Summary

A2RU37

Homolog: Q9SX22.
Function: 30S ribosomal protein 3-1, chloroplastic.

Statistics

Total GO Annotation: 113
Unique PROST Go: 113
Unique BLAST Go: 0

Total Homologs: 109
Unique PROST Homologs: 108
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q9SX22 (30S ribosomal protein 3-1, chloroplastic) with a FATCAT P-Value: 0.0196 and RMSD of 3.26 angstrom. The sequence alignment identity is 12.4%.
Structural alignment shown in left. Query protein A2RU37 colored as red in alignment, homolog Q9SX22 colored as blue. Query protein A2RU37 is also shown in right top, homolog Q9SX22 showed in right bottom. They are colored based on secondary structures. 

  A2RU37 -----------------------------------------------------------------------------------------MWSRR--GLGV 9
  Q9SX22 MMSSMALSSTSLCSSFISQHPKLSITASPPLFHTQTTKPISVKRKIITLAAPETLTAETVTGIDTSDNTPQQTIKVVKPDEKSRVVLKFVWMEKNIGLGL 100

  A2RU37 S-RAPLH--LLLG---VWGPSGRTGGQRKGA------SL-ARPGRGGLASCSVGANGKRDVLFLRKTLTNTVEDIQIDNFRRKSDLGVGSPDWKNLLIDV 96
  Q9SX22 DQHVPGHGTIPLSPYFFW-P-------RKDAWEELKSTLEAKP---WISQ-------KKMIILLNQA-T----DI-I-NLWQQS--G-G-----NL---- 163

  A2RU37 TREDHENSQNNSKRRCKVNCETDQR 121
  Q9SX22 TSQ---------------------- 166

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0005746 mitochondrial respirasome
2. P GO:0010258 NADH dehydrogenase complex (plastoquinone) assembly
2. P GO:0030984 kininogen binding
2. P GO:1901165 positive regulation of trophoblast cell migration
2. P GO:0048025 negative regulation of mRNA splicing, via spliceosome
2. P GO:0010196 nonphotochemical quenching
2. P GO:0042644 chloroplast nucleoid
2. P GO:0046621 negative regulation of organ growth
2. P GO:0035483 gastric emptying
2. P GO:0014065 phosphatidylinositol 3-kinase signaling
2. P GO:0000122 negative regulation of transcription by RNA polymerase II
2. P GO:0005762 mitochondrial large ribosomal subunit
2. P GO:0001849 complement component C1q complex binding
2. P GO:0009941 chloroplast envelope
2. P GO:0031690 adrenergic receptor binding
2. P GO:0005080 protein kinase C binding
2. P GO:0048786 presynaptic active zone
2. P GO:0015986 ATP synthesis coupled proton transport
2. P GO:0043196 varicosity
2. P GO:0039592 suppression by virus of G2/M transition of host mitotic cell cycle
2. P GO:0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)
2. P GO:0001964 startle response
2. P GO:1904231 positive regulation of succinate dehydrogenase activity
2. P GO:2000510 positive regulation of dendritic cell chemotaxis
2. P GO:0043065 positive regulation of apoptotic process
2. P GO:0019230 proprioception
2. P GO:0005753 mitochondrial proton-transporting ATP synthase complex
2. P GO:0097177 mitochondrial ribosome binding
2. P GO:0008047 enzyme activator activity
2. P GO:0003714 transcription corepressor activity
2. P GO:0034986 iron chaperone activity
2. P GO:0060455 negative regulation of gastric acid secretion
2. P GO:0005540 hyaluronic acid binding
2. P GO:1904234 positive regulation of aconitate hydratase activity
2. P GO:0030449 regulation of complement activation
2. P GO:0042256 mature ribosome assembly
2. P GO:0006958 complement activation, classical pathway
2. P GO:0015078 proton transmembrane transporter activity
2. P GO:0042756 drinking behavior
2. P GO:0032544 plastid translation
2. P GO:0005751 mitochondrial respiratory chain complex IV
2. P GO:0018283 iron incorporation into metallo-sulfur cluster
2. P GO:0006351 transcription, DNA-templated
2. P GO:0003081 regulation of systemic arterial blood pressure by renin-angiotensin
2. P GO:0039652 induction by virus of host NF-kappaB cascade
2. P GO:0009986 cell surface
2. P GO:0039534 negative regulation of MDA-5 signaling pathway
2. P GO:0036444 calcium import into the mitochondrion
2. P GO:0051431 corticotropin-releasing hormone receptor 2 binding
2. P GO:0045785 positive regulation of cell adhesion
2. P GO:1990246 uniplex complex
2. P GO:0009570 chloroplast stroma
2. P GO:0098807 chloroplast thylakoid membrane protein complex
2. P GO:0045792 negative regulation of cell size
2. P GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
2. P GO:0005737 cytoplasm
2. P GO:0016123 xanthophyll biosynthetic process
2. P GO:0034553 mitochondrial respiratory chain complex II assembly
2. P GO:0050687 negative regulation of defense response to virus
2. P GO:0032689 negative regulation of interferon-gamma production
2. P GO:1990221 L-cysteine desulfurase complex
2. P GO:0006397 mRNA processing
2. P GO:0033650 host cell mitochondrion
2. P GO:0030157 pancreatic juice secretion
2. P GO:0042775 mitochondrial ATP synthesis coupled electron transport
2. P GO:2000252 negative regulation of feeding behavior
2. P GO:0005747 mitochondrial respiratory chain complex I
2. P GO:0051430 corticotropin-releasing hormone receptor 1 binding
2. P GO:0032695 negative regulation of interleukin-12 production
2. P GO:0045815 epigenetic maintenance of chromatin in transcription-competent conformation
2. P GO:0045333 cellular respiration
2. P GO:0060452 positive regulation of cardiac muscle contraction
2. P GO:0010722 regulation of ferrochelatase activity
2. P GO:0006119 oxidative phosphorylation
2. P GO:0098982 GABA-ergic synapse
2. P GO:0090023 positive regulation of neutrophil chemotaxis
2. P GO:0070131 positive regulation of mitochondrial translation
2. P GO:0080153 negative regulation of reductive pentose-phosphate cycle
2. P GO:0019079 viral genome replication
2. P GO:0009688 abscisic acid biosynthetic process
2. P GO:0003729 mRNA binding
2. P GO:0032099 negative regulation of appetite
2. P GO:2000987 positive regulation of behavioral fear response
2. P GO:0009535 chloroplast thylakoid membrane
2. P GO:0008380 RNA splicing
2. P GO:0045273 respiratory chain complex II
2. P GO:0042025 host cell nucleus
2. P GO:0006915 apoptotic process
2. P GO:0051461 positive regulation of corticotropin secretion
2. P GO:0046888 negative regulation of hormone secretion
2. P GO:0043117 positive regulation of vascular permeability
2. P GO:0009654 photosystem II oxygen evolving complex
2. P GO:0034199 activation of protein kinase A activity
2. P GO:0005759 mitochondrial matrix
2. P GO:0005739 mitochondrion
2. P GO:0046811 histone deacetylase inhibitor activity
2. P GO:0003084 positive regulation of systemic arterial blood pressure
2. P GO:0008241 peptidyl-dipeptidase activity
2. P GO:0032543 mitochondrial translation
2. P GO:0008494 translation activator activity
2. P GO:0045087 innate immune response
2. P GO:0060547 negative regulation of necrotic cell death
2. P GO:0051560 mitochondrial calcium ion homeostasis
2. P GO:0032307 negative regulation of prostaglandin secretion
2. P GO:0051897 positive regulation of protein kinase B signaling
2. P GO:0031305 integral component of mitochondrial inner membrane
2. P GO:0006851 mitochondrial calcium ion transmembrane transport
2. P GO:1900139 negative regulation of arachidonic acid secretion
2. P GO:0030307 positive regulation of cell growth
2. P GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
2. P GO:0042776 mitochondrial ATP synthesis coupled proton transport
2. P GO:0039536 negative regulation of RIG-I signaling pathway
2. P GO:0010996 response to auditory stimulus

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A2RU37 Uncharacterized protein encoded by LINC02872 0 8.79e-140 1.88e-84
2. P Q9QAX0 Protein X NA 4.60e-02 NA
2. P Q96500 Light-regulated protein 1, chloroplastic 3.95e-01 4.86e-02 NA
2. P Q6H612 Protein PLASTID REDOX INSENSITIVE 2, chloroplastic 1.85e-01 2.47e-02 NA
2. P P0C686 Protein X NA 6.79e-04 NA
2. P Q02374 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial 5.75e-01 9.26e-03 NA
2. P Q9IBI5 Protein X NA 3.81e-05 NA
2. P Q80IU5 Protein X NA 9.00e-05 NA
2. P Q8JMY3 Protein X NA 8.26e-05 NA
2. P Q0MQJ1 NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial 1.68e-01 1.50e-03 NA
2. P P00842 ATP synthase subunit 9, mitochondrial 6.41e-01 8.35e-03 NA
2. P Q0JG75 Photosystem II reaction center PSB28 protein, chloroplastic 9.76e-02 1.40e-04 NA
2. P A9THA7 NAD(P)H-quinone oxidoreductase subunit M, chloroplastic 3.37e-01 5.10e-03 NA
2. P O22914 Calvin cycle protein CP12-1, chloroplastic 5.25e-01 3.92e-02 NA
2. P Q3E7A3 Uncharacterized protein YJL133C-A 9.65e-01 1.84e-03 NA
2. P Q0MQJ2 NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial 2.76e-01 1.79e-02 NA
2. P P46522 Late embryogenesis abundant protein Lea5-D 6.56e-01 2.40e-03 NA
2. P Q9SX22 30S ribosomal protein 3-1, chloroplastic 1.96e-02 4.48e-04 NA
2. P Q5R9K2 Cytochrome c oxidase subunit 7B, mitochondrial 8.96e-01 4.56e-02 NA
2. P Q24407 ATP synthase-coupling factor 6, mitochondrial 5.45e-01 1.06e-02 NA
2. P Q3T0B6 Complement component 1 Q subcomponent-binding protein, mitochondrial 1.74e-01 7.36e-04 NA
2. P Q86SI9 Protein CEI 8.55e-01 1.21e-02 NA
2. P Q9Y7U8 54S ribosomal protein L37, mitochondrial 4.57e-01 1.98e-04 NA
2. P P12820 Angiotensin-converting enzyme (Fragment) 6.79e-01 2.47e-02 NA
2. P P87133 Meiotically up-regulated gene 143 protein 4.40e-01 2.39e-05 NA
2. P Q69027 Protein X NA 6.32e-04 NA
2. P Q5VUM1 Succinate dehydrogenase assembly factor 4, mitochondrial 1.99e-01 2.76e-04 NA
2. P A0A1D1V3Z0 Mitochondrial-abundant heat soluble protein 7.68e-01 3.27e-03 NA
2. P O91531 Protein X NA 2.72e-03 NA
2. P Q69607 Protein X NA 9.80e-03 NA
2. P O80813 Ycf20-like protein 6.47e-01 4.10e-02 NA
2. P O94629 Stress-responsive protein 1 5.10e-01 5.29e-03 NA
2. P Q8BTE0 Succinate dehydrogenase assembly factor 4, mitochondrial 1.95e-01 2.88e-04 NA
2. P Q9LFV0 30S ribosomal protein 3-2, chloroplastic 6.54e-02 4.34e-04 NA
2. P Q40070 Photosystem II 10 kDa polypeptide, chloroplastic 3.12e-01 8.27e-03 NA
2. P Q69604 Protein X NA 4.86e-04 NA
2. P Q6P161 39S ribosomal protein L54, mitochondrial 5.86e-01 1.33e-03 NA
2. P P20977 Protein X NA 3.00e-05 NA
2. P P12936 Protein X NA 3.71e-03 NA
2. P Q9MZE0 Complement component 1 Q subcomponent-binding protein, mitochondrial 3.48e-01 6.32e-04 NA
2. P Q07021 Complement component 1 Q subcomponent-binding protein, mitochondrial 3.48e-01 6.93e-04 NA
2. P Q03672 ATP synthase subunit 9, mitochondrial 8.51e-01 1.98e-02 NA
2. P P17102 Protein X NA 4.00e-04 NA
2. P Q03200 Light-regulated protein, chloroplastic 3.79e-01 4.73e-02 NA
2. P Q9U505 ATP synthase lipid-binding protein, mitochondrial 2.93e-01 5.66e-03 NA
2. P P20976 Protein X NA 2.09e-02 NA
2. P Q9PXA2 Protein X NA 1.51e-06 NA
2. P O35796 Complement component 1 Q subcomponent-binding protein, mitochondrial 2.32e-01 1.11e-04 NA
2. P O61694 Cytochrome c oxidase subunit 5A, mitochondrial (Fragment) 7.40e-01 3.61e-04 NA
2. P Q64902 Protein X NA 1.36e-02 NA
2. P A2BDG5 Shadow of prion protein 7.63e-01 9.09e-03 NA
2. P Q8BK30 NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial 1.39e-01 2.49e-03 NA
2. P P20975 Protein X NA 1.23e-03 NA
2. P P56181 NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial 3.69e-01 1.79e-02 NA
2. P Q2M2S2 Essential MCU regulator, mitochondrial 9.72e-02 2.09e-03 NA
2. P Q39084 Late embryogenis abundant protein 41 3.69e-01 1.83e-06 NA
2. P Q8JN06 Protein X NA 1.45e-04 NA
2. P Q3MHJ5 39S ribosomal protein L54, mitochondrial 7.09e-01 7.62e-06 NA
2. P Q7JZM8 39S ribosomal protein L41, mitochondrial 8.78e-01 3.61e-02 NA
2. P Q67923 Protein X NA 2.09e-03 NA
2. P B6UFC7 Protein PLASTID REDOX INSENSITIVE 2, chloroplastic 4.09e-01 1.60e-02 NA
2. P P27114 Promotilin 6.30e-01 1.98e-02 NA
2. P Q9M9H3 Embryogenesis-like protein 5.72e-01 4.25e-02 NA
2. P O59673 ATP synthase subunit H, mitochondrial 5.36e-01 4.90e-02 NA
2. P O35658 Complement component 1 Q subcomponent-binding protein, mitochondrial 1.82e-01 2.54e-04 NA
2. P P87743 Protein X NA 4.86e-02 NA
2. P P25712 NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial 1.94e-01 8.47e-04 NA
2. P P03168 Protein X NA 2.45e-02 NA
2. P Q5ZEG0 Protein MAO HUZI 4, chloroplastic 4.83e-01 2.40e-03 NA
2. P P0C685 Protein X NA 2.52e-04 NA
2. P Q1LXI5 39S ribosomal protein L54, mitochondrial 6.18e-01 4.40e-02 NA
2. P Q9PX75 Protein X NA 6.17e-03 NA
2. P Q9J5S3 Protein X NA 1.95e-02 NA
2. P P12913 Protein X NA 3.69e-06 NA
2. P Q80IU8 Protein X NA 1.98e-04 NA
2. P Q9E6S8 Protein X NA 1.38e-03 NA
2. P Q0MQJ0 NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial 1.71e-01 2.56e-02 NA
2. P Q8JMZ5 Protein X NA 2.56e-06 NA
2. P P0C5N3 Uncharacterized protein YGL041W-A, mitochondrial 3.29e-01 4.73e-02 NA
2. P Q67877 Protein X NA 9.59e-05 NA
2. P Q4R1S1 Protein X NA 7.59e-05 NA
2. P P10690 Photosystem II 10 kDa polypeptide, chloroplastic 4.80e-01 3.61e-02 NA
2. P P03165 Protein X NA 4.04e-04 NA
2. P Q9USM2 Uncharacterized protein C16A11.15c 3.98e-01 2.64e-03 NA
2. P Q95283 Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (Fragment) NA 1.38e-02 NA
2. P Q6ZUF6 Putative uncharacterized protein encoded by LINC00336 2.94e-01 2.24e-03 NA
2. P Q9YZR6 Protein X NA 1.76e-02 NA
2. P Q0U6J9 54S ribosomal protein L4, mitochondrial 6.26e-01 9.98e-03 NA
2. P Q9DAE7 Uncharacterized protein C11orf97 homolog 6.77e-01 2.64e-03 NA
2. P Q40519 Photosystem II 10 kDa polypeptide, chloroplastic 4.95e-01 1.84e-03 NA
2. P Q96KR6 Protein FAM210B, mitochondrial 4.54e-01 5.99e-03 NA
2. P Q913A9 Protein X NA 1.74e-07 NA
2. P Q91C38 Protein X NA 3.54e-03 NA
2. P O93195 Protein X NA 2.40e-03 NA
2. P P0C678 Protein X NA 9.61e-03 NA
2. P Q8JMY5 Protein X NA 1.81e-05 NA
2. P Q39644 Late embryogenesis abundant protein Lea5 1.86e-01 3.21e-03 NA
2. P Q05B87 Frataxin, mitochondrial 1.58e-01 1.33e-04 NA
2. P P09859 Gastrin/cholecystokinin-like peptide 8.85e-01 7.82e-03 NA
2. P Q9QMI3 Protein X NA 1.45e-03 NA
2. P Q54HY7 Uncharacterized protein DDB_G0289137 4.40e-01 1.42e-04 NA
2. P Q9CPW3 39S ribosomal protein L54, mitochondrial 4.04e-01 1.11e-04 NA
2. P Q9H4I9 Essential MCU regulator, mitochondrial 7.99e-02 2.83e-02 NA
2. P P24026 Protein X NA 5.25e-07 NA
2. P Q0JDA2 Succinate dehydrogenase subunit 5, mitochondrial 7.26e-01 1.83e-02 NA
2. P P0C689 Protein X NA 1.81e-02 NA
2. P P0C681 Protein X NA 4.86e-04 NA
2. P P55089 Urocortin 8.38e-01 4.48e-02 NA
2. P P21571 ATP synthase-coupling factor 6, mitochondrial 7.33e-01 1.95e-02 NA