 |
| 3. B | Q07DV1 | Cortactin-binding protein 2 | 2.01e-02 | NA | 0.001 |
| 3. B | Q9W0T5 | Transient receptor potential channel pyrexia | 5.39e-05 | NA | 1.48e-10 |
| 3. B | Q9CWU2 | Palmitoyltransferase ZDHHC13 | 3.63e-05 | NA | 5.45e-08 |
| 3. B | Q5W7F2 | ADP-ribosylation factor GTPase-activating protein AGD3 | 1.41e-02 | NA | 0.006 |
| 3. B | Q9STP8 | Acyl-CoA-binding domain-containing protein 2 | 8.15e-03 | NA | 2.20e-07 |
| 3. B | A6NGH8 | Ankyrin repeat domain-containing protein 61 | 2.58e-05 | NA | 6.95e-06 |
| 3. B | Q63ZY3 | KN motif and ankyrin repeat domain-containing protein 2 | 7.91e-03 | NA | 1.96e-05 |
| 3. B | Q07DX4 | Cortactin-binding protein 2 | 6.56e-02 | NA | 5.31e-04 |
| 3. B | Q1RHQ8 | Putative ankyrin repeat protein RBE_1025 | 4.87e-04 | NA | 0.023 |
| 3. B | Q9CR42 | Ankyrin repeat domain-containing protein 1 | 2.80e-05 | NA | 2.18e-11 |
| 3. B | Q8BTZ5 | Ankyrin repeat domain-containing protein 46 | 2.42e-03 | NA | 0.001 |
| 3. B | A6NK59 | Ankyrin repeat and SOCS box protein 14 | 4.32e-04 | NA | 0.001 |
| 3. B | Q8BLA8 | Transient receptor potential cation channel subfamily A member 1 | 3.66e-04 | NA | 1.89e-05 |
| 3. B | Q8H569 | Potassium channel AKT3 | 2.66e-01 | NA | 7.79e-05 |
| 3. B | O73630 | Nuclear factor NF-kappa-B p100 subunit | 1.02e-03 | NA | 1.86e-09 |
| 3. B | A6NI47 | Putative POTE ankyrin domain family member M | 4.62e-09 | NA | 4.66e-68 |
| 3. B | Q5UQV3 | Putative ankyrin repeat protein L371 | NA | NA | 6.41e-09 |
| 3. B | Q6C520 | Palmitoyltransferase AKR1 | 2.16e-05 | NA | 2.31e-04 |
| 3. B | Q2QLA2 | Cortactin-binding protein 2 | 8.95e-02 | NA | 3.42e-04 |
| 3. B | Q9D2X0 | Ankyrin repeat domain-containing protein 39 | 2.78e-04 | NA | 6.91e-06 |
| 3. B | O75179 | Ankyrin repeat domain-containing protein 17 | 1.68e-02 | NA | 1.02e-15 |
| 3. B | Q86AT8 | Stress-activated protein kinase alpha | 9.24e-03 | NA | 2.96e-05 |
| 3. B | Q9HYV6 | Putative ankyrin repeat protein PA3287 | 2.85e-07 | NA | 2.78e-06 |
| 3. B | Q09YM8 | Cortactin-binding protein 2 | 3.13e-02 | NA | 0.004 |
| 3. B | Q9WTK5 | Nuclear factor NF-kappa-B p100 subunit | 5.66e-03 | NA | 9.67e-07 |
| 3. B | Q6GPE5 | Protein fem-1 homolog B | 5.03e-05 | NA | 7.29e-06 |
| 3. B | Q8WXE0 | Caskin-2 | 5.19e-04 | NA | 0.006 |
| 3. B | Q4R690 | Palmitoyltransferase ZDHHC13 | 8.83e-06 | NA | 7.12e-07 |
| 3. B | Q07E30 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 9.75e-04 | NA | 4.01e-05 |
| 3. B | Q5DW34 | Histone-lysine N-methyltransferase EHMT1 | 8.05e-04 | NA | 3.40e-09 |
| 3. B | Q80YE7 | Death-associated protein kinase 1 | 3.09e-02 | NA | 1.89e-14 |
| 3. B | Q5UPG0 | Putative ankyrin repeat protein L86 | NA | NA | 2.65e-05 |
| 3. B | E9PTT0 | Palmitoyltransferase ZDHHC17 | 1.39e-05 | NA | 3.71e-15 |
| 3. B | P0DJE3 | Alpha-latrotoxin-Lhe1a | 5.91e-03 | NA | 1.08e-08 |
| 3. B | Q978J0 | Putative ankyrin repeat protein TV1425 | 7.41e-09 | NA | 3.85e-16 |
| 3. B | O00221 | NF-kappa-B inhibitor epsilon | 3.89e-07 | NA | 3.33e-06 |
| 3. B | Q2IBF5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.82e-05 | NA | 0.004 |
| 3. B | Q8IWZ3 | Ankyrin repeat and KH domain-containing protein 1 | 9.87e-03 | NA | 1.38e-14 |
| 3. B | Q4V890 | Protein fem-1 homolog A | 1.93e-03 | NA | 1.94e-07 |
| 3. B | Q9J5H5 | Putative ankyrin repeat protein FPV026 | NA | NA | 2.26e-06 |
| 3. B | Q9J4Z4 | Putative ankyrin repeat protein FPV246 | NA | NA | 2.14e-12 |
| 3. B | Q29RV0 | Cyclin-dependent kinase 4 inhibitor D | 1.95e-05 | NA | 5.44e-06 |
| 3. B | Q4ACU6 | SH3 and multiple ankyrin repeat domains protein 3 | 2.32e-02 | NA | 0.004 |
| 3. B | B0G124 | Ankyrin repeat-containing protein DDB_G0279043 | 1.56e-06 | NA | 9.47e-14 |
| 3. B | Q8C6Y6 | Ankyrin repeat and SOCS box protein 14 | 5.99e-04 | NA | 7.53e-06 |
| 3. B | Q5UPJ9 | Putative ankyrin repeat protein L122 | NA | NA | 3.73e-07 |
| 3. B | Q91974 | NF-kappa-B inhibitor alpha | 5.70e-05 | NA | 4.09e-08 |
| 3. B | Q54F46 | Homeobox protein Wariai | 5.21e-04 | NA | 3.18e-08 |
| 3. B | Q108T9 | Cortactin-binding protein 2 | 9.25e-02 | NA | 4.12e-04 |
| 3. B | Q9H672 | Ankyrin repeat and SOCS box protein 7 | 1.88e-05 | NA | 1.52e-09 |
| 3. B | Q9ET47 | Espin | 9.09e-04 | NA | 0.006 |
| 3. B | Q9GKW8 | Ankyrin repeat and death domain-containing protein 1A (Fragment) | 4.61e-05 | NA | 1.88e-10 |
| 3. B | Q05921 | 2-5A-dependent ribonuclease | 1.18e-02 | NA | 1.35e-06 |
| 3. B | Q5ZIJ9 | E3 ubiquitin-protein ligase MIB2 | 1.51e-03 | NA | 1.63e-06 |
| 3. B | Q07DV3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.63e-05 | NA | 0.001 |
| 3. B | Q1RHT6 | Putative ankyrin repeat protein RBE_0997 | 9.42e-03 | NA | 3.37e-08 |
| 3. B | Q02979 | Glycerophosphocholine phosphodiesterase GDE1 | 1.64e-01 | NA | 0.006 |
| 3. B | Q505D1 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A | 2.71e-03 | NA | 3.23e-14 |
| 3. B | O90760 | Putative ankyrin repeat protein FPV031 | NA | NA | 6.47e-07 |
| 3. B | Q8IUH4 | Palmitoyltransferase ZDHHC13 | 6.43e-06 | NA | 1.05e-06 |
| 3. B | P81069 | GA-binding protein subunit beta-2 | 5.36e-05 | NA | 2.71e-06 |
| 3. B | Q54GC8 | Acyl-CoA-binding domain-containing protein 6 homolog | 2.29e-02 | NA | 0.001 |
| 3. B | Q9VUW9 | Palmitoyltransferase Hip14 | 1.35e-04 | NA | 1.28e-05 |
| 3. B | Q9NXR5 | Ankyrin repeat domain-containing protein 10 | 1.96e-05 | NA | 0.005 |
| 3. B | Q96Q27 | Ankyrin repeat and SOCS box protein 2 | 1.47e-03 | NA | 6.78e-08 |
| 3. B | Q00420 | GA-binding protein subunit beta-1 | 2.63e-05 | NA | 1.53e-08 |
| 3. B | Q6NLQ8 | E3 ubiquitin-protein ligase XBAT32 | 1.30e-03 | NA | 0.006 |
| 3. B | Q9J508 | Putative ankyrin repeat protein FPV227 | NA | NA | 0.005 |
| 3. B | Q1RI12 | Putative ankyrin repeat protein RBE_0921 | 2.53e-04 | NA | 2.54e-06 |
| 3. B | A4D7T3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.37e-04 | NA | 1.54e-07 |
| 3. B | Q8R516 | E3 ubiquitin-protein ligase MIB2 | 4.06e-04 | NA | 3.15e-06 |
| 3. B | Q5ZXN6 | Phosphocholine transferase AnkX | 1.55e-03 | NA | 3.93e-04 |
| 3. B | Q13418 | Integrin-linked protein kinase | 5.68e-03 | NA | 5.45e-09 |
| 3. B | P83757 | NF-kappa-B inhibitor cactus | NA | NA | 0.001 |
| 3. B | Q9C0D5 | Protein TANC1 | 4.25e-02 | NA | 2.82e-10 |
| 3. B | Q5BKI6 | Ankyrin repeat domain-containing protein 1 | 2.18e-06 | NA | 5.20e-09 |
| 3. B | Q9Z1P7 | KN motif and ankyrin repeat domain-containing protein 3 | 8.83e-04 | NA | 4.95e-04 |
| 3. B | Q9J516 | Putative ankyrin repeat protein FPV219 | NA | NA | 0.001 |
| 3. B | Q6ZQK5 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 8.34e-03 | NA | 0.001 |
| 3. B | Q07DZ5 | Cortactin-binding protein 2 | 1.26e-01 | NA | 0.009 |
| 3. B | Q09YN0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 4.13e-04 | NA | 3.55e-05 |
| 3. B | D3YZU1 | SH3 and multiple ankyrin repeat domains protein 1 | 2.58e-02 | NA | 1.92e-04 |
| 3. B | Q92527 | Ankyrin repeat domain-containing protein 7 | 1.60e-07 | NA | 1.18e-56 |
| 3. B | Q02989 | Alpha-latroinsectotoxin-Lt1a (Fragment) | 1.24e-02 | NA | 1.53e-07 |
| 3. B | Q60J38 | Ankyrin repeat and KH domain-containing protein CBG24701 | 1.15e-01 | NA | 2.40e-08 |
| 3. B | D3ZD05 | KN motif and ankyrin repeat domain-containing protein 2 | 8.90e-03 | NA | 3.86e-06 |
| 3. B | Q8T2Q0 | Putative ZDHHC-type palmitoyltransferase 6 | 9.58e-06 | NA | 1.82e-06 |
| 3. B | B2RXR6 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 8.64e-03 | NA | 4.96e-14 |
| 3. B | Q502K3 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 4.59e-03 | NA | 1.67e-13 |
| 3. B | Q862Z2 | Ankyrin repeat and SOCS box protein 5 | 4.82e-07 | NA | 1.04e-05 |
| 3. B | Q66H07 | Fibronectin type 3 and ankyrin repeat domains 1 protein | 4.09e-09 | NA | 1.02e-09 |
| 3. B | Q9C104 | Glycerophosphocholine phosphodiesterase gde1 | 1.16e-02 | NA | 0.011 |
| 3. B | Q9FIT8 | ADP-ribosylation factor GTPase-activating protein AGD1 | 3.07e-02 | NA | 4.42e-06 |
| 3. B | Q05753 | Ankyrin repeat domain-containing protein, chloroplastic | 8.97e-04 | NA | 7.17e-13 |
| 3. B | Q2QLB3 | Cortactin-binding protein 2 | 3.70e-02 | NA | 0.005 |
| 3. B | Q6UB99 | Ankyrin repeat domain-containing protein 11 | 6.09e-01 | NA | 2.04e-06 |
| 3. B | Q9JIA3 | NF-kappa-B inhibitor beta | 9.32e-04 | NA | 5.59e-04 |
| 3. B | O55222 | Integrin-linked protein kinase | 1.25e-02 | NA | 5.79e-09 |
| 3. B | Q9J569 | Putative ankyrin repeat protein FPV162 | NA | NA | 2.93e-08 |
| 3. B | Q3SX45 | Ankyrin repeat and SOCS box protein 2 | 9.66e-04 | NA | 2.08e-09 |
| 3. B | Q9SAR5 | Ankyrin repeat domain-containing protein 2A | 3.08e-03 | NA | 9.61e-07 |
| 3. B | Q08DV6 | Ankyrin repeat and SOCS box protein 3 | 1.66e-04 | NA | 9.26e-06 |
| 3. B | Q76K24 | Ankyrin repeat domain-containing protein 46 | 1.24e-03 | NA | 6.49e-04 |
| 3. B | Q4V8X4 | Acyl-CoA-binding domain-containing protein 6 | 2.76e-02 | NA | 5.55e-06 |
| 3. B | Q04721 | Neurogenic locus notch homolog protein 2 | 7.45e-02 | NA | 0.029 |
| 3. B | Q09YI1 | Cortactin-binding protein 2 | 8.69e-02 | NA | 1.39e-04 |
| 3. B | Q3UMT1 | Protein phosphatase 1 regulatory subunit 12C | 4.12e-04 | NA | 0.002 |
| 3. B | Q9C7A2 | Ankyrin repeat-containing protein ITN1 | 5.40e-07 | NA | 0.016 |
| 3. B | Q8N6D5 | Ankyrin repeat domain-containing protein 29 | 6.81e-06 | NA | 0.001 |
| 3. B | O15084 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A | 6.58e-03 | NA | 4.11e-13 |
| 3. B | Q5NVB9 | Palmitoyltransferase ZDHHC13 | 1.94e-05 | NA | 8.90e-07 |
| 3. B | Q7T2B9 | Myotrophin | 1.82e-06 | NA | 2.13e-04 |
| 3. B | Q9J4Z5 | Putative ankyrin repeat protein FPV245 | NA | NA | 1.92e-11 |
| 3. B | Q8BTI7 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 9.26e-03 | NA | 1.55e-12 |
| 3. B | E5RJM6 | Ankyrin repeat domain-containing protein 65 | 1.18e-05 | NA | 4.49e-09 |
| 3. B | Q6P9Z4 | Protein fem-1 homolog A | 4.41e-04 | NA | 8.21e-06 |
| 3. B | Q9GZV1 | Ankyrin repeat domain-containing protein 2 | 1.98e-03 | NA | 3.12e-09 |
| 3. B | Q108U1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.85e-04 | NA | 6.66e-05 |
| 3. B | Q6GQX6 | Ankyrin repeat and SAM domain-containing protein 6 | 2.97e-03 | NA | 7.60e-05 |
| 3. B | Q9QW30 | Neurogenic locus notch homolog protein 2 | 5.45e-04 | NA | 0.025 |
| 3. B | Q60649 | Caseinolytic peptidase B protein homolog | 7.28e-02 | NA | 6.90e-04 |
| 3. B | Q6IVG4 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 1.01e-02 | NA | 8.71e-04 |
| 3. B | Q2IBB1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.06e-04 | NA | 0.001 |
| 3. B | Q3SX00 | Ankyrin repeat domain-containing protein 46 | 1.32e-03 | NA | 0.008 |
| 3. B | Q59H18 | Serine/threonine-protein kinase TNNI3K | 9.22e-03 | NA | 1.85e-07 |
| 3. B | Q9SM23 | Acyl-CoA-binding domain-containing protein 1 | 9.56e-03 | NA | 2.62e-07 |
| 3. B | Q8VHQ3 | Protein phosphatase 1 regulatory inhibitor subunit 16B | 1.89e-06 | NA | 3.74e-04 |
| 3. B | Q99PE2 | Ankyrin repeat family A protein 2 | 1.41e-04 | NA | 4.77e-05 |
| 3. B | Q9BSK4 | Protein fem-1 homolog A | 3.63e-03 | NA | 1.69e-05 |
| 3. B | Q9H9B1 | Histone-lysine N-methyltransferase EHMT1 | 7.51e-03 | NA | 5.16e-09 |
| 3. B | P42773 | Cyclin-dependent kinase 4 inhibitor C | 1.28e-06 | NA | 2.46e-05 |
| 3. B | A0JNU3 | 60 kDa lysophospholipase | 4.63e-03 | NA | 0.002 |
| 3. B | Q28BK1 | E3 ubiquitin-protein ligase HACE1 | 1.97e-03 | NA | 4.35e-13 |
| 3. B | D4A615 | Tonsoku-like protein | 4.48e-01 | NA | 5.86e-05 |
| 3. B | Q9J5I7 | Putative ankyrin repeat protein FPV014 | NA | NA | 1.97e-06 |
| 3. B | H3BUK9 | POTE ankyrin domain family member B2 | 3.33e-08 | NA | 3.99e-67 |
| 3. B | Q9DAM9 | Fibronectin type 3 and ankyrin repeat domains 1 protein | 4.53e-09 | NA | 2.58e-09 |
| 3. B | Q8WXH4 | Ankyrin repeat and SOCS box protein 11 | 9.96e-06 | NA | 4.60e-05 |
| 3. B | Q1RJR4 | Putative ankyrin repeat protein RBE_0319 | 5.75e-03 | NA | 1.71e-06 |
| 3. B | O60733 | 85/88 kDa calcium-independent phospholipase A2 | 3.12e-02 | NA | 5.33e-12 |
| 3. B | Q9ERK0 | Receptor-interacting serine/threonine-protein kinase 4 | 5.73e-04 | NA | 1.08e-09 |
| 3. B | Q810B6 | Rabankyrin-5 | 7.07e-03 | NA | 1.63e-08 |
| 3. B | Q9J517 | Putative ankyrin repeat protein FPV218 | NA | NA | 3.55e-11 |
| 3. B | Q96IX9 | Putative ankyrin repeat domain-containing protein 26-like 1 | 8.07e-04 | NA | 2.35e-12 |
| 3. B | Q12955 | Ankyrin-3 | NA | NA | 2.53e-16 |
| 3. B | Q09YJ3 | Cortactin-binding protein 2 | 2.80e-02 | NA | 1.40e-04 |
| 3. B | Q8VHS5 | Ankyrin repeat and SOCS box protein 16 | 1.97e-04 | NA | 0.002 |
| 3. B | Q6TNT2 | Ankyrin repeat domain-containing protein 46 | 9.00e-03 | NA | 0.011 |
| 3. B | Q8C0T1 | Protein fem-1 homolog A-B | 5.87e-04 | NA | 2.38e-06 |
| 3. B | A2RUV0 | Neurogenic locus notch homolog protein 1 | 6.58e-03 | NA | 0.028 |
| 3. B | Q38998 | Potassium channel AKT1 | 1.83e-01 | NA | 0.001 |
| 3. B | Q80TN5 | Palmitoyltransferase ZDHHC17 | 2.85e-05 | NA | 1.96e-15 |
| 3. B | Q54LF0 | NAD-dependent deacetylase sir2B | 3.67e-03 | NA | 0.011 |
| 3. B | C9JTQ0 | Ankyrin repeat domain-containing protein 63 | 2.31e-02 | NA | 0.001 |
| 3. B | P20749 | B-cell lymphoma 3 protein | 1.42e-06 | NA | 2.31e-11 |
| 3. B | Q7S3M5 | Palmitoyltransferase akr1 | 2.93e-05 | NA | 1.55e-07 |
| 3. B | Q9BQI6 | SMC5-SMC6 complex localization factor protein 1 | 6.75e-02 | NA | 0.005 |
| 3. B | Q7Z6G8 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 1.82e-03 | NA | 0.001 |
| 3. B | Q3V0J4 | Ankyrin repeat domain-containing protein 53 | 3.19e-03 | NA | 0.050 |
| 3. B | Q5R5V4 | Integrin-linked protein kinase | 1.42e-02 | NA | 6.66e-09 |
| 3. B | Q4UKX2 | Putative ankyrin repeat protein RF_0950 | 2.33e-04 | NA | 9.02e-07 |
| 3. B | O75832 | 26S proteasome non-ATPase regulatory subunit 10 | 2.58e-11 | NA | 7.79e-13 |
| 3. B | P62775 | Myotrophin | 2.30e-05 | NA | 0.001 |
| 3. B | Q2IBB4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.14e-04 | NA | 0.001 |
| 3. B | Q9TZM3 | Leucine-rich repeat serine/threonine-protein kinase 1 | 4.62e-01 | NA | 0.015 |
| 3. B | P31695 | Neurogenic locus notch homolog protein 4 | 6.03e-04 | NA | 7.71e-04 |
| 3. B | Q8GXE6 | Potassium channel AKT6 | 1.66e-01 | NA | 3.89e-06 |
| 3. B | A0A140LI88 | Ankyrin repeat domain-containing protein 31 | 1.14e-01 | NA | 1.83e-06 |
| 3. B | Q5E9N5 | Caseinolytic peptidase B protein homolog | 4.26e-02 | NA | 0.001 |
| 3. B | Q09YK4 | Cortactin-binding protein 2 | 6.18e-02 | NA | 0.004 |
| 3. B | Q8C8R3 | Ankyrin-2 | NA | NA | 2.93e-15 |
| 3. B | E1C656 | E3 ubiquitin-protein ligase HACE1 | 3.65e-03 | NA | 1.03e-13 |
| 3. B | Q6F6B3 | Protein TANC1 | 2.33e-02 | NA | 1.07e-10 |
| 3. B | Q17QS6 | Ankyrin repeat and SOCS box protein 5 | 6.31e-07 | NA | 3.43e-07 |
| 3. B | Q86W74 | Ankyrin repeat domain-containing protein 46 | 1.37e-03 | NA | 0.008 |
| 3. B | Q8N8V4 | Ankyrin repeat and SAM domain-containing protein 4B | 1.30e-03 | NA | 2.11e-07 |
| 3. B | Q07DY6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.09e-04 | NA | 0.012 |
| 3. B | P40480 | Protein HOS4 | 2.02e-02 | NA | 3.06e-04 |
| 3. B | Q9Y574 | Ankyrin repeat and SOCS box protein 4 | 1.06e-03 | NA | 4.73e-04 |
| 3. B | Q9H9E1 | Ankyrin repeat family A protein 2 | 1.42e-04 | NA | 3.19e-05 |
| 3. B | Q6NXT1 | Ankyrin repeat domain-containing protein 54 | 3.68e-03 | NA | 4.29e-05 |
| 3. B | Q8BIZ1 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 5.08e-04 | NA | 0.001 |
| 3. B | Q6AWW5 | Ankyrin repeat-containing protein At5g02620 | 9.22e-08 | NA | 2.61e-06 |
| 3. B | Q9QZH2 | BRCA1-associated RING domain protein 1 | 1.26e-01 | NA | 6.27e-08 |
| 3. B | Q5T7N3 | KN motif and ankyrin repeat domain-containing protein 4 | 1.07e-01 | NA | 2.05e-04 |
| 3. B | Q92HB1 | Putative ankyrin repeat protein RC0860 | 1.30e-01 | NA | 0.009 |
| 3. B | Q7ZT11 | Ankyrin repeat domain-containing protein 1 | 5.64e-06 | NA | 4.11e-11 |
| 3. B | Q07E43 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 7.79e-06 | NA | 5.27e-04 |
| 3. B | Q8TC84 | Fibronectin type 3 and ankyrin repeat domains protein 1 | 3.34e-09 | NA | 6.09e-11 |
| 3. B | Q54HT1 | Protein tirA | 1.42e-01 | NA | 0.001 |
| 3. B | Q96P50 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3 | 3.53e-03 | NA | 0.001 |
| 3. B | Q9J503 | Putative ankyrin repeat protein FPV232 | NA | NA | 0.001 |
| 3. B | Q99728 | BRCA1-associated RING domain protein 1 | 1.16e-01 | NA | 4.33e-08 |
| 3. B | P97570 | 85/88 kDa calcium-independent phospholipase A2 | 9.47e-03 | NA | 7.60e-08 |
| 3. B | Q6S8J7 | POTE ankyrin domain family member A | 3.44e-07 | NA | 1.58e-75 |
| 3. B | Q3UMR0 | Ankyrin repeat domain-containing protein 27 | 1.43e-02 | NA | 2.26e-09 |
| 3. B | A3AYR1 | Acyl-CoA-binding domain-containing protein 4 | 3.18e-03 | NA | 2.37e-07 |
| 3. B | Q07008 | Neurogenic locus notch homolog protein 1 | 5.40e-02 | NA | 0.002 |
| 3. B | Q3T0F7 | Myotrophin | 2.49e-05 | NA | 0.003 |
| 3. B | Q07DY4 | Cortactin-binding protein 2 | 8.71e-02 | NA | 1.71e-04 |
| 3. B | Q9HCD6 | Protein TANC2 | 3.06e-02 | NA | 5.86e-10 |
| 3. B | A1X157 | Cortactin-binding protein 2 | 3.93e-02 | NA | 0.012 |
| 3. B | Q9D3J5 | Ankyrin repeat domain-containing protein 22 | 7.88e-07 | NA | 0.016 |
| 3. B | Q6S545 | POTE ankyrin domain family member H | 2.19e-09 | NA | 8.24e-68 |
| 3. B | Q9Z148 | Histone-lysine N-methyltransferase EHMT2 | 1.38e-03 | NA | 5.99e-08 |
| 3. B | Q1RK13 | Putative ankyrin repeat protein RBE_0220 | 1.00e-03 | NA | 8.06e-13 |
| 3. B | Q54XX5 | Probable serine/threonine-protein kinase DDB_G0278535 | 1.07e-02 | NA | 1.52e-10 |
| 3. B | Q9CZK6 | Ankyrin repeat and SAM domain-containing protein 3 | 3.85e-06 | NA | 9.28e-15 |
| 3. B | Q5UPF8 | Putative ankyrin repeat protein L88 | NA | NA | 1.49e-07 |
| 3. B | Q8TAK5 | GA-binding protein subunit beta-2 | 4.70e-04 | NA | 3.06e-06 |
| 3. B | Q99J82 | Integrin-linked protein kinase | 5.67e-03 | NA | 5.79e-09 |
| 3. B | Q2IBF7 | Cortactin-binding protein 2 | 5.51e-02 | NA | 5.04e-04 |
| 3. B | Q1RK83 | Putative ankyrin repeat protein RBE_0150 | 6.02e-03 | NA | 7.54e-04 |
| 3. B | Q2QLF8 | Cortactin-binding protein 2 | 5.96e-02 | NA | 8.30e-04 |
| 3. B | Q71S22 | Inversin-A | 2.23e-04 | NA | 9.11e-13 |
| 3. B | P18954 | Protein PhlB | 1.44e-04 | NA | 0.014 |
| 3. B | Q1RI31 | Putative ankyrin repeat protein RBE_0902 | 3.25e-03 | NA | 0.028 |
| 3. B | A0M8T3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 6.90e-05 | NA | 1.33e-04 |
| 3. B | Q4UMH6 | Putative ankyrin repeat protein RF_0381 | 2.51e-03 | NA | 4.76e-12 |
| 3. B | P53355 | Death-associated protein kinase 1 | 5.43e-02 | NA | 5.12e-16 |
| 3. B | Q804S5 | E3 ubiquitin-protein ligase mib1 | 1.13e-03 | NA | 8.56e-12 |
| 3. B | Q8IYU2 | E3 ubiquitin-protein ligase HACE1 | 3.16e-03 | NA | 2.08e-12 |
| 3. B | Q875S9 | Palmitoyltransferase AKR1 | 2.41e-04 | NA | 8.72e-08 |
| 3. B | P0CS66 | Palmitoyltransferase AKR1 | 1.62e-05 | NA | 1.70e-10 |
| 3. B | Q9HLN1 | Putative ankyrin repeat protein Ta0196 | 8.41e-08 | NA | 4.93e-06 |
| 3. B | Q6B858 | Fibronectin type 3 and ankyrin repeat domains protein 1 | 1.41e-09 | NA | 5.27e-10 |
| 3. B | Q8NB46 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 4.21e-02 | NA | 1.24e-12 |
| 3. B | P21001 | Ankyrin repeat protein B4 | NA | NA | 0.023 |
| 3. B | P25963 | NF-kappa-B inhibitor alpha | 1.31e-04 | NA | 1.89e-06 |
| 3. B | Q5REW9 | Ankyrin repeat domain-containing protein 27 | 3.61e-03 | NA | 5.70e-10 |
| 3. B | Q863Z4 | Myotrophin | 2.45e-05 | NA | 0.003 |
| 3. B | Q9CQ31 | Ankyrin repeat and SOCS box protein 11 | 9.40e-06 | NA | 3.14e-07 |
| 3. B | Q6JAN1 | Inversin | 1.31e-04 | NA | 7.49e-11 |
| 3. B | G3V8T1 | M-phase phosphoprotein 8 | 2.81e-02 | NA | 0.003 |
| 3. B | Q5RJK8 | Acyl-CoA-binding domain-containing protein 6 | 6.23e-03 | NA | 0.001 |
| 3. B | D3ZBM7 | E3 ubiquitin-protein ligase HACE1 | 3.47e-03 | NA | 3.19e-12 |
| 3. B | Q9J5G9 | Putative ankyrin repeat protein FPV034 | NA | NA | 3.35e-08 |
| 3. B | A2AS55 | Ankyrin repeat domain-containing protein 16 | 2.22e-05 | NA | 2.13e-05 |
| 3. B | Q2QLA4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 7.41e-05 | NA | 1.15e-04 |
| 3. B | P23631 | Alpha-latrotoxin-Lt1a | 8.26e-02 | NA | 1.61e-08 |
| 3. B | P39010 | Palmitoyltransferase AKR1 | 2.11e-04 | NA | 2.46e-05 |
| 3. B | Q8WXD9 | Caskin-1 | 9.65e-02 | NA | 7.14e-10 |
| 3. B | Q8R560 | Ankyrin repeat domain-containing protein 1 | 7.57e-06 | NA | 3.02e-11 |
| 3. B | Q60778 | NF-kappa-B inhibitor beta | 1.11e-05 | NA | 0.002 |
| 3. B | Q9FY48 | E3 ubiquitin-protein ligase KEG | 4.99e-02 | NA | 1.10e-04 |
| 3. B | A0A084B9Z8 | Ankyrin repeat domain-containing protein SAT10 | 3.23e-01 | NA | 3.04e-06 |
| 3. B | Q8WZ74 | Cortactin-binding protein 2 | 3.23e-02 | NA | 4.88e-04 |
| 3. B | Q3EC11 | Probable protein S-acyltransferase 23 | 3.45e-05 | NA | 0.001 |
| 3. B | Q5B0V6 | Palmitoyltransferase akr1 | 2.21e-05 | NA | 2.48e-09 |
| 3. B | Q8BLD6 | Ankyrin repeat domain-containing protein 55 | 6.38e-05 | NA | 6.08e-07 |
| 3. B | Q6DRG7 | Protein phosphatase 1 regulatory subunit 12A | 1.80e-03 | NA | 6.23e-06 |
| 3. B | Q9VBP3 | Poly [ADP-ribose] polymerase tankyrase | 1.29e-02 | NA | 7.94e-13 |
| 3. B | Q6DCL5 | E3 ubiquitin-protein ligase HACE1 | 5.26e-03 | NA | 4.78e-13 |
| 3. B | Q9BR61 | Acyl-CoA-binding domain-containing protein 6 | 6.31e-03 | NA | 7.36e-06 |
| 3. B | Q2QL82 | Cortactin-binding protein 2 | 4.13e-02 | NA | 1.69e-04 |
| 3. B | Q96NW4 | Ankyrin repeat domain-containing protein 27 | 2.79e-03 | NA | 9.08e-12 |
| 3. B | A7E2S9 | Putative ankyrin repeat domain-containing protein 30B-like | 6.74e-05 | NA | 1.12e-54 |
| 3. B | Q8VE42 | Ankyrin repeat domain-containing protein 49 | 2.35e-03 | NA | 0.001 |