Summary

A2A3L6

Homolog: Q13702.
Function: 43 kDa receptor-associated protein of the synapse.

Statistics

Total GO Annotation: 184
Unique PROST Go: 138
Unique BLAST Go: 16

Total Homologs: 76
Unique PROST Homologs: 60
Unique BLAST Homologs: 7

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q13702 (43 kDa receptor-associated protein of the synapse) with a FATCAT P-Value: 2.57e-12 and RMSD of 2.96 angstrom. The sequence alignment identity is 21.2%.
Structural alignment shown in left. Query protein A2A3L6 colored as red in alignment, homolog Q13702 colored as blue. Query protein A2A3L6 is also shown in right top, homolog Q13702 showed in right bottom. They are colored based on secondary structures. 

  A2A3L6 MSSPNPEDVPRRPEPEPSSSNKKKKKRKWLRQEASIQALTRAGHGALQAGQNHEALNNFQRAFLLASKA-PQTRDT----PVLQACAFNLGAAYVETGDP 95
  Q13702 -----------------------------MGQDQTKQQI-EKG---LQLYQS----NQTEKALQVWTKVLEKSSDLMGRFRVL-GC---LVTAHSEMG-- 57

  A2A3L6 ARGLELLLRAHPE-EKAQGRRHGDQCFNVALAYHALGELPQALAWYHRALGHYQPQGDQGEAWAKMGACYQALGQPELAAHCLQEASQAYAQERQLRAAA 194
  Q13702 -RYKEMLKFAVVQIDTARELEDAD--F-LLESYLNLARSNEKLCEFHKTI-----------SYCK--TC---LGLP---------GTRAGAQ-------- 120

  A2A3L6 LALGAAAGCM-LKSGRHRVGEVVQVLEKSRRLAERSTERRL-LGHLYND---L------GLG--YSQLQLFPLAVEAFLQALPLCWVPGEQATVLRNLGM 281
  Q13702 --LG---GQVSLSMGNAFLG--LSVFQKA--L--ESFEKALRYAH-NNDDAMLECRVCCSLGSFYAQVKDYEKAL--F---FP-C----KAAELVNNYGK 198

  A2A3L6 AHNALGNYQEAREFHQKAA-DLHGSVGQRWEQGRSFGSLAFALSQLGDHKAARDNYLHAL------QAARDSGDMK---GQWQACEG----LGAAAARLG 367
  Q13702 GW-SL-KYRAMSQYHMAVAYRLLGRLGSAMECCEE--SMKIAL-QHGD----RP--LQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIG---NRLG 284

  A2A3L6 QYDQALKYYKEALAQC-------QKEPDSVRERLVAK-LADTVRTRLAQVGLVQTHTLT----SAPG--R-LQAPGGASQ----AEGTPAKAGSSTAGVQ 448
  Q13702 QV-QAL----LGVAKCWVARKALDKALDAI-ER--AQDLAEEVGNKLSQLKL---HCLSESIYRSKGLQRELRAH--VVRFHECVEETELYCG--LCG-- 367

  A2A3L6 HRSSSGWEDEEFEEGHQKKKEERSANVPVRAGPGRPELCFLPGTVNHSHHLASSC--PTFTKHTP-CRGTVLGKASIYSPGPRAHLPFVGPGPPRAEYPS 545
  Q13702 --ESIG----------EK-------NSRLQALP-----C------SHIFHL--RCLQNNGTRSCPNCR-----RSSM-KPG------FV----------- 412

  A2A3L6 ILVPNGPQANRSSRWPRESLSRSRQRRPMESGICTIV 582
  Q13702 ------------------------------------- 412

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0016239 positive regulation of macroautophagy
1. PB GO:0008277 regulation of G protein-coupled receptor signaling pathway
1. PB GO:0097575 lateral cell cortex
1. PB GO:0051301 cell division
1. PB GO:0060170 ciliary membrane
1. PB GO:1905098 negative regulation of guanyl-nucleotide exchange factor activity
1. PB GO:0031291 Ran protein signal transduction
1. PB GO:0007098 centrosome cycle
1. PB GO:0007399 nervous system development
1. PB GO:0000132 establishment of mitotic spindle orientation
1. PB GO:0008022 protein C-terminus binding
1. PB GO:0051661 maintenance of centrosome location
1. PB GO:0034451 centriolar satellite
1. PB GO:0005092 GDP-dissociation inhibitor activity
1. PB GO:0070840 dynein complex binding
1. PB GO:0043621 protein self-association
1. PB GO:0005813 centrosome
1. PB GO:0032991 protein-containing complex
1. PB GO:0016328 lateral plasma membrane
1. PB GO:0034260 negative regulation of GTPase activity
1. PB GO:0000242 pericentriolar material
1. PB GO:1905832 positive regulation of spindle assembly
1. PB GO:0007052 mitotic spindle organization
1. PB GO:0000139 Golgi membrane
1. PB GO:0060236 regulation of mitotic spindle organization
1. PB GO:0001965 G-protein alpha-subunit binding
1. PB GO:0099738 cell cortex region
1. PB GO:0097431 mitotic spindle pole
1. PB GO:0005938 cell cortex
1. PB GO:1904778 positive regulation of protein localization to cell cortex
2. P GO:0009306 protein secretion
2. P GO:0021766 hippocampus development
2. P GO:0009556 microsporogenesis
2. P GO:0030837 negative regulation of actin filament polymerization
2. P GO:0071539 protein localization to centrosome
2. P GO:0000796 condensin complex
2. P GO:0060296 regulation of cilium beat frequency involved in ciliary motility
2. P GO:0046548 retinal rod cell development
2. P GO:0055037 recycling endosome
2. P GO:0007076 mitotic chromosome condensation
2. P GO:0007271 synaptic transmission, cholinergic
2. P GO:0035255 ionotropic glutamate receptor binding
2. P GO:0019894 kinesin binding
2. P GO:0140312 cargo adaptor activity
2. P GO:0099634 postsynaptic specialization membrane
2. P GO:1902855 regulation of non-motile cilium assembly
2. P GO:0005929 cilium
2. P GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
2. P GO:0099638 endosome to plasma membrane protein transport
2. P GO:0006891 intra-Golgi vesicle-mediated transport
2. P GO:0048487 beta-tubulin binding
2. P GO:0007268 chemical synaptic transmission
2. P GO:0030121 AP-1 adaptor complex
2. P GO:0038108 negative regulation of appetite by leptin-mediated signaling pathway
2. P GO:0060324 face development
2. P GO:0003085 negative regulation of systemic arterial blood pressure
2. P GO:0010032 meiotic chromosome condensation
2. P GO:0032465 regulation of cytokinesis
2. P GO:0001895 retina homeostasis
2. P GO:0080163 regulation of protein serine/threonine phosphatase activity
2. P GO:0001750 photoreceptor outer segment
2. P GO:0010438 cellular response to sulfur starvation
2. P GO:1900075 positive regulation of neuromuscular synaptic transmission
2. P GO:0048854 brain morphogenesis
2. P GO:0034464 BBSome
2. P GO:0034088 maintenance of mitotic sister chromatid cohesion
2. P GO:0035176 social behavior
2. P GO:0035825 homologous recombination
2. P GO:0051307 meiotic chromosome separation
2. P GO:0030534 adult behavior
2. P GO:0043323 positive regulation of natural killer cell degranulation
2. P GO:0060287 epithelial cilium movement involved in determination of left/right asymmetry
2. P GO:0005802 trans-Golgi network
2. P GO:0072659 protein localization to plasma membrane
2. P GO:0061938 protein localization to somatodendritic compartment
2. P GO:0005198 structural molecule activity
2. P GO:0120229 protein localization to motile cilium
2. P GO:0045087 innate immune response
2. P GO:0030742 GTP-dependent protein binding
2. P GO:0035646 endosome to melanosome transport
2. P GO:0009615 response to virus
2. P GO:0000281 mitotic cytokinesis
2. P GO:1905515 non-motile cilium assembly
2. P GO:0043495 protein-membrane adaptor activity
2. P GO:0097729 9+2 motile cilium
2. P GO:0001917 photoreceptor inner segment
2. P GO:0006896 Golgi to vacuole transport
2. P GO:0051492 regulation of stress fiber assembly
2. P GO:0035615 clathrin adaptor activity
2. P GO:0021756 striatum development
2. P GO:0044321 response to leptin
2. P GO:0120228 outer dynein arm docking complex
2. P GO:0097730 non-motile cilium
2. P GO:0010439 regulation of glucosinolate biosynthetic process
2. P GO:0030126 COPI vesicle coat
2. P GO:1905719 protein localization to perinuclear region of cytoplasm
2. P GO:0006886 intracellular protein transport
2. P GO:0016358 dendrite development
2. P GO:0061512 protein localization to cilium
2. P GO:0030131 clathrin adaptor complex
2. P GO:0030136 clathrin-coated vesicle
2. P GO:0033130 acetylcholine receptor binding
2. P GO:1903546 protein localization to photoreceptor outer segment
2. P GO:0090660 cerebrospinal fluid circulation
2. P GO:0072384 organelle transport along microtubule
2. P GO:0008285 negative regulation of cell population proliferation
2. P GO:0051457 maintenance of protein location in nucleus
2. P GO:1903540 establishment of protein localization to postsynaptic membrane
2. P GO:0006898 receptor-mediated endocytosis
2. P GO:0099518 vesicle cytoskeletal trafficking
2. P GO:0033365 protein localization to organelle
2. P GO:0016192 vesicle-mediated transport
2. P GO:0045444 fat cell differentiation
2. P GO:0000779 condensed chromosome, centromeric region
2. P GO:0001843 neural tube closure
2. P GO:0005793 endoplasmic reticulum-Golgi intermediate compartment
2. P GO:0070695 FHF complex
2. P GO:0036064 ciliary basal body
2. P GO:0000226 microtubule cytoskeleton organization
2. P GO:0008287 protein serine/threonine phosphatase complex
2. P GO:0016604 nuclear body
2. P GO:0045494 photoreceptor cell maintenance
2. P GO:0043525 positive regulation of neuron apoptotic process
2. P GO:0035064 methylated histone binding
2. P GO:0030124 AP-4 adaptor complex
2. P GO:0051607 defense response to virus
2. P GO:0043014 alpha-tubulin binding
2. P GO:0031594 neuromuscular junction
2. P GO:0001764 neuron migration
2. P GO:0060613 fat pad development
2. P GO:0120197 mucociliary clearance
2. P GO:0040018 positive regulation of multicellular organism growth
2. P GO:0034454 microtubule anchoring at centrosome
2. P GO:0046854 phosphatidylinositol phosphate biosynthetic process
2. P GO:0005814 centriole
2. P GO:0005769 early endosome
2. P GO:0042585 germinal vesicle
2. P GO:0005818 aster
2. P GO:0034452 dynactin binding
2. P GO:0005798 Golgi-associated vesicle
2. P GO:0090160 Golgi to lysosome transport
2. P GO:0045954 positive regulation of natural killer cell mediated cytotoxicity
2. P GO:0035634 response to stilbenoid
2. P GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
2. P GO:0005794 Golgi apparatus
2. P GO:0007286 spermatid development
2. P GO:0009965 leaf morphogenesis
2. P GO:0021591 ventricular system development
2. P GO:0032391 photoreceptor connecting cilium
2. P GO:0021987 cerebral cortex development
2. P GO:0007608 sensory perception of smell
2. P GO:1901626 regulation of postsynaptic membrane organization
2. P GO:0031514 motile cilium
2. P GO:0035845 photoreceptor cell outer segment organization
2. P GO:0035457 cellular response to interferon-alpha
2. P GO:0005829 cytosol
2. P GO:0030133 transport vesicle
2. P GO:1901799 negative regulation of proteasomal protein catabolic process
2. P GO:0019216 regulation of lipid metabolic process
2. P GO:0005721 pericentric heterochromatin
2. P GO:0050893 sensory processing
2. P GO:0045724 positive regulation of cilium assembly
2. P GO:0035869 ciliary transition zone
2. P GO:0032116 SMC loading complex
2. P GO:0045880 positive regulation of smoothened signaling pathway
2. P GO:0032438 melanosome organization
2. P GO:0033210 leptin-mediated signaling pathway
2. P GO:0030674 protein-macromolecule adaptor activity
3. B GO:0036126 sperm flagellum
3. B GO:0019900 kinase binding
3. B GO:0005783 endoplasmic reticulum
3. B GO:0004169 dolichyl-phosphate-mannose-protein mannosyltransferase activity
3. B GO:0007346 regulation of mitotic cell cycle
3. B GO:0035269 protein O-linked mannosylation
3. B GO:0005789 endoplasmic reticulum membrane
3. B GO:0019904 protein domain specific binding
3. B GO:0044782 cilium organization
3. B GO:1990023 mitotic spindle midzone
3. B GO:0030496 midbody
3. B GO:0030154 cell differentiation
3. B GO:0006396 RNA processing
3. B GO:0000030 mannosyltransferase activity
3. B GO:0003341 cilium movement
3. B GO:0005856 cytoskeleton

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q80XJ3 Tetratricopeptide repeat protein 28 2.96e-03 2.19e-02 1.23e-15
1. PB Q8BYG0 Tetratricopeptide repeat protein 24 7.54e-10 1.10e-13 1.09e-127
1. PB Q86YR5 G-protein-signaling modulator 1 7.92e-08 4.25e-11 6.57e-13
1. PB Q9R080 G-protein-signaling modulator 1 6.26e-06 8.53e-09 1.81e-12
1. PB P81274 G-protein-signaling modulator 2 1.92e-07 1.95e-09 2.28e-11
1. PB Q28G25 Bardet-Biedl syndrome 4 protein homolog 8.95e-08 7.24e-09 1.00e-04
1. PB Q6IR34 G-protein-signaling modulator 1 9.07e-08 2.28e-10 3.70e-12
1. PB Q8VDU0 G-protein-signaling modulator 2 1.04e-07 1.26e-08 3.59e-11
1. PB A2A3L6 Tetratricopeptide repeat protein 24 0 7.68e-156 0.0
2. P P09108 43 kDa receptor-associated protein of the synapse 4.53e-12 1.06e-04 NA
2. P Q8C0Y0 Serine/threonine-protein phosphatase 4 regulatory subunit 4 4.01e-03 2.70e-03 NA
2. P Q09485 43 kDa receptor-associated protein of the synapse homolog 1.07e-06 1.47e-08 NA
2. P A5A6J9 Interferon-induced protein with tetratricopeptide repeats 3 2.37e-06 6.55e-05 NA
2. P P42695 Condensin-2 complex subunit D3 2.50e-02 3.53e-02 NA
2. P Q96RK4 Bardet-Biedl syndrome 4 protein 8.62e-09 5.81e-08 NA
2. P Q99128 AP-1 complex subunit gamma-1 5.24e-03 1.59e-04 NA
2. P O88512 AP-1 complex subunit gamma-like 2 1.72e-03 1.78e-02 NA
2. P Q29AE5 Coatomer subunit gamma 2.69e-03 4.44e-02 NA
2. P Q5EA11 Tetratricopeptide repeat protein 4 3.28e-03 4.32e-02 NA
2. P Q00558 40-kDa huntingtin-associated protein 1.96e-04 1.06e-04 NA
2. P Q9ZUI6 AP-1 complex subunit gamma-2 7.07e-04 1.80e-02 NA
2. P O43747 AP-1 complex subunit gamma-1 8.44e-04 2.48e-04 NA
2. P Q9FKV5 Protein POLLENLESS 3-LIKE 1 7.07e-04 1.69e-11 NA
2. P Q84K16 AP-1 complex subunit gamma-1 5.19e-03 1.02e-02 NA
2. P Q7PVF6 Coatomer subunit gamma 1.15e-03 4.32e-02 NA
2. P P22892 AP-1 complex subunit gamma-1 1.18e-03 3.86e-04 NA
2. P B4NKT1 MAU2 chromatid cohesion factor homolog 4.41e-06 2.32e-02 NA
2. P Q9D2X8 Uncharacterized protein C8orf76 homolog 3.46e-03 6.96e-03 NA
2. P Q8BG67 Protein EFR3 homolog A 7.64e-04 2.96e-04 NA
2. P Q95LZ5 Tetratricopeptide repeat protein 16 1.66e-03 7.19e-07 NA
2. P Q66JI9 Coatomer subunit gamma-2 1.46e-03 3.70e-02 NA
2. P Q6ZQK0 Condensin-2 complex subunit D3 2.01e-02 1.55e-03 NA
2. P Q96K31 Uncharacterized protein C8orf76 1.34e-03 1.97e-02 NA
2. P P53272 Uncharacterized protein YGR122W 1.05e-02 4.24e-02 NA
2. P Q9SUC3 Protein POLLENLESS 3 1.24e-03 6.67e-07 NA
2. P O14879 Interferon-induced protein with tetratricopeptide repeats 3 2.33e-06 1.44e-05 NA
2. P Q5K6N0 Transmembrane protein 232 1.66e-03 7.32e-03 NA
2. P Q64345 Interferon-induced protein with tetratricopeptide repeats 3 6.34e-06 2.29e-03 NA
2. P Q22498 Probable coatomer subunit gamma 3.47e-03 3.81e-02 NA
2. P Q03569 G-protein regulator 2 3.85e-06 3.25e-13 NA
2. P Q8GZ63 Pentatricopeptide repeat-containing protein At5g25630 1.74e-04 4.45e-04 NA
2. P M0RDU0 40-kDa huntingtin-associated protein 1.20e-04 1.31e-04 NA
2. P Q95QJ7 G-protein regulator 1 2.03e-06 1.04e-14 NA
2. P B0G194 Dymeclin 3.85e-02 2.01e-02 NA
2. P F4I735 Sister chromatid cohesion protein PDS5 homolog B NA 3.70e-02 NA
2. P O42393 43 kDa receptor-associated protein of the synapse 3.54e-12 9.88e-05 NA
2. P P23610 40-kDa huntingtin-associated protein 3.61e-05 6.82e-03 NA
2. P P12672 43 kDa receptor-associated protein of the synapse 3.45e-12 5.39e-05 NA
2. P O75843 AP-1 complex subunit gamma-like 2 1.80e-03 4.82e-03 NA
2. P Q66H54 FHF complex subunit HOOK interacting protein 1B 8.38e-03 4.84e-02 NA
2. P Q96NG3 Outer dynein arm-docking complex subunit 4 5.56e-04 2.79e-03 NA
2. P Q6ZQ18 Protein EFR3 homolog B 2.27e-03 3.57e-04 NA
2. P Q8C1F5 Tetratricopeptide repeat protein 16 3.50e-05 1.39e-11 NA
2. P Q5SPP5 Protein EFR3 homolog B 6.74e-04 3.05e-02 NA
2. P Q8NEE8 Tetratricopeptide repeat protein 16 2.16e-04 2.32e-06 NA
2. P Q9Y2G0 Protein EFR3 homolog B 1.03e-03 7.74e-04 NA
2. P Q14156 Protein EFR3 homolog A 9.61e-04 4.91e-04 NA
2. P Q1JQ97 Bardet-Biedl syndrome 4 protein homolog 1.01e-07 6.06e-11 NA
2. P Q5W5X9 Tetratricopeptide repeat protein 23 9.99e-09 9.91e-03 NA
2. P Q9WV76 AP-4 complex subunit beta-1 1.00e-03 4.00e-02 NA
2. P Q5R5M2 AP-1 complex subunit gamma-1 7.63e-04 3.31e-04 NA
2. P Q8L730 Protein SULFUR DEFICIENCY-INDUCED 2 2.82e-05 1.11e-03 NA
2. P Q8C1Z7 Bardet-Biedl syndrome 4 protein homolog 2.80e-08 1.95e-08 NA
2. P Q13702 43 kDa receptor-associated protein of the synapse 2.57e-12 2.01e-04 NA
2. P Q9PUE4 Coatomer subunit gamma-2 2.93e-03 2.28e-02 NA
2. P Q2KHY7 Tetratricopeptide repeat protein 23 4.97e-09 8.80e-04 NA
2. P Q9SD20 Protein POLLENLESS 3-LIKE 2 7.10e-05 4.39e-07 NA
2. P Q9I8E6 Coatomer subunit gamma-2 9.69e-04 3.17e-02 NA
2. P Q641A2 Protein EFR3 homolog A 8.09e-04 1.36e-03 NA
3. B Q3UV71 Protein O-mannosyl-transferase TMTC1 3.29e-09 NA 0.009
3. B Q80VM3 Tetratricopeptide repeat protein 29 3.79e-08 NA 0.024
3. B Q96AY4 Tetratricopeptide repeat protein 28 4.57e-03 NA 4.32e-16
3. B Q9V3X5 Protein O-mannosyl-transferase TMTC2 9.44e-06 NA 0.005
3. B P19737 TPR repeat-containing protein SYNPCC7002_A0425 1.73e-10 NA 1.70e-05
3. B Q6AYP3 Tetratricopeptide repeat protein 29 1.18e-07 NA 0.010
3. B Q8IUR5 Protein O-mannosyl-transferase TMTC1 6.35e-08 NA 6.83e-04