Results | PROST

Summary

A6NC57

Homolog: Q9H560.
Function: Putative ankyrin repeat domain-containing protein 19.

Statistics

Total GO Annotation: 840
Unique PROST Go: 109
Unique BLAST Go: 695

Total Homologs: 764
Unique PROST Homologs: 57
Unique BLAST Homologs: 665

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q9H560 (Putative ankyrin repeat domain-containing protein 19) with a FATCAT P-Value: 2.66e-15 and RMSD of 2.00 angstrom. The sequence alignment identity is 14.8%.
Structural alignment shown in left. Query protein A6NC57 colored as red in alignment, homolog Q9H560 colored as blue. Query protein A6NC57 is also shown in right top, homolog Q9H560 showed in right bottom. They are colored based on secondary structures.

  A6NC57 MEVRGSFLAACRRRMA-TWRKNRDKDGFSNPGYRVRQKDLGMIHKAAIAGDVNKVMESILLRLNDLNDRDKKNRTALLLACAHGRPGVVADLVARKCQLN 99
  Q9H560 M--RK--LFSFGRRLGQALLDSMDQE-YAGRGYHIRDWELRKIHRAAIKGDAAEVEHCLTRRFRDLDARDRKDRTVLHLTCAHGRVEVVTLLLSRRCQIN 95

  A6NC57 LTDSENRTALIKAVQCQEEVCASILLEHGANPNVRDMYGNTALHYAIDNENISMARKLLAYGADIEARSQDGHTSLLLAVNRKKEQMVAFLLKKKPDLTA 199
  Q9H560 IYDRLNRTPLMKAVHCQEEACAIILLEHGANPNIKDIYSNTALHYAVYNKGTSLAEKLLSHHANIEALNEEGNTPLLFAINSRRQQIVEFLLKNQANLHA 195

  A6NC57 IDNFGRTALILAARNGSTSVVYQLLQHNIDVFCQDISGWTAEDYAVASKFQAIRGMISEYKANKRCKS-LQNSNSEQDLEMTSEGEQERLEGCESSQPQV 298
  Q9H560 IDNFRRTALMLAVQHNSSSIVSLLLQQNINIFSQDLFGQTAEDYAVCYNFRSIQQQILEHK-NKILKSHL------------------------------ 264

  A6NC57 EEKMKKCRNKKMEVSRNVHADDSDNYNDDVDELIHKIKNRKPDNHQSPGKENGEFDRLARKTSNEKSKVKSQIYFTDDLNDISGSSEKTSEDDELPYSDD 398
  Q9H560 ---------------------------------------------------------------------------------------------------- 264

  A6NC57 ENFMLLIEQSGMECKDFVSLSKSKNATAACGRSIEDQKCYCERLKVKFQKMKNNISVLQKVLSETDKTKSQSEHQNLQGKKKLCNLRFILQQQEEERIKA 498
  Q9H560 ---------------------------------------------------------------------------------------------------- 264

  A6NC57 EELYEKDIEELKIMEEQYRTQTEVKKQSKLTLKSLEVELKTVRSNSNQNFHTHERERDLWQENHLMRDEIARLRLEIDTIKHQNQETENKYFKDIEIIKE 598
  Q9H560 ---------------------------------------------------------------------------------------------------- 264

  A6NC57 NNEDLEKTLKRNEEALTKTITRYSKELNVLMDENTMLNSELQKEKQSMSRLETEMESYRCRLAAALCDHDQRQSSKRDLQLAFQSTVNEWCHLQEDTNSH 698
  Q9H560 ---------------------------------------------------------------------------------------------------- 264

  A6NC57 IQILSQQLSKAESTSSGLETELHYEREALKEKTLHIEHMQGVLSRTQRRLEDIEHMYQNDQPILEKYVRKQQSVEDGLFQLQSQNLLYQQQCNDARKKAD 798
  Q9H560 ---------------------------------------------------------------------------------------------------- 264

  A6NC57 NQEKTIINIQVKCEDTVEKLQAECRKLEENNKGLMKECTLLKERQCQYEKEKEEREVVRRQLQREVDDALNKQLLLEAMLEISSERRINLEDEAQSLKKK 898
  Q9H560 ---------------------------------------------------------------------------------------------------- 264

  A6NC57 LGQMRSQVCMKLSMSTVTL 917
  Q9H560 ------------------- 264

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0032426	stereocilium tip
1. PB	GO:1901223	negative regulation of NIK/NF-kappaB signaling
1. PB	GO:0004857	enzyme inhibitor activity
1. PB	GO:0009967	positive regulation of signal transduction
1. PB	GO:0043034	costamere
1. PB	GO:0048812	neuron projection morphogenesis
1. PB	GO:0005769	early endosome
1. PB	GO:0019901	protein kinase binding
1. PB	GO:0035148	tube formation
1. PB	GO:0072357	PTW/PP1 phosphatase complex
1. PB	GO:0019208	phosphatase regulator activity
1. PB	GO:0090090	negative regulation of canonical Wnt signaling pathway
1. PB	GO:0032456	endocytic recycling
1. PB	GO:0007283	spermatogenesis
1. PB	GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
1. PB	GO:0001650	fibrillar center
1. PB	GO:0009950	dorsal/ventral axis specification
1. PB	GO:0030424	axon
1. PB	GO:0031267	small GTPase binding
1. PB	GO:0007605	sensory perception of sound
1. PB	GO:0051017	actin filament bundle assembly
1. PB	GO:0005829	cytosol
1. PB	GO:0030030	cell projection organization
1. PB	GO:0030496	midbody
1. PB	GO:0097190	apoptotic signaling pathway
1. PB	GO:0035508	positive regulation of myosin-light-chain-phosphatase activity
1. PB	GO:0031672	A band
1. PB	GO:2000096	positive regulation of Wnt signaling pathway, planar cell polarity pathway
1. PB	GO:0005856	cytoskeleton
1. PB	GO:0005929	cilium
1. PB	GO:0035556	intracellular signal transduction
1. PB	GO:0030018	Z disc
1. PB	GO:0042802	identical protein binding
1. PB	GO:0005938	cell cortex
1. PB	GO:0007165	signal transduction
1. PB	GO:0035507	regulation of myosin-light-chain-phosphatase activity
2. P	GO:0097539	ciliary transition fiber
2. P	GO:0005768	endosome
2. P	GO:0032886	regulation of microtubule-based process
2. P	GO:0019904	protein domain specific binding
2. P	GO:0046621	negative regulation of organ growth
2. P	GO:0046965	retinoid X receptor binding
2. P	GO:0006828	manganese ion transport
2. P	GO:0070679	inositol 1,4,5 trisphosphate binding
2. P	GO:0034703	cation channel complex
2. P	GO:0007399	nervous system development
2. P	GO:0055037	recycling endosome
2. P	GO:0034451	centriolar satellite
2. P	GO:0150105	protein localization to cell-cell junction
2. P	GO:0051058	negative regulation of small GTPase mediated signal transduction
2. P	GO:0042043	neurexin family protein binding
2. P	GO:0030275	LRR domain binding
2. P	GO:0044877	protein-containing complex binding
2. P	GO:0006468	protein phosphorylation
2. P	GO:0106310	protein serine kinase activity
2. P	GO:0006974	cellular response to DNA damage stimulus
2. P	GO:0008631	intrinsic apoptotic signaling pathway in response to oxidative stress
2. P	GO:0015279	store-operated calcium channel activity
2. P	GO:0042975	peroxisome proliferator activated receptor binding
2. P	GO:0030139	endocytic vesicle
2. P	GO:0060631	regulation of meiosis I
2. P	GO:0035259	glucocorticoid receptor binding
2. P	GO:0046777	protein autophosphorylation
2. P	GO:0035997	rhabdomere microvillus membrane
2. P	GO:0007268	chemical synaptic transmission
2. P	GO:0022027	interkinetic nuclear migration
2. P	GO:0044309	neuron spine
2. P	GO:0071454	cellular response to anoxia
2. P	GO:0032465	regulation of cytokinesis
2. P	GO:1905349	ciliary transition zone assembly
2. P	GO:0001778	plasma membrane repair
2. P	GO:0005815	microtubule organizing center
2. P	GO:0051301	cell division
2. P	GO:0030054	cell junction
2. P	GO:2001257	regulation of cation channel activity
2. P	GO:0007098	centrosome cycle
2. P	GO:0031023	microtubule organizing center organization
2. P	GO:0032053	ciliary basal body organization
2. P	GO:0050962	detection of light stimulus involved in sensory perception
2. P	GO:0004674	protein serine/threonine kinase activity
2. P	GO:1903568	negative regulation of protein localization to ciliary membrane
2. P	GO:1904491	protein localization to ciliary transition zone
2. P	GO:0005879	axonemal microtubule
2. P	GO:0098662	inorganic cation transmembrane transport
2. P	GO:0010457	centriole-centriole cohesion
2. P	GO:0055038	recycling endosome membrane
2. P	GO:0005863	striated muscle myosin thick filament
2. P	GO:1905515	non-motile cilium assembly
2. P	GO:0000165	MAPK cascade
2. P	GO:0007095	mitotic G2 DNA damage checkpoint signaling
2. P	GO:0007206	phospholipase C-activating G protein-coupled glutamate receptor signaling pathway
2. P	GO:0032154	cleavage furrow
2. P	GO:0097711	ciliary basal body-plasma membrane docking
2. P	GO:0008377	light-induced release of internally sequestered calcium ion
2. P	GO:0048592	eye morphogenesis
2. P	GO:0007216	G protein-coupled glutamate receptor signaling pathway
2. P	GO:0030239	myofibril assembly
2. P	GO:1905684	regulation of plasma membrane repair
2. P	GO:0007005	mitochondrion organization
2. P	GO:0005819	spindle
2. P	GO:0046330	positive regulation of JNK cascade
2. P	GO:0042974	retinoic acid receptor binding
2. P	GO:0070164	negative regulation of adiponectin secretion
2. P	GO:0016028	rhabdomere
2. P	GO:0030425	dendrite
2. P	GO:0097733	photoreceptor cell cilium
2. P	GO:0043408	regulation of MAPK cascade
2. P	GO:0036064	ciliary basal body
2. P	GO:0046329	negative regulation of JNK cascade
2. P	GO:2001256	regulation of store-operated calcium entry
2. P	GO:0007049	cell cycle
2. P	GO:1903565	negative regulation of protein localization to cilium
2. P	GO:0016740	transferase activity
2. P	GO:0098534	centriole assembly
2. P	GO:0016459	myosin complex
2. P	GO:1903566	positive regulation of protein localization to cilium
2. P	GO:0048875	chemical homeostasis within a tissue
2. P	GO:0042803	protein homodimerization activity
2. P	GO:0005814	centriole
2. P	GO:0035256	G protein-coupled glutamate receptor binding
2. P	GO:0048935	peripheral nervous system neuron development
2. P	GO:0010461	light-activated ion channel activity
2. P	GO:0098962	regulation of postsynaptic neurotransmitter receptor activity
2. P	GO:2000401	regulation of lymphocyte migration
2. P	GO:0060271	cilium assembly
2. P	GO:0005813	centrosome
2. P	GO:0043293	apoptosome
2. P	GO:0045103	intermediate filament-based process
2. P	GO:0048148	behavioral response to cocaine
2. P	GO:0061822	ciliary cap
2. P	GO:0106311
2. P	GO:0016027	inaD signaling complex
2. P	GO:0043507	positive regulation of JUN kinase activity
2. P	GO:1902950	regulation of dendritic spine maintenance
2. P	GO:0043051	regulation of pharyngeal pumping
2. P	GO:0035735	intraciliary transport involved in cilium assembly
2. P	GO:0045599	negative regulation of fat cell differentiation
2. P	GO:0007603	phototransduction, visible light
2. P	GO:0060259	regulation of feeding behavior
2. P	GO:0032874	positive regulation of stress-activated MAPK cascade
2. P	GO:1902017	regulation of cilium assembly
2. P	GO:0032147	activation of protein kinase activity
2. P	GO:0071985	multivesicular body sorting pathway
2. P	GO:0045724	positive regulation of cilium assembly
2. P	GO:0090279	regulation of calcium ion import
3. B	GO:0001938	positive regulation of endothelial cell proliferation
3. B	GO:0005770	late endosome
3. B	GO:0034765	regulation of ion transmembrane transport
3. B	GO:0042994	cytoplasmic sequestering of transcription factor
3. B	GO:0000122	negative regulation of transcription by RNA polymerase II
3. B	GO:0050729	positive regulation of inflammatory response
3. B	GO:0048337	positive regulation of mesodermal cell fate specification
3. B	GO:0090037	positive regulation of protein kinase C signaling
3. B	GO:0048709	oligodendrocyte differentiation
3. B	GO:0006511	ubiquitin-dependent protein catabolic process
3. B	GO:0043011	myeloid dendritic cell differentiation
3. B	GO:0007507	heart development
3. B	GO:0001701	in utero embryonic development
3. B	GO:0072104	glomerular capillary formation
3. B	GO:1903779	regulation of cardiac conduction
3. B	GO:0042088	T-helper 1 type immune response
3. B	GO:0070563	negative regulation of vitamin D receptor signaling pathway
3. B	GO:0030334	regulation of cell migration
3. B	GO:0032421	stereocilium bundle
3. B	GO:0003270	Notch signaling pathway involved in regulation of secondary heart field cardioblast proliferation
3. B	GO:0010812	negative regulation of cell-substrate adhesion
3. B	GO:0001756	somitogenesis
3. B	GO:2001259	positive regulation of cation channel activity
3. B	GO:0051247	positive regulation of protein metabolic process
3. B	GO:0021514	ventral spinal cord interneuron differentiation
3. B	GO:1903522	regulation of blood circulation
3. B	GO:0070372	regulation of ERK1 and ERK2 cascade
3. B	GO:0060412	ventricular septum morphogenesis
3. B	GO:0045663	positive regulation of myoblast differentiation
3. B	GO:0014044	Schwann cell development
3. B	GO:0006306	DNA methylation
3. B	GO:0019903	protein phosphatase binding
3. B	GO:0003252	negative regulation of cell proliferation involved in heart valve morphogenesis
3. B	GO:0085020	protein K6-linked ubiquitination
3. B	GO:0006959	humoral immune response
3. B	GO:0004842	ubiquitin-protein transferase activity
3. B	GO:0047499	calcium-independent phospholipase A2 activity
3. B	GO:0043403	skeletal muscle tissue regeneration
3. B	GO:0007140	male meiotic nuclear division
3. B	GO:0001837	epithelial to mesenchymal transition
3. B	GO:0051494	negative regulation of cytoskeleton organization
3. B	GO:0048259	regulation of receptor-mediated endocytosis
3. B	GO:0045070	positive regulation of viral genome replication
3. B	GO:0003950	NAD+ ADP-ribosyltransferase activity
3. B	GO:0035264	multicellular organism growth
3. B	GO:0021519	spinal cord association neuron specification
3. B	GO:0015095	magnesium ion transmembrane transporter activity
3. B	GO:0045611	negative regulation of hemocyte differentiation
3. B	GO:0051489	regulation of filopodium assembly
3. B	GO:0035622	intrahepatic bile duct development
3. B	GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity
3. B	GO:0045036	protein targeting to chloroplast
3. B	GO:0033257	Bcl3/NF-kappaB2 complex
3. B	GO:0016571	histone methylation
3. B	GO:0043254	regulation of protein-containing complex assembly
3. B	GO:0070588	calcium ion transmembrane transport
3. B	GO:0035304	regulation of protein dephosphorylation
3. B	GO:0010765	positive regulation of sodium ion transport
3. B	GO:0071546	pi-body
3. B	GO:0010557	positive regulation of macromolecule biosynthetic process
3. B	GO:1902367	negative regulation of Notch signaling pathway involved in somitogenesis
3. B	GO:0003162	atrioventricular node development
3. B	GO:0035690
3. B	GO:0007492	endoderm development
3. B	GO:0048549	positive regulation of pinocytosis
3. B	GO:2001214	positive regulation of vasculogenesis
3. B	GO:0010956	negative regulation of calcidiol 1-monooxygenase activity
3. B	GO:0031069	hair follicle morphogenesis
3. B	GO:0072659	protein localization to plasma membrane
3. B	GO:0086015	SA node cell action potential
3. B	GO:0032466	negative regulation of cytokinesis
3. B	GO:1990404	protein ADP-ribosylase activity
3. B	GO:0005903	brush border
3. B	GO:0061073	ciliary body morphogenesis
3. B	GO:0051092	positive regulation of NF-kappaB transcription factor activity
3. B	GO:0007520	myoblast fusion
3. B	GO:0003151	outflow tract morphogenesis
3. B	GO:1902807	negative regulation of cell cycle G1/S phase transition
3. B	GO:0006913	nucleocytoplasmic transport
3. B	GO:0072014	proximal tubule development
3. B	GO:0002437	inflammatory response to antigenic stimulus
3. B	GO:0002039	p53 binding
3. B	GO:0002052	positive regulation of neuroblast proliferation
3. B	GO:0071354	cellular response to interleukin-6
3. B	GO:0042734	presynaptic membrane
3. B	GO:0050953	sensory perception of light stimulus
3. B	GO:1902309	negative regulation of peptidyl-serine dephosphorylation
3. B	GO:0070417	cellular response to cold
3. B	GO:0031462	Cul2-RING ubiquitin ligase complex
3. B	GO:0048715	negative regulation of oligodendrocyte differentiation
3. B	GO:0034142	toll-like receptor 4 signaling pathway
3. B	GO:1990433	CSL-Notch-Mastermind transcription factor complex
3. B	GO:0005123	death receptor binding
3. B	GO:0008608	attachment of spindle microtubules to kinetochore
3. B	GO:0043409	negative regulation of MAPK cascade
3. B	GO:0001886	endothelial cell morphogenesis
3. B	GO:0043008	ATP-dependent protein binding
3. B	GO:0048056	R3/R4 cell differentiation
3. B	GO:0003160	endocardium morphogenesis
3. B	GO:0043086	negative regulation of catalytic activity
3. B	GO:0022011	myelination in peripheral nervous system
3. B	GO:0007249	I-kappaB kinase/NF-kappaB signaling
3. B	GO:0050894	determination of affect
3. B	GO:0045638	negative regulation of myeloid cell differentiation
3. B	GO:0001709	cell fate determination
3. B	GO:0000209	protein polyubiquitination
3. B	GO:0097546	ciliary base
3. B	GO:0001947	heart looping
3. B	GO:0035116	embryonic hindlimb morphogenesis
3. B	GO:0090201	negative regulation of release of cytochrome c from mitochondria
3. B	GO:0002027	regulation of heart rate
3. B	GO:2000178	negative regulation of neural precursor cell proliferation
3. B	GO:1904970	brush border assembly
3. B	GO:0044325	transmembrane transporter binding
3. B	GO:0008593	regulation of Notch signaling pathway
3. B	GO:0005634	nucleus
3. B	GO:0072116	pronephros formation
3. B	GO:0072574	hepatocyte proliferation
3. B	GO:1990760	osmolarity-sensing cation channel activity
3. B	GO:0010629	negative regulation of gene expression
3. B	GO:0019888	protein phosphatase regulator activity
3. B	GO:0046875	ephrin receptor binding
3. B	GO:0001763	morphogenesis of a branching structure
3. B	GO:0030660	Golgi-associated vesicle membrane
3. B	GO:0002789	negative regulation of antifungal peptide production
3. B	GO:0072044	collecting duct development
3. B	GO:0046826	negative regulation of protein export from nucleus
3. B	GO:1900246	positive regulation of RIG-I signaling pathway
3. B	GO:1904901	positive regulation of myosin II filament organization
3. B	GO:0070528	protein kinase C signaling
3. B	GO:0097129	cyclin D2-CDK4 complex
3. B	GO:0007253	cytoplasmic sequestering of NF-kappaB
3. B	GO:0005516	calmodulin binding
3. B	GO:0045603	positive regulation of endothelial cell differentiation
3. B	GO:0010875	positive regulation of cholesterol efflux
3. B	GO:0045746	negative regulation of Notch signaling pathway
3. B	GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus
3. B	GO:0051289	protein homotetramerization
3. B	GO:0097604	temperature-gated cation channel activity
3. B	GO:0070213	protein auto-ADP-ribosylation
3. B	GO:0004672	protein kinase activity
3. B	GO:0046427	positive regulation of receptor signaling pathway via JAK-STAT
3. B	GO:0043330	response to exogenous dsRNA
3. B	GO:0055016	hypochord development
3. B	GO:0033292	T-tubule organization
3. B	GO:0006967	positive regulation of antifungal peptide biosynthetic process
3. B	GO:0031877	somatostatin receptor binding
3. B	GO:0071356	cellular response to tumor necrosis factor
3. B	GO:0010923	negative regulation of phosphatase activity
3. B	GO:0002043	blood vessel endothelial cell proliferation involved in sprouting angiogenesis
3. B	GO:0045665	negative regulation of neuron differentiation
3. B	GO:0055074	calcium ion homeostasis
3. B	GO:0071372	cellular response to follicle-stimulating hormone stimulus
3. B	GO:0006816	calcium ion transport
3. B	GO:0061629	RNA polymerase II-specific DNA-binding transcription factor binding
3. B	GO:1904108	protein localization to ciliary inversin compartment
3. B	GO:0005525	GTP binding
3. B	GO:1900245	positive regulation of MDA-5 signaling pathway
3. B	GO:0045747	positive regulation of Notch signaling pathway
3. B	GO:0006915	apoptotic process
3. B	GO:0035898	parathyroid hormone secretion
3. B	GO:0035924	cellular response to vascular endothelial growth factor stimulus
3. B	GO:0014832	urinary bladder smooth muscle contraction
3. B	GO:0071889	14-3-3 protein binding
3. B	GO:0090521	glomerular visceral epithelial cell migration
3. B	GO:0031436	BRCA1-BARD1 complex
3. B	GO:0045944	positive regulation of transcription by RNA polymerase II
3. B	GO:0050768	negative regulation of neurogenesis
3. B	GO:0030307	positive regulation of cell growth
3. B	GO:0099092	postsynaptic density, intracellular component
3. B	GO:0045893	positive regulation of transcription, DNA-templated
3. B	GO:0005249	voltage-gated potassium channel activity
3. B	GO:0045211	postsynaptic membrane
3. B	GO:0010838	positive regulation of keratinocyte proliferation
3. B	GO:0014070	response to organic cyclic compound
3. B	GO:0010976	positive regulation of neuron projection development
3. B	GO:0031941	filamentous actin
3. B	GO:0030017	sarcomere
3. B	GO:0032270	positive regulation of cellular protein metabolic process
3. B	GO:0045581	negative regulation of T cell differentiation
3. B	GO:0043491	protein kinase B signaling
3. B	GO:0005902	microvillus
3. B	GO:0036336	dendritic cell migration
3. B	GO:0016055	Wnt signaling pathway
3. B	GO:0048873	homeostasis of number of cells within a tissue
3. B	GO:0051967	negative regulation of synaptic transmission, glutamatergic
3. B	GO:0061195	taste bud formation
3. B	GO:0018345	protein palmitoylation
3. B	GO:1904106	protein localization to microvillus
3. B	GO:0032288	myelin assembly
3. B	GO:0021515	cell differentiation in spinal cord
3. B	GO:1900127	positive regulation of hyaluronan biosynthetic process
3. B	GO:0015271	outward rectifier potassium channel activity
3. B	GO:0002011	morphogenesis of an epithelial sheet
3. B	GO:0071212	subsynaptic reticulum
3. B	GO:0014807	regulation of somitogenesis
3. B	GO:0031670	cellular response to nutrient
3. B	GO:0030279	negative regulation of ossification
3. B	GO:0048663	neuron fate commitment
3. B	GO:0030016	myofibril
3. B	GO:0006584	catecholamine metabolic process
3. B	GO:0060743	epithelial cell maturation involved in prostate gland development
3. B	GO:0003182	coronary sinus valve morphogenesis
3. B	GO:0055117	regulation of cardiac muscle contraction
3. B	GO:1902339	positive regulation of apoptotic process involved in morphogenesis
3. B	GO:0044605	phosphocholine transferase activity
3. B	GO:0006929	substrate-dependent cell migration
3. B	GO:0071345	cellular response to cytokine stimulus
3. B	GO:0035307	positive regulation of protein dephosphorylation
3. B	GO:0007409	axonogenesis
3. B	GO:0051146	striated muscle cell differentiation
3. B	GO:0045171	intercellular bridge
3. B	GO:0003714	transcription corepressor activity
3. B	GO:0043069	negative regulation of programmed cell death
3. B	GO:1902260	negative regulation of delayed rectifier potassium channel activity
3. B	GO:0031013	troponin I binding
3. B	GO:0031430	M band
3. B	GO:0050678	regulation of epithelial cell proliferation
3. B	GO:0043046	DNA methylation involved in gamete generation
3. B	GO:0070198	protein localization to chromosome, telomeric region
3. B	GO:0090238	positive regulation of arachidonic acid secretion
3. B	GO:0045751	negative regulation of Toll signaling pathway
3. B	GO:0072576	liver morphogenesis
3. B	GO:0007030	Golgi organization
3. B	GO:0045838	positive regulation of membrane potential
3. B	GO:1902263	apoptotic process involved in embryonic digit morphogenesis
3. B	GO:0036371	protein localization to T-tubule
3. B	GO:0035172	hemocyte proliferation
3. B	GO:0003344	pericardium morphogenesis
3. B	GO:0044030	regulation of DNA methylation
3. B	GO:0070742	C2H2 zinc finger domain binding
3. B	GO:0140627	ubiquitin-dependent protein catabolic process via the C-end degron rule pathway
3. B	GO:0003208	cardiac ventricle morphogenesis
3. B	GO:0003214	cardiac left ventricle morphogenesis
3. B	GO:2000812	regulation of barbed-end actin filament capping
3. B	GO:0010424	DNA methylation on cytosine within a CG sequence
3. B	GO:0051101	regulation of DNA binding
3. B	GO:0014731	spectrin-associated cytoskeleton
3. B	GO:0005737	cytoplasm
3. B	GO:0098978	glutamatergic synapse
3. B	GO:2000001	regulation of DNA damage checkpoint
3. B	GO:0055013	cardiac muscle cell development
3. B	GO:0072114	pronephros morphogenesis
3. B	GO:0061630	ubiquitin protein ligase activity
3. B	GO:0010882	regulation of cardiac muscle contraction by calcium ion signaling
3. B	GO:0043005	neuron projection
3. B	GO:0098871	postsynaptic actin cytoskeleton
3. B	GO:0097435	supramolecular fiber organization
3. B	GO:1904385	cellular response to angiotensin
3. B	GO:0035153	epithelial cell type specification, open tracheal system
3. B	GO:0046331	lateral inhibition
3. B	GO:0014704	intercalated disc
3. B	GO:0042995	cell projection
3. B	GO:0001955	blood vessel maturation
3. B	GO:0010225	response to UV-C
3. B	GO:0099519	dense core granule cytoskeletal transport
3. B	GO:0007219	Notch signaling pathway
3. B	GO:0035994	response to muscle stretch
3. B	GO:0038023	signaling receptor activity
3. B	GO:0060354	negative regulation of cell adhesion molecule production
3. B	GO:0031441	negative regulation of mRNA 3'-end processing
3. B	GO:0034638	phosphatidylcholine catabolic process
3. B	GO:0021546	rhombomere development
3. B	GO:0003332	negative regulation of extracellular matrix constituent secretion
3. B	GO:0033280	response to vitamin D
3. B	GO:0046976	histone methyltransferase activity (H3-K27 specific)
3. B	GO:1905274	regulation of modification of postsynaptic actin cytoskeleton
3. B	GO:0009862	systemic acquired resistance, salicylic acid mediated signaling pathway
3. B	GO:0031047	gene silencing by RNA
3. B	GO:0071222	cellular response to lipopolysaccharide
3. B	GO:0071447	cellular response to hydroperoxide
3. B	GO:0032580	Golgi cisterna membrane
3. B	GO:0035914	skeletal muscle cell differentiation
3. B	GO:0000731	DNA synthesis involved in DNA repair
3. B	GO:0016529	sarcoplasmic reticulum
3. B	GO:0071800	podosome assembly
3. B	GO:0060288	formation of a compartment boundary
3. B	GO:0051497	negative regulation of stress fiber assembly
3. B	GO:0000082	G1/S transition of mitotic cell cycle
3. B	GO:0005096	GTPase activator activity
3. B	GO:0030034	microvillar actin bundle assembly
3. B	GO:1901222	regulation of NIK/NF-kappaB signaling
3. B	GO:0045672	positive regulation of osteoclast differentiation
3. B	GO:1904743	negative regulation of telomeric DNA binding
3. B	GO:0071347	cellular response to interleukin-1
3. B	GO:1900383	regulation of synaptic plasticity by receptor localization to synapse
3. B	GO:0003241	growth involved in heart morphogenesis
3. B	GO:0072660	maintenance of protein location in plasma membrane
3. B	GO:0015629	actin cytoskeleton
3. B	GO:0071359	cellular response to dsRNA
3. B	GO:0086004	regulation of cardiac muscle cell contraction
3. B	GO:0055007	cardiac muscle cell differentiation
3. B	GO:0060289	compartment boundary maintenance
3. B	GO:0031674	I band
3. B	GO:2000134	negative regulation of G1/S transition of mitotic cell cycle
3. B	GO:0043197	dendritic spine
3. B	GO:0005112	Notch binding
3. B	GO:0003198	epithelial to mesenchymal transition involved in endocardial cushion formation
3. B	GO:0102991	myristoyl-CoA hydrolase activity
3. B	GO:1901187	regulation of ephrin receptor signaling pathway
3. B	GO:0008285	negative regulation of cell population proliferation
3. B	GO:0061028	establishment of endothelial barrier
3. B	GO:0001889	liver development
3. B	GO:0045197	establishment or maintenance of epithelial cell apical/basal polarity
3. B	GO:0060674	placenta blood vessel development
3. B	GO:0039529	RIG-I signaling pathway
3. B	GO:0033209	tumor necrosis factor-mediated signaling pathway
3. B	GO:0036309	protein localization to M-band
3. B	GO:0065001	specification of axis polarity
3. B	GO:0060317	cardiac epithelial to mesenchymal transition
3. B	GO:0060948	cardiac vascular smooth muscle cell development
3. B	GO:0086069	bundle of His cell to Purkinje myocyte communication
3. B	GO:0045732	positive regulation of protein catabolic process
3. B	GO:0034446	substrate adhesion-dependent cell spreading
3. B	GO:0002357	defense response to tumor cell
3. B	GO:0002070	epithelial cell maturation
3. B	GO:0031432	titin binding
3. B	GO:0034112	positive regulation of homotypic cell-cell adhesion
3. B	GO:0060442	branching involved in prostate gland morphogenesis
3. B	GO:0006471	protein ADP-ribosylation
3. B	GO:0070531	BRCA1-A complex
3. B	GO:0030154	cell differentiation
3. B	GO:0060842	arterial endothelial cell differentiation
3. B	GO:0086070	SA node cell to atrial cardiac muscle cell communication
3. B	GO:0009411	response to UV
3. B	GO:0042327	positive regulation of phosphorylation
3. B	GO:0045955	negative regulation of calcium ion-dependent exocytosis
3. B	GO:0070972	protein localization to endoplasmic reticulum
3. B	GO:0090160	Golgi to lysosome transport
3. B	GO:2001027	negative regulation of endothelial cell chemotaxis
3. B	GO:0043268	positive regulation of potassium ion transport
3. B	GO:0035518	histone H2A monoubiquitination
3. B	GO:0016021	integral component of membrane
3. B	GO:0060035	notochord cell development
3. B	GO:0002193	MAML1-RBP-Jkappa- ICN1 complex
3. B	GO:0046579	positive regulation of Ras protein signal transduction
3. B	GO:0045685	regulation of glial cell differentiation
3. B	GO:0030513	positive regulation of BMP signaling pathway
3. B	GO:2000737	negative regulation of stem cell differentiation
3. B	GO:0048754	branching morphogenesis of an epithelial tube
3. B	GO:0004861	cyclin-dependent protein serine/threonine kinase inhibitor activity
3. B	GO:0010001	glial cell differentiation
3. B	GO:0000062	fatty-acyl-CoA binding
3. B	GO:1902531	regulation of intracellular signal transduction
3. B	GO:1900827	positive regulation of membrane depolarization during cardiac muscle cell action potential
3. B	GO:0031960	response to corticosteroid
3. B	GO:0003256	regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation
3. B	GO:1901201	regulation of extracellular matrix assembly
3. B	GO:0048892	lateral line nerve development
3. B	GO:0032049	cardiolipin biosynthetic process
3. B	GO:0008093	cytoskeletal anchor activity
3. B	GO:0010667	negative regulation of cardiac muscle cell apoptotic process
3. B	GO:0038061	NIK/NF-kappaB signaling
3. B	GO:0019730	antimicrobial humoral response
3. B	GO:0005654	nucleoplasm
3. B	GO:0048708	astrocyte differentiation
3. B	GO:0030674	protein-macromolecule adaptor activity
3. B	GO:0001708	cell fate specification
3. B	GO:0034058	endosomal vesicle fusion
3. B	GO:0003222	ventricular trabecula myocardium morphogenesis
3. B	GO:0030326	embryonic limb morphogenesis
3. B	GO:0060740	prostate gland epithelium morphogenesis
3. B	GO:0030837	negative regulation of actin filament polymerization
3. B	GO:0071286	cellular response to magnesium ion
3. B	GO:0090309	positive regulation of DNA methylation-dependent heterochromatin assembly
3. B	GO:0060411	cardiac septum morphogenesis
3. B	GO:1905938	positive regulation of germ cell proliferation
3. B	GO:0050775	positive regulation of dendrite morphogenesis
3. B	GO:0032717	negative regulation of interleukin-8 production
3. B	GO:0060113	inner ear receptor cell differentiation
3. B	GO:0045967	negative regulation of growth rate
3. B	GO:0021986	habenula development
3. B	GO:0018230	peptidyl-L-cysteine S-palmitoylation
3. B	GO:0032791	lead ion binding
3. B	GO:0031297	replication fork processing
3. B	GO:0030046	parallel actin filament bundle assembly
3. B	GO:0046843	dorsal appendage formation
3. B	GO:0016567	protein ubiquitination
3. B	GO:0051059	NF-kappaB binding
3. B	GO:0036166	phenotypic switching
3. B	GO:0046469	platelet activating factor metabolic process
3. B	GO:0070986	left/right axis specification
3. B	GO:1990416	cellular response to brain-derived neurotrophic factor stimulus
3. B	GO:0005576	extracellular region
3. B	GO:0019887	protein kinase regulator activity
3. B	GO:0046974	histone methyltransferase activity (H3-K9 specific)
3. B	GO:0098908	regulation of neuronal action potential
3. B	GO:0018024	histone-lysine N-methyltransferase activity
3. B	GO:0010468	regulation of gene expression
3. B	GO:0045814	negative regulation of gene expression, epigenetic
3. B	GO:0021915	neural tube development
3. B	GO:0042805	actinin binding
3. B	GO:0002467	germinal center formation
3. B	GO:0001569	branching involved in blood vessel morphogenesis
3. B	GO:0036377	arbuscular mycorrhizal association
3. B	GO:0043063	intercellular bridge organization
3. B	GO:0046473	phosphatidic acid metabolic process
3. B	GO:0007221	positive regulation of transcription of Notch receptor target
3. B	GO:0099612	protein localization to axon
3. B	GO:0061419	positive regulation of transcription from RNA polymerase II promoter in response to hypoxia
3. B	GO:0005524	ATP binding
3. B	GO:1902041	regulation of extrinsic apoptotic signaling pathway via death domain receptors
3. B	GO:0098703	calcium ion import across plasma membrane
3. B	GO:0045669	positive regulation of osteoblast differentiation
3. B	GO:0042686	regulation of cardioblast cell fate specification
3. B	GO:0046338	phosphatidylethanolamine catabolic process
3. B	GO:0071260	cellular response to mechanical stimulus
3. B	GO:0097422	tubular endosome
3. B	GO:0018027	peptidyl-lysine dimethylation
3. B	GO:0071316	cellular response to nicotine
3. B	GO:0010960	magnesium ion homeostasis
3. B	GO:0080085	signal recognition particle, chloroplast targeting
3. B	GO:2001204	regulation of osteoclast development
3. B	GO:0048536	spleen development
3. B	GO:0042826	histone deacetylase binding
3. B	GO:1990090	cellular response to nerve growth factor stimulus
3. B	GO:0140261	BCOR complex
3. B	GO:0005886	plasma membrane
3. B	GO:0042325	regulation of phosphorylation
3. B	GO:0010614	negative regulation of cardiac muscle hypertrophy
3. B	GO:0021675	nerve development
3. B	GO:0035646	endosome to melanosome transport
3. B	GO:0044232	organelle membrane contact site
3. B	GO:0001841	neural tube formation
3. B	GO:0048899	anterior lateral line development
3. B	GO:0033147	negative regulation of intracellular estrogen receptor signaling pathway
3. B	GO:0062043	positive regulation of cardiac epithelial to mesenchymal transition
3. B	GO:0001222	transcription corepressor binding
3. B	GO:0045316	negative regulation of compound eye photoreceptor development
3. B	GO:0007009	plasma membrane organization
3. B	GO:0045607	regulation of inner ear auditory receptor cell differentiation
3. B	GO:0043292	contractile fiber
3. B	GO:0032996	Bcl3-Bcl10 complex
3. B	GO:0043517	positive regulation of DNA damage response, signal transduction by p53 class mediator
3. B	GO:0019843	rRNA binding
3. B	GO:0070212	protein poly-ADP-ribosylation
3. B	GO:2000048	negative regulation of cell-cell adhesion mediated by cadherin
3. B	GO:1904058	positive regulation of sensory perception of pain
3. B	GO:0060979	vasculogenesis involved in coronary vascular morphogenesis
3. B	GO:0007160	cell-matrix adhesion
3. B	GO:0009066	aspartate family amino acid metabolic process
3. B	GO:0000151	ubiquitin ligase complex
3. B	GO:0045662	negative regulation of myoblast differentiation
3. B	GO:0030160	synaptic receptor adaptor activity
3. B	GO:0019228	neuronal action potential
3. B	GO:0072017	distal tubule development
3. B	GO:0007440	foregut morphogenesis
3. B	GO:0048711	positive regulation of astrocyte differentiation
3. B	GO:0072073	kidney epithelium development
3. B	GO:0045859	regulation of protein kinase activity
3. B	GO:0051569	regulation of histone H3-K4 methylation
3. B	GO:0004622	lysophospholipase activity
3. B	GO:0035023	regulation of Rho protein signal transduction
3. B	GO:0007386	compartment pattern specification
3. B	GO:0009925	basal plasma membrane
3. B	GO:0010650	positive regulation of cell communication by electrical coupling
3. B	GO:0003181	atrioventricular valve morphogenesis
3. B	GO:0090051	negative regulation of cell migration involved in sprouting angiogenesis
3. B	GO:0010638	positive regulation of organelle organization
3. B	GO:0060768	regulation of epithelial cell proliferation involved in prostate gland development
3. B	GO:0060998	regulation of dendritic spine development
3. B	GO:2000811	negative regulation of anoikis
3. B	GO:0048102	autophagic cell death
3. B	GO:0032934	sterol binding
3. B	GO:0045608	negative regulation of inner ear auditory receptor cell differentiation
3. B	GO:0055008	cardiac muscle tissue morphogenesis
3. B	GO:1901339	regulation of store-operated calcium channel activity
3. B	GO:2000630	positive regulation of miRNA metabolic process
3. B	GO:0014066	regulation of phosphatidylinositol 3-kinase signaling
3. B	GO:0006887	exocytosis
3. B	GO:0071314	cellular response to cocaine
3. B	GO:0000242	pericentriolar material
3. B	GO:0003197	endocardial cushion development
3. B	GO:0016604	nuclear body
3. B	GO:0003723	RNA binding
3. B	GO:0042665	regulation of ectodermal cell fate specification
3. B	GO:1903589	positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis
3. B	GO:0098907	regulation of SA node cell action potential
3. B	GO:0003203	endocardial cushion morphogenesis
3. B	GO:0008157	protein phosphatase 1 binding
3. B	GO:1900026	positive regulation of substrate adhesion-dependent cell spreading
3. B	GO:0035965	cardiolipin acyl-chain remodeling
3. B	GO:0003677	DNA binding
3. B	GO:0048471	perinuclear region of cytoplasm
3. B	GO:0030155	regulation of cell adhesion
3. B	GO:0086014	atrial cardiac muscle cell action potential
3. B	GO:0016409	palmitoyltransferase activity
3. B	GO:0008270	zinc ion binding
3. B	GO:0003184	pulmonary valve morphogenesis
3. B	GO:0030507	spectrin binding
3. B	GO:0032695	negative regulation of interleukin-12 production
3. B	GO:0003169	coronary vein morphogenesis
3. B	GO:0043518	negative regulation of DNA damage response, signal transduction by p53 class mediator
3. B	GO:1904908	negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric
3. B	GO:0060528	secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development
3. B	GO:0047389	glycerophosphocholine phosphodiesterase activity
3. B	GO:0002315	marginal zone B cell differentiation
3. B	GO:0010832	negative regulation of myotube differentiation
3. B	GO:0070936	protein K48-linked ubiquitination
3. B	GO:0070682	proteasome regulatory particle assembly
3. B	GO:0070412	R-SMAD binding
3. B	GO:0140439	protein-cysteine S-stearoyltransferase activity
3. B	GO:0051438	regulation of ubiquitin-protein transferase activity
3. B	GO:0045648	positive regulation of erythrocyte differentiation
3. B	GO:0031143	pseudopodium
3. B	GO:1900087	positive regulation of G1/S transition of mitotic cell cycle
3. B	GO:0032495	response to muramyl dipeptide
3. B	GO:0007368	determination of left/right symmetry
3. B	GO:0071244	cellular response to carbon dioxide
3. B	GO:0060982	coronary artery morphogenesis
3. B	GO:0007616	long-term memory
3. B	GO:0045687	positive regulation of glial cell differentiation
3. B	GO:0070431	nucleotide-binding oligomerization domain containing 2 signaling pathway
3. B	GO:0001954	positive regulation of cell-matrix adhesion
3. B	GO:0051726	regulation of cell cycle
3. B	GO:0002268	follicular dendritic cell differentiation
3. B	GO:0001818	negative regulation of cytokine production
3. B	GO:0032525	somite rostral/caudal axis specification
3. B	GO:0014912	negative regulation of smooth muscle cell migration
3. B	GO:0031359	integral component of chloroplast outer membrane
3. B	GO:0010780	meiotic DNA double-strand break formation involved in reciprocal meiotic recombination
3. B	GO:0071407	cellular response to organic cyclic compound
3. B	GO:0031867	EP4 subtype prostaglandin E2 receptor binding
3. B	GO:0015248	sterol transporter activity
3. B	GO:0048103	somatic stem cell division
3. B	GO:0043266	regulation of potassium ion transport
3. B	GO:0050955	thermoception
3. B	GO:0060843	venous endothelial cell differentiation
3. B	GO:2000651	positive regulation of sodium ion transmembrane transporter activity
3. B	GO:0006528	asparagine metabolic process
3. B	GO:0032496	response to lipopolysaccharide
3. B	GO:0061399	positive regulation of transcription from RNA polymerase II promoter in response to cobalt ion
3. B	GO:0140031	phosphorylation-dependent protein binding
3. B	GO:0051306	mitotic sister chromatid separation
3. B	GO:0050957	equilibrioception
3. B	GO:0003207	cardiac chamber formation
3. B	GO:0061384	heart trabecula morphogenesis
3. B	GO:0043619	regulation of transcription from RNA polymerase II promoter in response to oxidative stress
3. B	GO:0048060	negative gravitaxis
3. B	GO:0072015	glomerular visceral epithelial cell development
3. B	GO:2000304	positive regulation of ceramide biosynthetic process
3. B	GO:0070171	negative regulation of tooth mineralization
3. B	GO:0030315	T-tubule
3. B	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
3. B	GO:0003209	cardiac atrium morphogenesis
3. B	GO:1905936	regulation of germ cell proliferation
3. B	GO:0090263	positive regulation of canonical Wnt signaling pathway
3. B	GO:0048052	R1/R6 cell differentiation
3. B	GO:1903670	regulation of sprouting angiogenesis
3. B	GO:0021531	spinal cord radial glial cell differentiation
3. B	GO:0010888	negative regulation of lipid storage
3. B	GO:0035308	negative regulation of protein dephosphorylation
3. B	GO:0010761	fibroblast migration
3. B	GO:0005262	calcium channel activity
3. B	GO:0017020	myosin phosphatase regulator activity
3. B	GO:0008290	F-actin capping protein complex
3. B	GO:0102545	phosphatidyl phospholipase B activity
3. B	GO:0097062	dendritic spine maintenance
3. B	GO:0031901	early endosome membrane
3. B	GO:0003213	cardiac right atrium morphogenesis
3. B	GO:0045869	negative regulation of single stranded viral RNA replication via double stranded DNA intermediate
3. B	GO:0045602	negative regulation of endothelial cell differentiation
3. B	GO:0050793	regulation of developmental process
3. B	GO:0098910	regulation of atrial cardiac muscle cell action potential
3. B	GO:0043194	axon initial segment
3. B	GO:0090575	RNA polymerase II transcription regulator complex
3. B	GO:0009912	auditory receptor cell fate commitment
3. B	GO:0030941	chloroplast targeting sequence binding
3. B	GO:0099527	postsynapse to nucleus signaling pathway
3. B	GO:0046849	bone remodeling
3. B	GO:2000249	regulation of actin cytoskeleton reorganization
3. B	GO:0048265	response to pain
3. B	GO:0016279	protein-lysine N-methyltransferase activity
3. B	GO:0043066	negative regulation of apoptotic process
3. B	GO:1904355	positive regulation of telomere capping
3. B	GO:0010745	negative regulation of macrophage derived foam cell differentiation
3. B	GO:0033270	paranode region of axon
3. B	GO:0001895	retina homeostasis
3. B	GO:0031466	Cul5-RING ubiquitin ligase complex
3. B	GO:0097543	ciliary inversin compartment
3. B	GO:0017124	SH3 domain binding
3. B	GO:0003847	1-alkyl-2-acetylglycerophosphocholine esterase activity
3. B	GO:0046822	regulation of nucleocytoplasmic transport
3. B	GO:0003219	cardiac right ventricle formation
3. B	GO:0043235	receptor complex
3. B	GO:0001658	branching involved in ureteric bud morphogenesis
3. B	GO:0017171	serine hydrolase activity
3. B	GO:0072144	glomerular mesangial cell development
3. B	GO:2000031	regulation of salicylic acid mediated signaling pathway
3. B	GO:0016235	aggresome
3. B	GO:0060956	endocardial cell differentiation
3. B	GO:1904632	cellular response to glucoside
3. B	GO:1902230	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage
3. B	GO:0042383	sarcolemma
3. B	GO:0071322	cellular response to carbohydrate stimulus
3. B	GO:1901189	positive regulation of ephrin receptor signaling pathway
3. B	GO:0070427	nucleotide-binding oligomerization domain containing 1 signaling pathway
3. B	GO:0050931	pigment cell differentiation
3. B	GO:0034704	calcium channel complex
3. B	GO:0060038	cardiac muscle cell proliferation
3. B	GO:0030029	actin filament-based process
3. B	GO:0032212	positive regulation of telomere maintenance via telomerase
3. B	GO:0002040	sprouting angiogenesis
3. B	GO:0007569	cell aging
3. B	GO:0045064	T-helper 2 cell differentiation
3. B	GO:0061001	regulation of dendritic spine morphogenesis
3. B	GO:2000279	negative regulation of DNA biosynthetic process
3. B	GO:0045596	negative regulation of cell differentiation
3. B	GO:0061025	membrane fusion
3. B	GO:0051386	regulation of neurotrophin TRK receptor signaling pathway
3. B	GO:1990393	3M complex
3. B	GO:0060803	BMP signaling pathway involved in mesodermal cell fate specification
3. B	GO:0045618	positive regulation of keratinocyte differentiation
3. B	GO:0003180	aortic valve morphogenesis
3. B	GO:1990705	cholangiocyte proliferation
3. B	GO:0007411	axon guidance
3. B	GO:0050968	detection of chemical stimulus involved in sensory perception of pain
3. B	GO:0042246	tissue regeneration
3. B	GO:0003157	endocardium development
3. B	GO:0007229	integrin-mediated signaling pathway
3. B	GO:0002455	humoral immune response mediated by circulating immunoglobulin
3. B	GO:1903343	positive regulation of meiotic DNA double-strand break formation
3. B	GO:0090029	negative regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion
3. B	GO:0046533	negative regulation of photoreceptor cell differentiation
3. B	GO:0097150	neuronal stem cell population maintenance
3. B	GO:0060045	positive regulation of cardiac muscle cell proliferation
3. B	GO:0048013	ephrin receptor signaling pathway
3. B	GO:1901019	regulation of calcium ion transmembrane transporter activity
3. B	GO:0035171	lamellocyte differentiation
3. B	GO:0004067	asparaginase activity
3. B	GO:1903849	positive regulation of aorta morphogenesis
3. B	GO:0003713	transcription coactivator activity
3. B	GO:0045162	clustering of voltage-gated sodium channels
3. B	GO:0060413	atrial septum morphogenesis
3. B	GO:0050728	negative regulation of inflammatory response
3. B	GO:0003192	mitral valve formation
3. B	GO:0043065	positive regulation of apoptotic process
3. B	GO:0008139	nuclear localization sequence binding
3. B	GO:0030027	lamellipodium
3. B	GO:0000415	negative regulation of histone H3-K36 methylation
3. B	GO:0033268	node of Ranvier
3. B	GO:0048665	neuron fate specification
3. B	GO:0090200	positive regulation of release of cytochrome c from mitochondria
3. B	GO:1904630	cellular response to diterpene
3. B	GO:0003264	regulation of cardioblast proliferation
3. B	GO:0019705	protein-cysteine S-myristoyltransferase activity
3. B	GO:0010613	positive regulation of cardiac muscle hypertrophy
3. B	GO:0043596	nuclear replication fork
3. B	GO:0001835	blastocyst hatching
3. B	GO:0061314	Notch signaling involved in heart development
3. B	GO:0008361	regulation of cell size
3. B	GO:0071709	membrane assembly
3. B	GO:0015278	calcium-release channel activity
3. B	GO:0045921	positive regulation of exocytosis
3. B	GO:0043422	protein kinase B binding
3. B	GO:1990756	ubiquitin ligase-substrate adaptor activity
3. B	GO:0060992	response to fungicide
3. B	GO:0016290	palmitoyl-CoA hydrolase activity
3. B	GO:0014732	skeletal muscle atrophy
3. B	GO:0019899	enzyme binding
3. B	GO:0051570	regulation of histone H3-K9 methylation
3. B	GO:0034587	piRNA metabolic process
3. B	GO:2000974	negative regulation of pro-B cell differentiation
3. B	GO:0048845	venous blood vessel morphogenesis
3. B	GO:1901018	positive regulation of potassium ion transmembrane transporter activity
3. B	GO:0050714	positive regulation of protein secretion
3. B	GO:0060135	maternal process involved in female pregnancy
3. B	GO:0031663	lipopolysaccharide-mediated signaling pathway
3. B	GO:0043055	maintenance of dauer
3. B	GO:0086066	atrial cardiac muscle cell to AV node cell communication
3. B	GO:1901021	positive regulation of calcium ion transmembrane transporter activity
3. B	GO:1901224	positive regulation of NIK/NF-kappaB signaling
3. B	GO:0060253	negative regulation of glial cell proliferation
3. B	GO:0005925	focal adhesion
3. B	GO:0050966	detection of mechanical stimulus involved in sensory perception of pain
3. B	GO:0021707	cerebellar granule cell differentiation
3. B	GO:0033256	I-kappaB/NF-kappaB complex
3. B	GO:0014031	mesenchymal cell development
3. B	GO:0051151	negative regulation of smooth muscle cell differentiation
3. B	GO:0032991	protein-containing complex
3. B	GO:0046872	metal ion binding
3. B	GO:0035544	negative regulation of SNARE complex assembly
3. B	GO:0097553	calcium ion transmembrane import into cytosol
3. B	GO:0000139	Golgi membrane
3. B	GO:0042326	negative regulation of phosphorylation
3. B	GO:0019706	protein-cysteine S-palmitoyltransferase activity
3. B	GO:0003273	cell migration involved in endocardial cushion formation
3. B	GO:0051572	negative regulation of histone H3-K4 methylation
3. B	GO:0030900	forebrain development
3. B	GO:1903793	positive regulation of anion transport
3. B	GO:0070168	negative regulation of biomineral tissue development
3. B	GO:0044354	macropinosome
3. B	GO:1904357	negative regulation of telomere maintenance via telomere lengthening
3. B	GO:0061344	regulation of cell adhesion involved in heart morphogenesis
3. B	GO:0032088	negative regulation of NF-kappaB transcription factor activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q6ZW76	Ankyrin repeat and SAM domain-containing protein 3	6.26e-06	3.37e-08	2.17e-12
1. PB	Q6ZVH7	Espin-like protein	3.37e-03	1.09e-04	1.61e-09
1. PB	A6NC57	Ankyrin repeat domain-containing protein 62	0	1.38e-165	0.0
1. PB	Q9Y2G4	Ankyrin repeat domain-containing protein 6	3.26e-04	5.16e-11	7.45e-10
1. PB	Q5U312	Ankycorbin	2.39e-09	6.43e-34	1.34e-13
1. PB	A2RUR9	Coiled-coil domain-containing protein 144A	4.33e-05	1.49e-06	1.91e-113
1. PB	Q5VUR7	Putative ankyrin repeat domain-containing protein 20A3	1.92e-13	2.17e-39	2.23e-68
1. PB	Q8IVF6	Ankyrin repeat domain-containing protein 18A	3.96e-14	5.60e-24	1.10e-74
1. PB	Q5TYW2	Ankyrin repeat domain-containing protein 20A1	1.77e-09	2.21e-40	4.56e-68
1. PB	Q69YU3	Ankyrin repeat domain-containing protein 34A	7.88e-03	1.16e-02	8.21e-05
1. PB	Q3UUF8	Ankyrin repeat domain-containing protein 34B	4.05e-03	6.06e-05	0.014
1. PB	Q9BZF9	Uveal autoantigen with coiled-coil domains and ankyrin repeats	4.35e-06	1.11e-04	1.47e-12
1. PB	Q80VM7	Ankyrin repeat domain-containing protein 24	2.65e-06	1.91e-07	1.47e-10
1. PB	Q8N283	Ankyrin repeat domain-containing protein 35	3.09e-06	2.03e-28	8.63e-13
1. PB	Q9EP71	Ankycorbin	5.94e-10	1.93e-32	2.02e-14
1. PB	Q69ZU8	Ankyrin repeat domain-containing protein 6	1.80e-06	7.80e-09	1.10e-09
1. PB	Q8HYY4	Uveal autoantigen with coiled-coil domains and ankyrin repeats protein	2.44e-05	8.13e-05	6.55e-13
1. PB	Q4UJ75	Putative ankyrin repeat domain-containing protein 20A4	1.16e-11	1.19e-38	4.38e-68
1. PB	Q8TF21	Ankyrin repeat domain-containing protein 24	3.30e-06	1.85e-04	1.93e-06
1. PB	Q6P9K8	Caskin-1	1.29e-02	2.91e-02	1.76e-06
1. PB	Q8BLB8	Ankyrin repeat domain-containing protein 34C	1.80e-02	5.93e-03	7.28e-04
1. PB	Q8BG95	Protein phosphatase 1 regulatory subunit 12B	3.79e-03	1.72e-08	2.19e-05
1. PB	Q9BZL4	Protein phosphatase 1 regulatory subunit 12C	6.18e-04	3.48e-02	4.13e-05
1. PB	Q90623	Protein phosphatase 1 regulatory subunit 12A	2.49e-03	2.15e-05	2.10e-04
1. PB	Q5CZ79	Ankyrin repeat domain-containing protein 20B	1.57e-12	2.24e-38	6.71e-71
1. PB	Q811D2	Ankyrin repeat domain-containing protein 26	4.64e-04	1.63e-15	1.92e-121
1. PB	P0C6C1	Ankyrin repeat domain-containing protein 34C	1.35e-02	5.84e-04	6.52e-04
1. PB	Q9GL21	Uveal autoantigen with coiled-coil domains and ankyrin repeats	7.46e-07	3.60e-05	1.04e-12
1. PB	Q9CZK6	Ankyrin repeat and SAM domain-containing protein 3	5.24e-05	1.81e-07	2.26e-12
1. PB	Q3UMT1	Protein phosphatase 1 regulatory subunit 12C	6.91e-04	2.38e-02	0.010
1. PB	Q8VHK2	Caskin-1	9.17e-02	3.15e-02	9.17e-07
1. PB	Q9UPS8	Ankyrin repeat domain-containing protein 26	5.68e-04	3.18e-10	3.19e-168
1. PB	Q5SQ80	Putative ankyrin repeat domain-containing protein 20A2	7.22e-12	7.59e-40	2.17e-68
1. PB	Q9P0K7	Ankycorbin	3.20e-09	7.76e-35	2.42e-14
1. PB	Q8N2N9	Ankyrin repeat domain-containing protein 36B	3.97e-04	1.47e-02	1.89e-157
1. PB	O60237	Protein phosphatase 1 regulatory subunit 12B	6.67e-04	4.37e-08	3.81e-06
1. PB	A5PLL1	Ankyrin repeat domain-containing protein 34B	1.55e-02	5.07e-03	0.024
1. PB	Q3UYR4	Espin-like protein	1.08e-02	2.57e-04	2.53e-09
1. PB	A2A2Z9	Ankyrin repeat domain-containing protein 18B	1.26e-11	9.03e-26	3.76e-74
1. PB	Q5BJT1	Ankyrin repeat domain-containing protein 34A	3.48e-02	2.41e-02	6.39e-05
1. PB	Q5M9H0	Ankyrin repeat and SAM domain-containing protein 3	5.32e-04	5.21e-08	3.54e-12
1. PB	Q8CGB3	Uveal autoantigen with coiled-coil domains and ankyrin repeats	1.76e-05	1.78e-06	4.96e-12
2. P	Q86SQ7	Serologically defined colon cancer antigen 8	1.10e-01	9.93e-04	NA
2. P	Q9CR92	Coiled-coil domain-containing protein 96	3.26e-05	5.33e-05	NA
2. P	P35416	Paramyosin, short form	5.56e-06	1.03e-04	NA
2. P	O15049	NEDD4-binding protein 3	1.59e-02	4.32e-02	NA
2. P	Q96C92	Endosome-associated-trafficking regulator 1	1.09e-02	1.71e-02	NA
2. P	Q9C099	Leucine-rich repeat and coiled-coil domain-containing protein 1	1.43e-05	2.54e-04	NA
2. P	Q9JHQ5	Leucine zipper transcription factor-like protein 1	1.92e-05	4.23e-02	NA
2. P	Q6AI12	Ankyrin repeat domain-containing protein 40	7.65e-02	2.93e-03	NA
2. P	O75154	Rab11 family-interacting protein 3	5.93e-04	2.03e-03	NA
2. P	Q0WPJ7	Putative E3 ubiquitin-protein ligase RF298	4.34e-03	2.17e-03	NA
2. P	Q9I9E0	Serine/threonine-protein kinase TAO3	3.64e-04	5.97e-04	NA
2. P	Q96ST8	Centrosomal protein of 89 kDa	8.34e-04	1.22e-02	NA
2. P	P46549	Serine/threonine-protein kinase SULU	3.32e-05	2.24e-02	NA
2. P	Q6Y685	Transforming acidic coiled-coil-containing protein 1	2.33e-02	2.31e-02	NA
2. P	Q4KLH6	Centrosomal protein of 162 kDa	3.48e-05	1.45e-02	NA
2. P	Q8BQP8	Rab11 family-interacting protein 4	2.13e-03	4.73e-06	NA
2. P	A6NGH7	Coiled-coil domain-containing protein 160	8.38e-06	5.57e-03	NA
2. P	Q6P402	Centrosomal protein of 89 kDa	3.97e-05	2.13e-05	NA
2. P	Q91WG2	Rab GTPase-binding effector protein 2	1.36e-05	7.15e-03	NA
2. P	Q86YS3	Rab11 family-interacting protein 4	7.96e-04	5.59e-05	NA
2. P	Q8BYC6	Serine/threonine-protein kinase TAO3	1.57e-04	2.05e-04	NA
2. P	Q3ZBL4	Leucine zipper transcription factor-like protein 1	3.09e-05	5.87e-03	NA
2. P	Q6DD27	Serine/threonine-protein kinase TAO3	1.16e-04	2.37e-04	NA
2. P	Q9VAC8	Spindle assembly abnormal protein 6 homolog	2.48e-07	2.79e-02	NA
2. P	Q8C7U1	NEDD4-binding protein 3	1.50e-03	4.76e-02	NA
2. P	Q9NQ48	Leucine zipper transcription factor-like protein 1	8.85e-06	3.03e-02	NA
2. P	A2CE83	Endosome-associated-trafficking regulator 1	5.20e-03	3.98e-03	NA
2. P	Q9EPM5	Syncoilin	4.21e-06	4.81e-02	NA
2. P	A1Z7Z9	Centrosomal protein of 131 kDa	4.16e-04	4.27e-04	NA
2. P	Q0VG85	Coiled-coil domain-containing protein 162	1.42e-04	2.11e-02	NA
2. P	Q9Y608	Leucine-rich repeat flightless-interacting protein 2	1.96e-03	1.79e-03	NA
2. P	Q5ZI11	Leucine-rich repeat-containing protein 45	1.45e-05	3.77e-03	NA
2. P	Q6AW69	Cingulin-like protein 1	6.08e-04	3.15e-02	NA
2. P	Q69ZB0	Leucine-rich repeat and coiled-coil domain-containing protein 1	6.18e-06	6.46e-04	NA
2. P	Q6GNW0	Leucine-rich repeat flightless-interacting protein 2	1.49e-03	1.25e-03	NA
2. P	Q562C6	Leucine zipper transcription factor-like protein 1	1.56e-04	1.03e-02	NA
2. P	Q9ZVT8	Putative E3 ubiquitin-protein ligase RF4	1.92e-02	1.41e-03	NA
2. P	Q9H2K8	Serine/threonine-protein kinase TAO3	3.53e-05	1.81e-04	NA
2. P	Q6NRC9	Leucine-rich repeat and coiled-coil domain-containing protein 1	1.19e-04	3.87e-02	NA
2. P	Q3LGD4	Rab11 family-interacting protein 4A	6.37e-03	4.73e-07	NA
2. P	O64584	WPP domain-associated protein	4.20e-06	5.93e-03	NA
2. P	Q95JS9	Coiled-coil domain-containing protein 110	2.78e-05	2.14e-04	NA
2. P	Q53UA7	Serine/threonine-protein kinase TAO3	9.03e-05	4.04e-04	NA
2. P	Q3LUD3	Nedd4 binding protein 3	4.81e-04	1.17e-02	NA
2. P	Q8VHQ7	Synaptotagmin-like protein 4	5.51e-01	3.69e-02	NA
2. P	Q6ZQ06	Centrosomal protein of 162 kDa	6.99e-04	9.65e-03	NA
2. P	Q86YM7	Homer protein homolog 1	1.26e-04	3.15e-02	NA
2. P	A4IIE8	Rab11 family-interacting protein 4	2.50e-03	3.05e-05	NA
2. P	Q5R4F3	Serine/threonine-protein kinase TAO3	4.90e-05	3.86e-04	NA
2. P	Q5TB80	Centrosomal protein of 162 kDa	5.82e-04	3.09e-02	NA
2. P	Q3UYG1	Coiled-coil domain-containing protein 160	3.64e-04	1.20e-03	NA
2. P	Q5T5N4	Uncharacterized protein C6orf118	6.62e-03	4.52e-03	NA
2. P	Q4R6V9	Leucine zipper transcription factor-like protein 1	3.25e-05	3.21e-02	NA
2. P	Q8TBZ0	Coiled-coil domain-containing protein 110	8.13e-02	3.34e-04	NA
2. P	P19334	Transient receptor potential protein	1.34e-02	2.34e-03	NA
2. P	Q2T9U9	Coiled-coil domain-containing protein 160	1.18e-03	2.45e-02	NA
2. P	Q7SY52	Serine/threonine-protein kinase 10	2.41e-04	4.49e-02	NA
3. B	Q9H560	Putative ankyrin repeat domain-containing protein 19	2.66e-15	NA	2.85e-79
3. B	Q8N9V6	Ankyrin repeat domain-containing protein 53	1.58e-02	NA	0.004
3. B	Q8VHS6	Ankyrin repeat and SOCS box protein 15	1.19e-04	NA	5.03e-04
3. B	Q8BX02	KN motif and ankyrin repeat domain-containing protein 2	3.58e-03	NA	0.002
3. B	Q1RGM2	Putative ankyrin repeat protein RBE_1411	1.71e-02	NA	0.042
3. B	Q9J5H9	Putative ankyrin repeat protein FPV022	NA	NA	3.67e-05
3. B	Q8IUH5	Palmitoyltransferase ZDHHC17	3.02e-04	NA	1.60e-05
3. B	Q54KA7	Ankyrin repeat, PH and SEC7 domain containing protein secG	3.63e-02	NA	1.93e-13
3. B	Q0V8G2	GA-binding protein subunit beta-2	1.64e-04	NA	0.022
3. B	Q3MJ40	Coiled-coil domain-containing protein 144B	4.30e-02	NA	3.74e-27
3. B	Q6AFL2	Putative ankyrin-containing lipoprotein Lxx09580	1.20e-06	NA	1.73e-05
3. B	P59672	Ankyrin repeat and SAM domain-containing protein 1A	7.61e-03	NA	2.68e-05
3. B	O14974	Protein phosphatase 1 regulatory subunit 12A	4.51e-03	NA	2.09e-05
3. B	Q99NH0	Ankyrin repeat domain-containing protein 17	1.43e-02	NA	1.54e-10
3. B	Q2QL84	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.59e-06	NA	2.46e-06
3. B	A9JR78	Tonsoku-like protein	1.56e-01	NA	2.93e-05
3. B	P57078	Receptor-interacting serine/threonine-protein kinase 4	1.89e-05	NA	1.91e-10
3. B	Q6P9J5	KN motif and ankyrin repeat domain-containing protein 4	4.84e-03	NA	1.06e-06
3. B	Q3TYL0	IQ motif and ankyrin repeat domain-containing protein 1	1.99e-03	NA	6.33e-04
3. B	Q9Y575	Ankyrin repeat and SOCS box protein 3	3.20e-05	NA	4.22e-06
3. B	Q1LZC5	Ankyrin repeat domain-containing protein 54	2.12e-03	NA	1.58e-07
3. B	Q2QLB5	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.58e-04	NA	2.25e-05
3. B	P0C6P7	Protein fem-1 homolog B	6.02e-03	NA	3.44e-05
3. B	Q8CEF1	Protein fem-1 homolog C	5.50e-04	NA	1.20e-06
3. B	Q4FE45	E3 ubiquitin-protein ligase XBAT33	3.78e-03	NA	0.017
3. B	Q9J5H8	Putative ankyrin repeat protein FPV023	NA	NA	8.15e-09
3. B	D3J162	Protein VAPYRIN	1.80e-04	NA	6.78e-09
3. B	Q0P5B9	Ankyrin repeat domain-containing protein 39	9.22e-06	NA	1.83e-06
3. B	Q06527	Ankyrin homolog	2.00e-06	NA	2.13e-13
3. B	Q9UM47	Neurogenic locus notch homolog protein 3	9.36e-02	NA	5.08e-07
3. B	Q8N7Z5	Ankyrin repeat domain-containing protein 31	3.31e-01	NA	0.002
3. B	Q01317	Ankyrin repeat protein nuc-2	4.24e-02	NA	1.67e-07
3. B	Q566C8	Ankyrin repeat domain-containing protein 54	7.62e-03	NA	2.11e-05
3. B	Q641X1	Ankyrin repeat domain-containing protein 61	1.67e-04	NA	0.009
3. B	P14585	Protein lin-12	1.33e-02	NA	0.001
3. B	Q96T49	Protein phosphatase 1 regulatory inhibitor subunit 16B	6.49e-06	NA	1.13e-06
3. B	O14593	DNA-binding protein RFXANK	2.71e-05	NA	3.93e-07
3. B	Q9H1D0	Transient receptor potential cation channel subfamily V member 6	2.58e-05	NA	0.010
3. B	Q9UPQ3	Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1	7.62e-01	NA	0.002
3. B	Q99466	Neurogenic locus notch homolog protein 4	2.35e-02	NA	5.25e-07
3. B	Q8K4M9	Oxysterol-binding protein-related protein 1	8.72e-03	NA	4.27e-04
3. B	Q00PJ3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.00e-05	NA	2.09e-07
3. B	Q07E41	Cortactin-binding protein 2	5.50e-02	NA	1.50e-04
3. B	Q9Y576	Ankyrin repeat and SOCS box protein 1	1.19e-07	NA	0.031
3. B	P62774	Myotrophin	2.31e-06	NA	0.033
3. B	Q9Z2X2	26S proteasome non-ATPase regulatory subunit 10	4.28e-12	NA	3.64e-11
3. B	Q95N27	Protein phosphatase 1 regulatory inhibitor subunit 16B	5.21e-04	NA	4.40e-06
3. B	P97819	85/88 kDa calcium-independent phospholipase A2	1.56e-02	NA	7.62e-10
3. B	Q9WV06	Ankyrin repeat domain-containing protein 2	2.11e-04	NA	1.44e-07
3. B	Q02357	Ankyrin-1	2.68e-02	NA	2.54e-11
3. B	O44997	Death-associated protein kinase dapk-1	6.04e-02	NA	6.26e-07
3. B	Q5FVC7	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2	7.94e-03	NA	0.001
3. B	Q2QLC6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.89e-05	NA	1.03e-04
3. B	Q4ULZ2	Putative ankyrin repeat protein RF_0580	1.94e-04	NA	3.49e-06
3. B	Q8N8A2	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B	4.85e-02	NA	1.82e-13
3. B	Q9D504	Ankyrin repeat domain-containing protein 7	7.73e-13	NA	1.31e-62
3. B	Q9NU02	Ankyrin repeat and EF-hand domain-containing protein 1	6.95e-02	NA	1.26e-05
3. B	Q29RM5	Protein fem-1 homolog A	5.79e-05	NA	1.47e-05
3. B	Q5ZK62	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2	8.81e-03	NA	1.19e-05
3. B	Q5TYM7	CARD- and ANK-domain containing inflammasome adapter protein	1.23e-06	NA	1.54e-12
3. B	Q21920	Ankyrin repeat and KH domain-containing protein mask-1	1.61e-01	NA	6.71e-09
3. B	Q65XV2	E3 ubiquitin-protein ligase XB3	4.38e-03	NA	0.003
3. B	Q5R6D7	Ankyrin repeat and SOCS box protein 8	2.77e-05	NA	1.95e-10
3. B	S0DPL8	Apicidin F cluster transcription factor apf2	3.18e-03	NA	1.62e-08
3. B	Q8IV38	Ankyrin repeat and MYND domain-containing protein 2	2.63e-02	NA	0.041
3. B	A1ZBY1	Protein fem-1 homolog B	2.86e-03	NA	5.90e-05
3. B	Q08353	NF-kappa-B inhibitor alpha	5.46e-05	NA	4.36e-05
3. B	Q554E7	Putative ZDHHC-type palmitoyltransferase 5	4.25e-04	NA	5.82e-06
3. B	Q14DN9	Ankyrin repeat and death domain-containing protein 1B	3.80e-03	NA	3.60e-08
3. B	A6QL64	Ankyrin repeat domain-containing protein 36A	1.11e-03	NA	4.87e-153
3. B	Q9VUX2	E3 ubiquitin-protein ligase mind-bomb	3.48e-03	NA	9.96e-09
3. B	Q9SQK3	Ankyrin repeat domain-containing protein EMB506, chloroplastic	2.10e-05	NA	7.55e-10
3. B	Q7T0Q1	Myotrophin	2.47e-06	NA	0.021
3. B	Q6NRD0	Ankyrin repeat domain-containing protein 13C-A	1.43e-01	NA	0.046
3. B	A2AQH4	BCL-6 corepressor-like protein 1	3.98e-01	NA	3.74e-04
3. B	O70511	Ankyrin-3	4.20e-01	NA	1.14e-10
3. B	Q5R8C8	Ankyrin repeat domain-containing protein 46	1.43e-03	NA	1.40e-07
3. B	Q3U0D9	E3 ubiquitin-protein ligase HACE1	6.30e-03	NA	2.94e-11
3. B	Q9Z2X3	26S proteasome non-ATPase regulatory subunit 10	2.86e-12	NA	7.06e-10
3. B	P24769	Ankyrin repeat protein B4	NA	NA	0.014
3. B	Q9TXQ1	Poly [ADP-ribose] polymerase tankyrase	1.61e-02	NA	3.77e-04
3. B	Q7Z8U2	Palmitoyltransferase akr1	1.03e-02	NA	2.72e-06
3. B	Q7T163	Kinase D-interacting substrate of 220 kDa B	2.39e-03	NA	6.02e-15
3. B	Q68DC2	Ankyrin repeat and SAM domain-containing protein 6	1.80e-02	NA	1.03e-06
3. B	Q9J505	Putative ankyrin repeat protein FPV230	NA	NA	0.014
3. B	A1X154	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	9.62e-06	NA	1.90e-05
3. B	Q7XUW4	Potassium channel KOR2	2.01e-01	NA	1.02e-04
3. B	Q6RI86	Transient receptor potential cation channel subfamily A member 1	1.89e-03	NA	1.98e-06
3. B	Q15057	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2	5.05e-03	NA	3.62e-04
3. B	Q1RMI3	GA-binding protein subunit beta-1	3.27e-05	NA	1.81e-04
3. B	Q63369	Nuclear factor NF-kappa-B p105 subunit (Fragment)	3.52e-05	NA	4.08e-04
3. B	O73579	Ankyrin repeat protein D4L/I2R	NA	NA	0.015
3. B	D3J163	Protein VAPYRIN-LIKE	6.06e-05	NA	0.009
3. B	A2A690	Protein TANC2	3.24e-02	NA	1.90e-06
3. B	A5A3E0	POTE ankyrin domain family member F	1.76e-04	NA	1.36e-84
3. B	Q07DW4	Cortactin-binding protein 2	7.44e-03	NA	2.17e-04
3. B	Q6FJ70	Palmitoyltransferase AKR1	1.89e-02	NA	0.003
3. B	Q4R3S3	Ankyrin repeat domain-containing protein 7	1.91e-12	NA	3.33e-64
3. B	Q38898	Potassium channel AKT2/3	6.34e-02	NA	1.75e-06
3. B	Q8CGN4	BCL-6 corepressor	7.40e-01	NA	0.001
3. B	Q61982	Neurogenic locus notch homolog protein 3	5.59e-02	NA	4.43e-07
3. B	Q7T3P8	Protein fem-1 homolog C	3.29e-03	NA	1.79e-07
3. B	Q5UPX1	Putative ankyrin repeat protein L289	NA	NA	9.45e-06
3. B	Q9Z2F6	B-cell lymphoma 3 protein homolog	6.59e-06	NA	5.50e-09
3. B	P17221	Sex-determining protein fem-1	6.02e-05	NA	3.31e-06
3. B	Q8BXP5	Photoreceptor ankyrin repeat protein	3.73e-03	NA	4.75e-05
3. B	O83515	Putative ankyrin repeat-containing protein TP_0502	3.03e-06	NA	6.51e-07
3. B	A7MB89	Protein fem-1 homolog C	5.10e-03	NA	1.13e-06
3. B	Q9WTT2	Caseinolytic peptidase B protein homolog	6.16e-02	NA	0.004
3. B	Q80T11	Usher syndrome type-1G protein homolog	4.44e-02	NA	1.89e-04
3. B	Q9D2J7	Ankyrin repeat and EF-hand domain-containing protein 1	6.23e-03	NA	1.03e-04
3. B	Q9D119	Protein phosphatase 1 regulatory subunit 27	4.03e-04	NA	1.96e-04
3. B	Q9H2K2	Poly [ADP-ribose] polymerase tankyrase-2	9.17e-02	NA	8.63e-11
3. B	Q9D061	Acyl-CoA-binding domain-containing protein 6	2.09e-03	NA	2.94e-04
3. B	Q8VHA6	Ankyrin repeat and SOCS box protein 18	6.82e-04	NA	7.66e-07
3. B	Q9BXX2	Ankyrin repeat domain-containing protein 30B	3.94e-04	NA	4.95e-76
3. B	Q06547	GA-binding protein subunit beta-1	4.90e-05	NA	1.96e-04
3. B	A6NHY2	Ankyrin repeat and death domain-containing protein 1B	1.51e-02	NA	1.59e-09
3. B	Q91ZT7	Ankyrin repeat and SOCS box protein 10	3.99e-04	NA	2.44e-05
3. B	P55273	Cyclin-dependent kinase 4 inhibitor D	2.79e-07	NA	3.20e-05
3. B	Q5RCK5	Ankyrin repeat and SOCS box protein 7	5.58e-06	NA	7.45e-04
3. B	Q8UVC1	Inversin	7.55e-03	NA	1.68e-06
3. B	Q8GSP8	Zygote-specific protein 3	3.17e-01	NA	0.043
3. B	Q2IBD4	Cortactin-binding protein 2	1.46e-01	NA	0.004
3. B	P0CG39	POTE ankyrin domain family member J	1.40e-03	NA	4.50e-98
3. B	P46530	Neurogenic locus notch homolog protein 1	2.49e-01	NA	2.91e-06
3. B	Q6ZVZ8	Ankyrin repeat and SOCS box protein 18	3.00e-05	NA	1.60e-04
3. B	Q2IBE3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	8.23e-05	NA	1.34e-05
3. B	Q63618	Espin	1.54e-03	NA	0.013
3. B	Q1RIZ4	Putative ankyrin repeat protein RBE_0589	1.00e-03	NA	0.015
3. B	B9EJA2	Cortactin-binding protein 2	6.18e-02	NA	0.001
3. B	Q8IWB6	Inactive serine/threonine-protein kinase TEX14	2.14e-01	NA	0.003
3. B	Q3UES3	Poly [ADP-ribose] polymerase tankyrase-2	4.34e-02	NA	2.06e-10
3. B	A5WVX9	Palmitoyltransferase ZDHHC17	2.17e-03	NA	6.28e-06
3. B	Q9J504	Putative ankyrin repeat protein FPV231	NA	NA	5.96e-11
3. B	Q91ZT9	Ankyrin repeat and SOCS box protein 8	1.61e-05	NA	2.32e-09
3. B	Q6W2J9	BCL-6 corepressor	4.08e-01	NA	0.004
3. B	P40578	Protein MGA2	1.16e-01	NA	0.005
3. B	P0DSS9	Ankyrin repeat protein B4	NA	NA	0.010
3. B	F1LTE0	Protein TANC2	4.89e-02	NA	2.37e-06
3. B	B1AK53	Espin	1.60e-03	NA	0.003
3. B	Q495M9	Usher syndrome type-1G protein	3.62e-02	NA	2.11e-04
3. B	Q9ERC1	Unconventional myosin-XVI	2.61e-02	NA	7.32e-07
3. B	Q9P2R3	Rabankyrin-5	1.98e-02	NA	8.87e-10
3. B	Q8BZ25	Ankyrin repeat and protein kinase domain-containing protein 1	1.23e-07	NA	3.06e-13
3. B	Q8UVC3	Inversin	7.93e-03	NA	1.36e-08
3. B	P13508	Protein glp-1	1.04e-03	NA	0.037
3. B	Q9SCX5	Probable potassium channel AKT5	6.22e-03	NA	1.19e-10
3. B	Q2QLG0	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	7.58e-06	NA	0.004
3. B	Q05823	2-5A-dependent ribonuclease	3.15e-04	NA	4.58e-10
3. B	P57044	Integrin-linked protein kinase	1.32e-03	NA	2.12e-04
3. B	Q8ZWC4	Putative ankyrin repeat protein PAE1861	5.33e-09	NA	3.44e-09
3. B	Q91XL9	Oxysterol-binding protein-related protein 1	1.01e-02	NA	0.001
3. B	O54910	NF-kappa-B inhibitor epsilon	1.53e-08	NA	1.71e-07
3. B	Q75HP9	Potassium channel AKT2	2.20e-01	NA	0.008
3. B	Q4X251	Palmitoyltransferase akr1	7.28e-03	NA	1.55e-08
3. B	Q8WMX7	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.09e-06	NA	7.12e-06
3. B	Q12013	Probable palmitoyltransferase AKR2	1.02e-02	NA	1.31e-04
3. B	Q08E43	Ankyrin repeat and SOCS box protein 8	1.64e-05	NA	2.04e-09
3. B	Q5UPG6	Putative ankyrin repeat protein L92	NA	NA	3.00e-06
3. B	Q8VBX0	Ankyrin repeat and SOCS box protein 13	2.43e-07	NA	1.27e-04
3. B	B7WN72	Protein shank	5.45e-02	NA	3.79e-06
3. B	Q14678	KN motif and ankyrin repeat domain-containing protein 1	1.85e-01	NA	7.51e-05
3. B	Q9Z205	DNA-binding protein RFXANK	5.79e-06	NA	3.76e-04
3. B	Q9BXW6	Oxysterol-binding protein-related protein 1	4.90e-03	NA	0.001
3. B	Q00653	Nuclear factor NF-kappa-B p100 subunit	3.59e-04	NA	2.75e-04
3. B	Q5ZLC8	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	4.61e-03	NA	5.89e-10
3. B	Q68LP1	E3 ubiquitin-protein ligase MIB2	1.21e-02	NA	1.40e-04
3. B	Q01484	Ankyrin-2	NA	NA	1.88e-13
3. B	Q9UK73	Protein fem-1 homolog B	6.31e-03	NA	3.05e-05
3. B	F8W2M1	E3 ubiquitin-protein ligase HACE1	2.08e-02	NA	1.36e-10
3. B	Q2QLH1	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.21e-05	NA	1.01e-05
3. B	Q9WV71	Ankyrin repeat and SOCS box protein 4	1.48e-03	NA	0.001
3. B	Q9J513	Putative ankyrin repeat protein FPV222	NA	NA	3.47e-07
3. B	Q9DBR7	Protein phosphatase 1 regulatory subunit 12A	1.28e-04	NA	1.97e-05
3. B	Q9U518	L-asparaginase	1.40e-03	NA	5.88e-07
3. B	Q9Y283	Inversin	9.47e-05	NA	1.53e-07
3. B	Q495B1	Ankyrin repeat and death domain-containing protein 1A	3.13e-05	NA	3.12e-10
3. B	Q9M8S6	Potassium channel SKOR	2.12e-01	NA	0.031
3. B	Q9ULH0	Kinase D-interacting substrate of 220 kDa	1.84e-04	NA	5.38e-18
3. B	G3I6Z6	Neurogenic locus notch homolog protein 1	NA	NA	8.84e-09
3. B	Q9BGT9	Ankyrin repeat and SOCS box protein 7	6.44e-07	NA	6.53e-04
3. B	Q5XJ13	Ankyrin repeat and SAM domain-containing protein 6	7.22e-05	NA	0.036
3. B	P14360	Putative ankyrin repeat protein FPV240	NA	NA	1.44e-07
3. B	O70445	BRCA1-associated RING domain protein 1	8.25e-02	NA	1.51e-07
3. B	Q4UKJ3	Putative ankyrin repeat protein RF_1087	1.70e-04	NA	0.013
3. B	Q3U0L2	Ankyrin repeat domain-containing protein 33B	3.40e-02	NA	1.38e-06
3. B	Q09YK6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	8.97e-02	NA	3.07e-05
3. B	Q5UPG5	Putative ankyrin repeat protein L93	NA	NA	4.58e-12
3. B	Q86SG2	Ankyrin repeat domain-containing protein 23	5.60e-05	NA	3.90e-08
3. B	Q876L4	Probable palmitoyltransferase AKR2	8.57e-03	NA	8.45e-06
3. B	Q9WV72	Ankyrin repeat and SOCS box protein 3	1.75e-02	NA	9.56e-06
3. B	Q91WK7	Ankyrin repeat domain-containing protein 54	5.09e-03	NA	2.54e-05
3. B	Q9J502	Putative ankyrin repeat protein FPV233	NA	NA	0.003
3. B	Q5U2S6	Ankyrin repeat and SOCS box protein 2	1.57e-03	NA	2.05e-04
3. B	Q80SY4	E3 ubiquitin-protein ligase MIB1	3.58e-03	NA	5.59e-09
3. B	Q876L5	Palmitoyltransferase AKR1	1.05e-02	NA	3.67e-08
3. B	Q4I8B6	Palmitoyltransferase AKR1	7.98e-03	NA	2.16e-07
3. B	P16157	Ankyrin-1	4.31e-02	NA	2.08e-12
3. B	O88202	60 kDa lysophospholipase	5.13e-03	NA	0.008
3. B	Q502M6	Ankyrin repeat domain-containing protein 29	1.96e-10	NA	1.59e-09
3. B	A4II29	Notch-regulated ankyrin repeat-containing protein	2.90e-03	NA	0.004
3. B	Q337A0	Probable E3 ubiquitin-protein ligase XBOS33	1.03e-02	NA	0.002
3. B	Q6S8J3	POTE ankyrin domain family member E	1.08e-03	NA	1.84e-85
3. B	P0C0T2	Ankyrin repeat and SAM domain-containing protein 6	6.74e-04	NA	9.93e-10
3. B	Q0VGY8	Protein TANC1	9.96e-02	NA	2.59e-06
3. B	O95271	Poly [ADP-ribose] polymerase tankyrase-1	5.08e-02	NA	4.89e-09
3. B	G0LXV8	Alpha-latrotoxin-Lh1a (Fragment)	5.90e-02	NA	7.52e-07
3. B	Q15027	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1	1.39e-02	NA	2.15e-05
3. B	Q9Y566	SH3 and multiple ankyrin repeat domains protein 1	2.39e-02	NA	0.015
3. B	Q653P0	Potassium channel KOR1	4.66e-02	NA	1.62e-08
3. B	Q6PFX9	Poly [ADP-ribose] polymerase tankyrase-1	3.02e-02	NA	4.23e-09
3. B	Q9J5I3	Putative ankyrin repeat protein FPV018	NA	NA	4.37e-06
3. B	Q2IBG0	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.45e-06	NA	6.21e-06
3. B	Q94B55	Putative E3 ubiquitin-protein ligase XBAT31	8.17e-05	NA	1.20e-04
3. B	C7B178	Protein VAPYRIN	3.37e-05	NA	1.21e-06
3. B	Q5R4M7	Ankyrin repeat and SOCS box protein 6	7.68e-04	NA	4.69e-05
3. B	Q875M2	Palmitoyltransferase AKR1	3.52e-03	NA	5.94e-08
3. B	Q71S21	Inversin-B	6.34e-03	NA	4.95e-11
3. B	Q9R172	Neurogenic locus notch homolog protein 3	1.84e-01	NA	4.63e-07
3. B	Q29Q26	Ankyrin repeat domain-containing protein 2B	1.83e-02	NA	0.003
3. B	Q5JPF3	Ankyrin repeat domain-containing protein 36C	1.03e-03	NA	2.83e-160
3. B	Q6DGX3	Ankyrin repeat domain-containing protein 54	4.09e-03	NA	1.75e-06
3. B	Q4P6L3	Palmitoyltransferase AKR1	1.87e-04	NA	2.91e-05
3. B	Q3V096	Ankyrin repeat domain-containing protein 42	8.81e-05	NA	1.40e-04
3. B	Q96AX9	E3 ubiquitin-protein ligase MIB2	1.09e-02	NA	7.21e-05
3. B	A0A3L7I2I8	85/88 kDa calcium-independent phospholipase A2	9.07e-03	NA	1.78e-08
3. B	Q5DU14	Unconventional myosin-XVI	1.84e-03	NA	1.09e-06
3. B	Q5UPH0	Putative ankyrin repeat protein L100	NA	NA	0.001
3. B	Q86YR6	POTE ankyrin domain family member D	9.14e-06	NA	3.06e-86
3. B	Q5UPE3	Putative ankyrin repeat protein L62	NA	NA	0.020
3. B	Q923M0	Protein phosphatase 1 regulatory subunit 16A	6.23e-06	NA	0.004
3. B	Q6F3J0	Nuclear factor NF-kappa-B p105 subunit	8.68e-04	NA	3.32e-05
3. B	Q5UQY4	Putative ankyrin repeat protein R886 (Fragment)	NA	NA	1.19e-04
3. B	Q94527	Nuclear factor NF-kappa-B p110 subunit	1.22e-02	NA	0.030
3. B	Q8N9B4	Ankyrin repeat domain-containing protein 42	5.78e-06	NA	1.35e-05
3. B	Q07E28	Cortactin-binding protein 2	1.03e-01	NA	7.06e-05
3. B	Q5H9F3	BCL-6 corepressor-like protein 1	6.53e-01	NA	3.06e-04
3. B	Q8WXK3	Ankyrin repeat and SOCS box protein 13	2.84e-07	NA	1.46e-04
3. B	Q96P64	Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 4	3.26e-01	NA	0.002
3. B	Q5GIG6	Serine/threonine-protein kinase TNNI3K	1.52e-02	NA	6.88e-07
3. B	Q92625	Ankyrin repeat and SAM domain-containing protein 1A	1.38e-03	NA	0.002
3. B	Q09YI3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	4.15e-05	NA	6.20e-06
3. B	Q9J5I9	Putative ankyrin repeat protein FPV012	NA	NA	2.99e-08
3. B	A0M8T5	Cortactin-binding protein 2	9.98e-02	NA	2.07e-05
3. B	Q2KI79	Ankyrin repeat family A protein 2	1.64e-04	NA	2.78e-05
3. B	Q5ZM55	Protein fem-1 homolog B	6.10e-03	NA	4.53e-05
3. B	Q07E15	Cortactin-binding protein 2	1.49e-01	NA	8.79e-05
3. B	Q6UB98	Ankyrin repeat domain-containing protein 12	4.31e-01	NA	3.70e-04
3. B	A6QPE7	Ankyrin repeat domain-containing protein 65	1.50e-07	NA	1.11e-06
3. B	Q9XZC0	Alpha-latrocrustotoxin-Lt1a (Fragment)	6.41e-02	NA	1.15e-05
3. B	Q94A76	Potassium channel GORK	2.90e-01	NA	4.02e-05
3. B	Q8Q0U0	Putative ankyrin repeat protein MM_0045	6.99e-08	NA	1.30e-19
3. B	O35516	Neurogenic locus notch homolog protein 2	1.54e-01	NA	6.30e-06
3. B	A6NCL7	Ankyrin repeat domain-containing protein 33B	1.76e-03	NA	9.33e-06
3. B	Q5VYY1	Ankyrin repeat domain-containing protein 22	8.63e-08	NA	4.20e-05
3. B	Q755Y0	Palmitoyltransferase AKR1	3.47e-03	NA	4.24e-07
3. B	Q03017	NF-kappa-B inhibitor cactus	3.13e-05	NA	1.39e-05
3. B	Q91WD2	Transient receptor potential cation channel subfamily V member 6	2.27e-05	NA	2.12e-04
3. B	B8N0E6	Ankyrin-repeat domain containing transcription coregulator asaA	7.28e-03	NA	5.81e-06
3. B	O75762	Transient receptor potential cation channel subfamily A member 1	4.23e-03	NA	1.29e-08
3. B	Q8VD46	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.07e-05	NA	9.89e-06
3. B	Q9CQM6	Ankyrin repeat domain-containing protein 61	7.61e-05	NA	4.79e-04
3. B	Q6NY19	KN motif and ankyrin repeat domain-containing protein 3	5.74e-03	NA	6.61e-07
3. B	P19838	Nuclear factor NF-kappa-B p105 subunit	3.97e-03	NA	3.41e-05
3. B	A0M8S4	Cortactin-binding protein 2	8.86e-02	NA	8.43e-04
3. B	Q9Z1E3	NF-kappa-B inhibitor alpha	1.45e-05	NA	3.53e-04
3. B	A6NIR3	Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 5	6.75e-01	NA	0.002
3. B	Q9TU71	Ankyrin repeat domain-containing protein 1	1.56e-05	NA	4.17e-11
3. B	Q18297	Transient receptor potential cation channel subfamily A member 1 homolog	1.45e-05	NA	3.00e-05
3. B	E9Q4F7	Ankyrin repeat domain-containing protein 11	4.53e-01	NA	1.10e-04
3. B	Q8WWH4	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	4.21e-05	NA	1.48e-05
3. B	Q1RJN6	Putative ankyrin repeat protein RBE_0347	7.52e-03	NA	7.93e-05
3. B	P98150	Nuclear factor NF-kappa-B p100 subunit	2.80e-03	NA	6.18e-07
3. B	Q9XSM3	Transient receptor potential cation channel subfamily V member 5	3.20e-05	NA	4.86e-04
3. B	Q5RF15	Serine/threonine-protein kinase TNNI3K	1.72e-03	NA	7.20e-08
3. B	Q9VFD5	Protein fem-1 homolog CG6966	2.06e-04	NA	1.04e-04
3. B	Q2IBA2	Cortactin-binding protein 2	8.34e-02	NA	8.50e-04
3. B	Q812A3	Ankyrin repeat domain-containing protein 23	4.23e-05	NA	9.81e-06
3. B	Q3SWY2	Integrin-linked protein kinase	1.37e-02	NA	2.19e-04
3. B	A5PMU4	Ankyrin repeat and sterile alpha motif domain-containing protein 1B	4.18e-03	NA	2.11e-08
3. B	Q876A6	Palmitoyltransferase AKR1	5.34e-03	NA	6.01e-08
3. B	Q96KQ7	Histone-lysine N-methyltransferase EHMT2	9.30e-03	NA	1.00e-07
3. B	P25799	Nuclear factor NF-kappa-B p105 subunit	1.50e-03	NA	9.86e-05
3. B	Q6GNY1	E3 ubiquitin-protein ligase mib1	4.46e-03	NA	8.35e-09
3. B	Q91ZU0	Ankyrin repeat and SOCS box protein 7	7.92e-07	NA	7.52e-04
3. B	Q5UPV1	Putative ankyrin repeat protein L271	NA	NA	1.91e-05
3. B	Q91ZT8	Ankyrin repeat and SOCS box protein 9	3.12e-08	NA	0.030
3. B	Q9J5H7	Putative ankyrin repeat protein FPV024	NA	NA	5.75e-06
3. B	Q09701	Palmitoyltransferase akr1	2.91e-08	NA	0.017
3. B	Q8WXI3	Ankyrin repeat and SOCS box protein 10	1.53e-03	NA	3.86e-04
3. B	Q01705	Neurogenic locus notch homolog protein 1	3.37e-02	NA	1.16e-08
3. B	Q9Z2G1	Protein fem-1 homolog A-A	1.55e-02	NA	1.11e-05
3. B	P0C550	Potassium channel AKT1	1.12e-02	NA	6.68e-09
3. B	X1WE18	KN motif and ankyrin repeat domain-containing protein 2	5.79e-03	NA	5.54e-05
3. B	G5EGA3	Ankyrin repeat and LEM domain-containing protein 1 homolog	3.87e-02	NA	3.00e-05
3. B	Q8TF27	Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 11	3.55e-01	NA	0.002
3. B	Q5VUJ5	Putative Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 7	6.20e-01	NA	0.002
3. B	Q8WXK1	Ankyrin repeat and SOCS box protein 15	8.04e-04	NA	3.70e-05
3. B	Q2IBF8	Cortactin-binding protein 2	5.73e-02	NA	2.71e-04
3. B	Q2T9K6	Protein fem-1 homolog C	6.55e-03	NA	5.71e-08
3. B	Q9ULJ7	Ankyrin repeat domain-containing protein 50	2.56e-02	NA	6.15e-15
3. B	P0C927	Ankyrin repeat and SOCS box protein 14	1.34e-03	NA	1.21e-07
3. B	Q07DX6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	7.56e-03	NA	2.69e-05
3. B	A5PK26	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1	7.75e-03	NA	8.97e-04
3. B	Q9Y6X6	Unconventional myosin-XVI	2.39e-03	NA	1.32e-05
3. B	Q8K2H4	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1	4.35e-03	NA	2.36e-05
3. B	Q9ZCL3	Putative ankyrin repeat protein RP714	1.43e-05	NA	6.32e-05
3. B	P46531	Neurogenic locus notch homolog protein 1	8.73e-02	NA	3.04e-08
3. B	Q2IBE6	Cortactin-binding protein 2	1.51e-01	NA	1.65e-04
3. B	Q3ZBX7	Ankyrin repeat domain-containing protein 1	1.13e-05	NA	9.11e-11
3. B	Q4V869	Acyl-CoA-binding domain-containing protein 6	1.59e-02	NA	5.22e-05
3. B	Q09YG9	Cortactin-binding protein 2	5.07e-02	NA	4.43e-05
3. B	Q8HXA6	Ankyrin repeat and SOCS box protein 15	4.35e-03	NA	0.002
3. B	Q0P5G1	Tonsoku-like protein	3.66e-01	NA	1.85e-04
3. B	Q91ZU1	Ankyrin repeat and SOCS box protein 6	7.98e-04	NA	0.005
3. B	Q96NS5	Ankyrin repeat and SOCS box protein 16	1.58e-03	NA	0.003
3. B	Q52T38	Protein S-acyltransferase 24	1.45e-05	NA	5.30e-05
3. B	P0C6S7	Ankyrin repeat and sterile alpha motif domain-containing protein 1B	6.07e-03	NA	4.86e-08
3. B	Q96JP0	Protein fem-1 homolog C	1.26e-04	NA	1.10e-06
3. B	Q9C6C3	ADP-ribosylation factor GTPase-activating protein AGD2	1.19e-03	NA	0.025
3. B	F1N6G5	E3 ubiquitin-protein ligase HACE1	2.15e-02	NA	2.40e-11
3. B	Q8NFD2	Ankyrin repeat and protein kinase domain-containing protein 1	3.35e-07	NA	1.20e-12
3. B	Q865U8	Ankyrin repeat domain-containing protein 1	1.07e-05	NA	5.54e-10
3. B	Q9DF58	Integrin-linked protein kinase	1.57e-02	NA	2.19e-04
3. B	Q3SZE4	Ankyrin repeat and SOCS box protein 11	1.58e-06	NA	0.047
3. B	Q6NZL6	Tonsoku-like protein	8.18e-02	NA	0.006
3. B	Q9SMX5	ADP-ribosylation factor GTPase-activating protein AGD4	1.39e-02	NA	0.043
3. B	Q1LZH7	KN motif and ankyrin repeat domain-containing protein 2	4.63e-03	NA	7.17e-04
3. B	Q8WVL7	Ankyrin repeat domain-containing protein 49	6.49e-04	NA	2.81e-04
3. B	Q8QN36	Ankyrin repeat domain-containing protein CP77	NA	NA	0.045
3. B	Q8NF67	Putative ankyrin repeat domain-containing protein 20A12 pseudogene	6.21e-07	NA	6.46e-16
3. B	A2VDR2	Acyl-CoA-binding domain-containing protein 6	4.38e-03	NA	4.41e-05
3. B	Q00PJ1	Cortactin-binding protein 2	1.38e-01	NA	0.001
3. B	Q54BA2	Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800	1.75e-02	NA	1.26e-08
3. B	Q9VCA8	Ankyrin repeat and KH domain-containing protein mask	NA	NA	9.75e-11
3. B	A2ARS0	Ankyrin repeat domain-containing protein 63	1.83e-04	NA	0.006
3. B	F1MJR8	Inactive serine/threonine-protein kinase TEX14	1.27e-01	NA	0.021
3. B	Q15327	Ankyrin repeat domain-containing protein 1	1.38e-05	NA	9.03e-10
3. B	Q25338	Delta-latroinsectotoxin-Lt1a	3.12e-02	NA	1.91e-09
3. B	Q5EA33	Ankyrin repeat domain-containing protein 49	1.10e-04	NA	2.29e-06
3. B	Q9BXX3	Ankyrin repeat domain-containing protein 30A	1.24e-04	NA	7.53e-80
3. B	Q86YT6	E3 ubiquitin-protein ligase MIB1	9.55e-05	NA	5.83e-09
3. B	Q94CT7	Probable E3 ubiquitin-protein ligase XBOS31	4.16e-04	NA	9.73e-05
3. B	Q9TZC4	Integrin-linked protein kinase homolog pat-4	1.31e-02	NA	0.003
3. B	O89019	Inversin	1.02e-02	NA	4.03e-07
3. B	Q66JD7	Acyl-CoA-binding domain-containing protein 6	1.85e-02	NA	1.03e-06
3. B	Q53RE8	Ankyrin repeat domain-containing protein 39	5.85e-08	NA	6.19e-06
3. B	Q54HW1	26S proteasome non-ATPase regulatory subunit 10	3.27e-12	NA	6.23e-10
3. B	Q8WMX8	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	4.95e-06	NA	6.09e-06
3. B	Q07DZ7	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.81e-04	NA	5.23e-04
3. B	Q0JKV1	Potassium channel AKT1	4.91e-02	NA	6.62e-09
3. B	Q09YH1	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	4.68e-03	NA	0.007
3. B	Q60773	Cyclin-dependent kinase 4 inhibitor D	2.84e-07	NA	1.03e-05
3. B	Q5UPG7	Putative ankyrin repeat protein L91	NA	NA	1.03e-04
3. B	Q2IBB2	Cortactin-binding protein 2	6.78e-02	NA	2.90e-04
3. B	Q9EQG6	Kinase D-interacting substrate of 220 kDa	1.29e-04	NA	1.06e-17
3. B	Q5ZLC6	Ankyrin repeat domain-containing protein 10	3.12e-04	NA	0.003
3. B	Q4KL97	Ankyrin repeat domain-containing protein 1	9.69e-06	NA	5.14e-08
3. B	Q91955	Myotrophin	2.41e-06	NA	0.048
3. B	P58546	Myotrophin	2.27e-06	NA	0.032
3. B	Q2QLG9	Cortactin-binding protein 2	1.81e-02	NA	6.16e-04
3. B	Q4R544	Ankyrin repeat and SOCS box protein 8	1.59e-05	NA	6.61e-10
3. B	Q9J4Z6	Putative ankyrin repeat protein FPV244	NA	NA	7.00e-10
3. B	Q9J5A7	Putative ankyrin repeat protein FPV115	NA	NA	4.61e-08
3. B	P93002	Regulatory protein NPR1	2.95e-01	NA	0.011
3. B	B2RU33	POTE ankyrin domain family member C	2.27e-07	NA	1.73e-86
3. B	Q07E17	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.64e-05	NA	1.19e-05
3. B	Q9UVH3	Palmitoyltransferase AKR1 (Fragment)	1.69e-02	NA	9.67e-05
3. B	Q60772	Cyclin-dependent kinase 4 inhibitor C	1.05e-07	NA	0.003
3. B	Q6NSI1	Putative ankyrin repeat domain-containing protein 26-like protein	3.22e-05	NA	3.25e-54
3. B	P0CG38	POTE ankyrin domain family member I	7.59e-04	NA	1.31e-96
3. B	A0JP26	POTE ankyrin domain family member B3	6.16e-08	NA	1.75e-88
3. B	O74205	Transcription factor TOXE	2.60e-02	NA	1.93e-04
3. B	Q09YJ5	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.97e-05	NA	9.23e-07
3. B	Q8WMX6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	4.95e-05	NA	1.66e-05
3. B	Q6S5H5	POTE ankyrin domain family member G	1.19e-07	NA	1.00e-87
3. B	P77736	Putative ankyrin repeat protein YahD	1.43e-10	NA	5.33e-05
3. B	Q5F478	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B	6.80e-02	NA	2.00e-13
3. B	Q8K3X6	Ankyrin repeat and SAM domain-containing protein 4B	1.77e-01	NA	2.97e-06
3. B	Q9J507	Putative ankyrin repeat protein FPV228	NA	NA	9.40e-06
3. B	Q7TQP6	Serine/threonine-protein kinase TNNI3K	1.10e-04	NA	1.22e-09
3. B	P0CS67	Palmitoyltransferase AKR1	3.02e-05	NA	3.84e-05
3. B	Q9Z2G0	Protein fem-1 homolog B	1.74e-05	NA	3.50e-05
3. B	P14356	Ankyrin repeat protein M1	NA	NA	0.005
3. B	P21102	Ankyrin repeat protein C18/B24	NA	NA	0.022
3. B	G5E8K5	Ankyrin-3	2.37e-02	NA	4.48e-11
3. B	Q8K0L0	Ankyrin repeat and SOCS box protein 2	1.64e-03	NA	2.35e-04
3. B	A0PJZ0	Putative ankyrin repeat domain-containing protein 20A5	2.69e-05	NA	2.36e-45
3. B	Q5VW22	Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 6	4.31e-01	NA	0.003
3. B	Q3TYA6	M-phase phosphoprotein 8	1.81e-02	NA	4.63e-05
3. B	P21783	Neurogenic locus notch homolog protein 1	1.65e-01	NA	4.36e-07
3. B	A0A0A6YYL3	POTE ankyrin domain family member B	2.19e-09	NA	4.66e-89
3. B	A0A0R4IQZ2	Putative palmitoyltransferase ZDHHC13	1.26e-06	NA	2.45e-07
3. B	Q96HA7	Tonsoku-like protein	7.03e-01	NA	0.037
3. B	Q9H765	Ankyrin repeat and SOCS box protein 8	2.79e-05	NA	1.92e-10
3. B	Q3KP44	Ankyrin repeat domain-containing protein 55	1.14e-02	NA	5.37e-05
3. B	Q99549	M-phase phosphoprotein 8	1.72e-02	NA	1.17e-04
3. B	Q1RJR6	Putative ankyrin repeat protein RBE_0317	5.25e-05	NA	2.89e-04
3. B	Q9R186	Transient receptor potential cation channel subfamily V member 6	6.24e-04	NA	2.00e-04
3. B	Q10728	Protein phosphatase 1 regulatory subunit 12A	3.67e-04	NA	2.85e-05
3. B	Q63746	NF-kappa-B inhibitor alpha	3.49e-06	NA	3.82e-04
3. B	P07207	Neurogenic locus Notch protein	NA	NA	1.18e-09
3. B	Q07DV1	Cortactin-binding protein 2	3.55e-02	NA	6.65e-05
3. B	Q9W0T5	Transient receptor potential channel pyrexia	9.56e-08	NA	4.42e-12
3. B	Q9CWU2	Palmitoyltransferase ZDHHC13	2.33e-03	NA	2.64e-07
3. B	Q9NWX5	Ankyrin repeat and SOCS box protein 6	8.01e-04	NA	8.38e-05
3. B	Q5W7F2	ADP-ribosylation factor GTPase-activating protein AGD3	6.48e-04	NA	4.19e-04
3. B	Q9STP8	Acyl-CoA-binding domain-containing protein 2	2.50e-02	NA	1.87e-06
3. B	A6NGH8	Ankyrin repeat domain-containing protein 61	3.35e-05	NA	7.98e-05
3. B	Q63ZY3	KN motif and ankyrin repeat domain-containing protein 2	1.77e-03	NA	8.60e-05
3. B	Q07DX4	Cortactin-binding protein 2	8.26e-02	NA	2.09e-04
3. B	Q1RHQ8	Putative ankyrin repeat protein RBE_1025	1.41e-04	NA	0.009
3. B	Q9CR42	Ankyrin repeat domain-containing protein 1	1.37e-05	NA	2.87e-09
3. B	Q8BTZ5	Ankyrin repeat domain-containing protein 46	1.31e-03	NA	8.16e-07
3. B	A6NK59	Ankyrin repeat and SOCS box protein 14	6.77e-04	NA	1.93e-08
3. B	Q8BLA8	Transient receptor potential cation channel subfamily A member 1	2.70e-03	NA	2.54e-07
3. B	Q8H569	Potassium channel AKT3	1.18e-02	NA	1.27e-05
3. B	O73630	Nuclear factor NF-kappa-B p100 subunit	8.51e-04	NA	4.06e-08
3. B	A6NI47	Putative POTE ankyrin domain family member M	1.57e-07	NA	6.29e-88
3. B	Q5UQV3	Putative ankyrin repeat protein L371	NA	NA	6.44e-06
3. B	Q6C520	Palmitoyltransferase AKR1	1.16e-02	NA	0.002
3. B	Q2QLA2	Cortactin-binding protein 2	9.69e-02	NA	4.28e-04
3. B	Q9D2X0	Ankyrin repeat domain-containing protein 39	6.69e-04	NA	2.36e-06
3. B	O75179	Ankyrin repeat domain-containing protein 17	1.24e-01	NA	7.63e-11
3. B	Q86AT8	Stress-activated protein kinase alpha	3.26e-03	NA	0.009
3. B	Q9HYV6	Putative ankyrin repeat protein PA3287	1.31e-07	NA	6.38e-08
3. B	Q5ZMD2	Ankyrin repeat and MYND domain-containing protein 2	2.06e-02	NA	0.003
3. B	Q09YM8	Cortactin-binding protein 2	5.13e-02	NA	2.25e-06
3. B	Q9WTK5	Nuclear factor NF-kappa-B p100 subunit	6.00e-04	NA	3.89e-05
3. B	Q6GPE5	Protein fem-1 homolog B	6.45e-03	NA	5.91e-05
3. B	Q8BXK8	Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1	6.58e-01	NA	0.003
3. B	Q4R690	Palmitoyltransferase ZDHHC13	3.45e-03	NA	2.14e-06
3. B	Q07E30	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	6.67e-03	NA	7.12e-06
3. B	Q5DW34	Histone-lysine N-methyltransferase EHMT1	1.67e-02	NA	3.96e-08
3. B	Q80YE7	Death-associated protein kinase 1	6.63e-02	NA	3.35e-14
3. B	Q5URB8	Putative ankyrin repeat protein R841	NA	NA	0.009
3. B	Q5UPG0	Putative ankyrin repeat protein L86	NA	NA	2.32e-05
3. B	Q4UMP3	Putative ankyrin repeat protein RF_0314	4.96e-02	NA	0.003
3. B	E9PTT0	Palmitoyltransferase ZDHHC17	2.41e-04	NA	5.54e-05
3. B	P0DJE3	Alpha-latrotoxin-Lhe1a	8.18e-02	NA	1.16e-07
3. B	Q7Z6K4	Notch-regulated ankyrin repeat-containing protein	1.03e-03	NA	0.005
3. B	Q978J0	Putative ankyrin repeat protein TV1425	6.68e-09	NA	1.28e-14
3. B	O00221	NF-kappa-B inhibitor epsilon	1.55e-07	NA	6.60e-07
3. B	Q2IBF5	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	4.04e-03	NA	1.65e-05
3. B	P33825	Ankyrin repeat protein M1	NA	NA	0.027
3. B	Q8IWZ3	Ankyrin repeat and KH domain-containing protein 1	3.72e-02	NA	8.94e-12
3. B	Q4V890	Protein fem-1 homolog A	2.38e-05	NA	7.85e-06
3. B	Q9J5H5	Putative ankyrin repeat protein FPV026	NA	NA	2.51e-08
3. B	Q9J4Z4	Putative ankyrin repeat protein FPV246	NA	NA	1.67e-08
3. B	P20640	Ankyrin repeat protein M1	NA	NA	0.004
3. B	Q29RV0	Cyclin-dependent kinase 4 inhibitor D	2.35e-07	NA	5.68e-06
3. B	B0G124	Ankyrin repeat-containing protein DDB_G0279043	4.53e-07	NA	0.009
3. B	Q8C6Y6	Ankyrin repeat and SOCS box protein 14	5.99e-04	NA	1.24e-09
3. B	Q5UPJ9	Putative ankyrin repeat protein L122	NA	NA	1.51e-04
3. B	Q91974	NF-kappa-B inhibitor alpha	2.15e-05	NA	3.14e-05
3. B	Q54F46	Homeobox protein Wariai	1.15e-02	NA	9.31e-12
3. B	Q108T9	Cortactin-binding protein 2	7.33e-02	NA	6.16e-05
3. B	Q9H672	Ankyrin repeat and SOCS box protein 7	5.64e-07	NA	6.64e-04
3. B	Q9ET47	Espin	1.63e-03	NA	0.005
3. B	Q05921	2-5A-dependent ribonuclease	1.72e-04	NA	1.33e-08
3. B	Q9GKW8	Ankyrin repeat and death domain-containing protein 1A (Fragment)	2.05e-04	NA	1.31e-07
3. B	Q5ZIJ9	E3 ubiquitin-protein ligase MIB2	6.82e-03	NA	5.22e-06
3. B	Q9FY74	Calmodulin-binding transcription activator 1	2.79e-03	NA	0.003
3. B	Q07DV3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.87e-04	NA	0.001
3. B	Q1RHT6	Putative ankyrin repeat protein RBE_0997	4.30e-04	NA	6.63e-13
3. B	Q9SZI3	Regulatory protein NPR2	2.81e-02	NA	0.027
3. B	Q02979	Glycerophosphocholine phosphodiesterase GDE1	1.06e-01	NA	1.38e-04
3. B	Q505D1	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A	4.02e-02	NA	2.06e-13
3. B	O90760	Putative ankyrin repeat protein FPV031	NA	NA	4.02e-06
3. B	Q8IUH4	Palmitoyltransferase ZDHHC13	2.55e-04	NA	1.12e-07
3. B	P81069	GA-binding protein subunit beta-2	1.40e-04	NA	0.003
3. B	Q54GC8	Acyl-CoA-binding domain-containing protein 6 homolog	2.81e-02	NA	0.004
3. B	Q9VUW9	Palmitoyltransferase Hip14	2.31e-04	NA	0.036
3. B	Q96Q27	Ankyrin repeat and SOCS box protein 2	1.31e-03	NA	1.37e-06
3. B	Q00420	GA-binding protein subunit beta-1	2.42e-05	NA	1.16e-04
3. B	Q9J508	Putative ankyrin repeat protein FPV227	NA	NA	6.67e-04
3. B	Q86WC6	Protein phosphatase 1 regulatory subunit 27	1.12e-03	NA	0.002
3. B	Q1RI12	Putative ankyrin repeat protein RBE_0921	6.32e-04	NA	7.82e-05
3. B	A4D7T3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.62e-05	NA	0.002
3. B	Q8R516	E3 ubiquitin-protein ligase MIB2	1.02e-02	NA	5.87e-05
3. B	Q5ZXN6	Phosphocholine transferase AnkX	1.07e-03	NA	2.09e-04
3. B	Q13418	Integrin-linked protein kinase	1.27e-02	NA	2.19e-04
3. B	P83757	NF-kappa-B inhibitor cactus	NA	NA	0.006
3. B	Q9C0D5	Protein TANC1	2.80e-01	NA	7.80e-06
3. B	Q5UNU1	Putative ankyrin repeat protein L675	NA	NA	0.005
3. B	Q5BKI6	Ankyrin repeat domain-containing protein 1	1.49e-05	NA	1.14e-09
3. B	Q9Z1P7	KN motif and ankyrin repeat domain-containing protein 3	5.78e-04	NA	9.65e-07
3. B	Q9J516	Putative ankyrin repeat protein FPV219	NA	NA	5.47e-04
3. B	Q6ZQK5	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2	8.33e-03	NA	0.001
3. B	Q07DZ5	Cortactin-binding protein 2	8.66e-02	NA	5.95e-04
3. B	Q09YN0	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.64e-05	NA	3.54e-06
3. B	Q92527	Ankyrin repeat domain-containing protein 7	8.79e-07	NA	6.52e-55
3. B	Q02989	Alpha-latroinsectotoxin-Lt1a (Fragment)	6.64e-02	NA	3.80e-06
3. B	Q60J38	Ankyrin repeat and KH domain-containing protein CBG24701	8.37e-02	NA	4.07e-08
3. B	D3ZD05	KN motif and ankyrin repeat domain-containing protein 2	7.32e-03	NA	3.03e-04
3. B	Q8T2Q0	Putative ZDHHC-type palmitoyltransferase 6	1.02e-04	NA	1.19e-06
3. B	B2RXR6	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B	4.41e-02	NA	8.75e-14
3. B	Q502K3	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	1.48e-02	NA	4.14e-08
3. B	Q66H07	Fibronectin type 3 and ankyrin repeat domains 1 protein	1.24e-09	NA	2.58e-10
3. B	Q9C104	Glycerophosphocholine phosphodiesterase gde1	3.14e-02	NA	0.018
3. B	Q7M6U3	Inactive serine/threonine-protein kinase TEX14	1.14e-01	NA	0.011
3. B	Q20500	Intracellular phospholipase A2	1.50e-01	NA	3.48e-04
3. B	Q9FIT8	ADP-ribosylation factor GTPase-activating protein AGD1	3.51e-03	NA	0.027
3. B	Q5PQ89	Ankyrin repeat domain-containing protein 34B	1.31e-02	NA	5.14e-04
3. B	Q05753	Ankyrin repeat domain-containing protein, chloroplastic	8.10e-04	NA	1.35e-11
3. B	Q2QLB3	Cortactin-binding protein 2	1.31e-01	NA	7.55e-05
3. B	Q6UB99	Ankyrin repeat domain-containing protein 11	5.35e-01	NA	1.82e-04
3. B	O22265	Signal recognition particle 43 kDa protein, chloroplastic	2.37e-02	NA	3.51e-04
3. B	Q9JIA3	NF-kappa-B inhibitor beta	3.31e-04	NA	0.001
3. B	O55222	Integrin-linked protein kinase	1.59e-02	NA	2.35e-04
3. B	Q9J569	Putative ankyrin repeat protein FPV162	NA	NA	2.16e-07
3. B	Q3SX45	Ankyrin repeat and SOCS box protein 2	6.76e-04	NA	1.56e-06
3. B	Q08DV6	Ankyrin repeat and SOCS box protein 3	3.35e-03	NA	1.28e-05
3. B	Q9SAR5	Ankyrin repeat domain-containing protein 2A	1.92e-02	NA	0.005
3. B	Q76K24	Ankyrin repeat domain-containing protein 46	1.50e-03	NA	5.43e-07
3. B	Q4V8X4	Acyl-CoA-binding domain-containing protein 6	1.05e-02	NA	2.49e-05
3. B	Q04721	Neurogenic locus notch homolog protein 2	1.42e-01	NA	5.88e-06
3. B	Q09YI1	Cortactin-binding protein 2	9.24e-02	NA	6.10e-04
3. B	Q8N6D5	Ankyrin repeat domain-containing protein 29	4.78e-11	NA	6.60e-13
3. B	O15084	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A	3.10e-03	NA	3.23e-13
3. B	Q5NVB9	Palmitoyltransferase ZDHHC13	2.30e-03	NA	1.19e-07
3. B	P0DST0	Ankyrin repeat protein B4	NA	NA	0.010
3. B	Q9J4Z5	Putative ankyrin repeat protein FPV245	NA	NA	1.94e-07
3. B	Q8BTI7	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	3.16e-02	NA	3.29e-09
3. B	E5RJM6	Ankyrin repeat domain-containing protein 65	1.14e-06	NA	2.26e-06
3. B	Q6P9Z4	Protein fem-1 homolog A	3.17e-03	NA	5.19e-06
3. B	Q9GZV1	Ankyrin repeat domain-containing protein 2	1.97e-04	NA	1.39e-07
3. B	Q6GQX6	Ankyrin repeat and SAM domain-containing protein 6	1.41e-01	NA	1.21e-07
3. B	Q9QW30	Neurogenic locus notch homolog protein 2	6.05e-02	NA	5.69e-06
3. B	Q108U1	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	4.50e-05	NA	9.80e-06
3. B	Q86U10	60 kDa lysophospholipase	1.13e-02	NA	0.002
3. B	Q3SX00	Ankyrin repeat domain-containing protein 46	1.68e-03	NA	1.40e-07
3. B	Q2IBB1	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.92e-05	NA	6.59e-06
3. B	Q6IVG4	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2	1.01e-02	NA	4.04e-04
3. B	Q60649	Caseinolytic peptidase B protein homolog	1.67e-01	NA	0.017
3. B	Q9SM23	Acyl-CoA-binding domain-containing protein 1	1.03e-02	NA	1.28e-08
3. B	Q59H18	Serine/threonine-protein kinase TNNI3K	6.31e-03	NA	2.67e-08
3. B	Q8VHQ3	Protein phosphatase 1 regulatory inhibitor subunit 16B	4.10e-05	NA	5.99e-06
3. B	Q99PE2	Ankyrin repeat family A protein 2	6.07e-04	NA	4.21e-05
3. B	Q9BSK4	Protein fem-1 homolog A	8.01e-03	NA	1.95e-05
3. B	Q9H9B1	Histone-lysine N-methyltransferase EHMT1	9.38e-03	NA	2.38e-08
3. B	P42773	Cyclin-dependent kinase 4 inhibitor C	2.49e-07	NA	0.006
3. B	A0JNU3	60 kDa lysophospholipase	8.70e-03	NA	4.32e-04
3. B	Q28BK1	E3 ubiquitin-protein ligase HACE1	1.49e-02	NA	1.97e-10
3. B	Q8IYA2	Putative coiled-coil domain-containing protein 144C	1.45e-04	NA	2.72e-74
3. B	D4A615	Tonsoku-like protein	1.54e-02	NA	0.005
3. B	Q9J5I7	Putative ankyrin repeat protein FPV014	NA	NA	9.92e-05
3. B	H3BUK9	POTE ankyrin domain family member B2	2.02e-08	NA	4.66e-89
3. B	Q9DAM9	Fibronectin type 3 and ankyrin repeat domains 1 protein	1.45e-09	NA	3.50e-10
3. B	Q1RJR4	Putative ankyrin repeat protein RBE_0319	6.04e-04	NA	0.010
3. B	O60733	85/88 kDa calcium-independent phospholipase A2	3.32e-02	NA	2.39e-11
3. B	Q810B6	Rabankyrin-5	1.68e-02	NA	1.16e-09
3. B	Q9ERK0	Receptor-interacting serine/threonine-protein kinase 4	1.24e-04	NA	1.83e-09
3. B	Q9J517	Putative ankyrin repeat protein FPV218	NA	NA	6.11e-09
3. B	Q96IX9	Putative ankyrin repeat domain-containing protein 26-like 1	4.97e-04	NA	1.96e-29
3. B	Q12955	Ankyrin-3	NA	NA	3.20e-12
3. B	Q8VHS5	Ankyrin repeat and SOCS box protein 16	3.31e-03	NA	1.10e-04
3. B	Q09YJ3	Cortactin-binding protein 2	2.31e-02	NA	6.93e-04
3. B	Q6TNT2	Ankyrin repeat domain-containing protein 46	1.86e-03	NA	1.01e-07
3. B	Q8C0T1	Protein fem-1 homolog A-B	2.68e-03	NA	2.81e-05
3. B	A2RUV0	Neurogenic locus notch homolog protein 1	8.54e-02	NA	1.09e-07
3. B	Q38998	Potassium channel AKT1	2.68e-02	NA	6.70e-06
3. B	Q80TN5	Palmitoyltransferase ZDHHC17	8.67e-07	NA	3.83e-05
3. B	C9JTQ0	Ankyrin repeat domain-containing protein 63	1.08e-03	NA	0.017
3. B	P20749	B-cell lymphoma 3 protein	4.21e-05	NA	1.21e-11
3. B	Q7S3M5	Palmitoyltransferase akr1	5.11e-04	NA	4.36e-07
3. B	Q7Z6G8	Ankyrin repeat and sterile alpha motif domain-containing protein 1B	5.47e-03	NA	3.37e-08
3. B	Q5R5V4	Integrin-linked protein kinase	1.17e-02	NA	2.29e-04
3. B	Q4UKX2	Putative ankyrin repeat protein RF_0950	1.97e-03	NA	1.30e-07
3. B	O75832	26S proteasome non-ATPase regulatory subunit 10	1.85e-12	NA	1.30e-10
3. B	P62775	Myotrophin	2.31e-06	NA	0.033
3. B	Q5UPP7	Putative ankyrin repeat protein R760	NA	NA	0.037
3. B	Q2IBB4	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.39e-05	NA	1.18e-06
3. B	P31695	Neurogenic locus notch homolog protein 4	2.77e-01	NA	4.53e-07
3. B	Q8GXE6	Potassium channel AKT6	2.18e-02	NA	5.96e-11
3. B	A0A140LI88	Ankyrin repeat domain-containing protein 31	3.42e-01	NA	1.02e-05
3. B	Q09YK4	Cortactin-binding protein 2	1.16e-02	NA	1.17e-04
3. B	Q8C8R3	Ankyrin-2	NA	NA	2.30e-13
3. B	E1C656	E3 ubiquitin-protein ligase HACE1	1.82e-02	NA	7.64e-11
3. B	Q6F6B3	Protein TANC1	4.09e-02	NA	2.42e-05
3. B	P17369	Ankyrin repeat protein 14	NA	NA	0.010
3. B	Q86W74	Ankyrin repeat domain-containing protein 46	1.58e-03	NA	1.40e-07
3. B	Q8N8V4	Ankyrin repeat and SAM domain-containing protein 4B	2.08e-03	NA	2.90e-06
3. B	Q07DY6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	8.44e-05	NA	3.16e-06
3. B	Q7T3Y0	Notch-regulated ankyrin repeat-containing protein A	1.92e-04	NA	0.028
3. B	P40480	Protein HOS4	3.78e-03	NA	2.29e-05
3. B	Q9Y574	Ankyrin repeat and SOCS box protein 4	1.58e-04	NA	7.64e-04
3. B	Q9H9E1	Ankyrin repeat family A protein 2	4.57e-05	NA	1.93e-05
3. B	Q6NXT1	Ankyrin repeat domain-containing protein 54	4.02e-03	NA	8.08e-08
3. B	Q8BIZ1	Ankyrin repeat and sterile alpha motif domain-containing protein 1B	2.41e-03	NA	5.03e-08
3. B	Q5T7N3	KN motif and ankyrin repeat domain-containing protein 4	7.26e-01	NA	1.14e-07
3. B	Q9QZH2	BRCA1-associated RING domain protein 1	1.30e-01	NA	2.04e-06
3. B	Q92HB1	Putative ankyrin repeat protein RC0860	4.69e-02	NA	0.009
3. B	Q6AWW5	Ankyrin repeat-containing protein At5g02620	5.72e-07	NA	0.013
3. B	Q7ZT11	Ankyrin repeat domain-containing protein 1	1.16e-05	NA	8.85e-12
3. B	Q07E43	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.66e-05	NA	4.41e-04
3. B	Q8TC84	Fibronectin type 3 and ankyrin repeat domains protein 1	1.01e-09	NA	1.04e-07
3. B	Q91ZA8	Notch-regulated ankyrin repeat-containing protein	1.05e-03	NA	0.005
3. B	Q96P50	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3	9.06e-03	NA	0.026
3. B	Q9J503	Putative ankyrin repeat protein FPV232	NA	NA	2.06e-06
3. B	Q99728	BRCA1-associated RING domain protein 1	1.24e-01	NA	1.01e-04
3. B	P97570	85/88 kDa calcium-independent phospholipase A2	1.93e-03	NA	4.06e-09
3. B	Q6S8J7	POTE ankyrin domain family member A	3.64e-06	NA	5.48e-124
3. B	Q07008	Neurogenic locus notch homolog protein 1	1.69e-01	NA	1.07e-08
3. B	Q3UMR0	Ankyrin repeat domain-containing protein 27	7.40e-03	NA	1.64e-06
3. B	A3AYR1	Acyl-CoA-binding domain-containing protein 4	1.84e-03	NA	1.16e-05
3. B	Q3T0F7	Myotrophin	2.14e-06	NA	0.032
3. B	Q07DY4	Cortactin-binding protein 2	3.87e-02	NA	7.88e-04
3. B	Q9HCD6	Protein TANC2	3.20e-02	NA	2.80e-06
3. B	A1X157	Cortactin-binding protein 2	1.62e-01	NA	0.003
3. B	Q9D3J5	Ankyrin repeat domain-containing protein 22	9.07e-08	NA	0.003
3. B	Q6S545	POTE ankyrin domain family member H	4.70e-06	NA	1.49e-87
3. B	Q9Z148	Histone-lysine N-methyltransferase EHMT2	1.16e-02	NA	1.02e-06
3. B	Q1RK13	Putative ankyrin repeat protein RBE_0220	5.63e-04	NA	1.15e-12
3. B	Q54XX5	Probable serine/threonine-protein kinase DDB_G0278535	2.66e-03	NA	1.22e-09
3. B	Q5UPF8	Putative ankyrin repeat protein L88	NA	NA	1.78e-07
3. B	P18954	Protein PhlB	7.60e-05	NA	9.81e-06
3. B	Q99J82	Integrin-linked protein kinase	1.51e-02	NA	2.35e-04
3. B	Q2QLF8	Cortactin-binding protein 2	1.07e-01	NA	4.66e-05
3. B	Q2IBF7	Cortactin-binding protein 2	6.24e-02	NA	2.14e-04
3. B	Q1RK83	Putative ankyrin repeat protein RBE_0150	2.74e-05	NA	0.005
3. B	Q71S22	Inversin-A	2.29e-02	NA	3.08e-09
3. B	Q8TAK5	GA-binding protein subunit beta-2	1.19e-04	NA	0.025
3. B	A0M8T3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.45e-05	NA	7.50e-06
3. B	Q4UMH6	Putative ankyrin repeat protein RF_0381	1.72e-05	NA	2.62e-13
3. B	P53355	Death-associated protein kinase 1	4.69e-04	NA	5.90e-13
3. B	Q804S5	E3 ubiquitin-protein ligase mib1	7.83e-03	NA	1.81e-08
3. B	Q8IYU2	E3 ubiquitin-protein ligase HACE1	1.41e-02	NA	2.24e-11
3. B	Q875S9	Palmitoyltransferase AKR1	1.17e-02	NA	9.95e-11
3. B	A8MXQ7	IQ motif and ankyrin repeat domain-containing protein 1	1.20e-02	NA	0.003
3. B	P0CS66	Palmitoyltransferase AKR1	1.52e-05	NA	3.84e-05
3. B	Q9HLN1	Putative ankyrin repeat protein Ta0196	3.34e-08	NA	2.77e-07
3. B	Q6B858	Fibronectin type 3 and ankyrin repeat domains protein 1	4.87e-10	NA	1.22e-08
3. B	Q8NB46	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	4.89e-04	NA	1.23e-09
3. B	P21001	Ankyrin repeat protein B4	NA	NA	0.014
3. B	Q0VCS9	Ankyrin repeat and MYND domain-containing protein 2	7.66e-03	NA	0.034
3. B	P25963	NF-kappa-B inhibitor alpha	7.79e-06	NA	3.97e-04
3. B	Q5REW9	Ankyrin repeat domain-containing protein 27	3.51e-03	NA	7.99e-06
3. B	Q863Z4	Myotrophin	2.28e-06	NA	0.032
3. B	Q6JAN1	Inversin	4.32e-03	NA	1.07e-07
3. B	G3V8T1	M-phase phosphoprotein 8	1.32e-02	NA	4.58e-05
3. B	Q5RJK8	Acyl-CoA-binding domain-containing protein 6	2.09e-03	NA	4.94e-04
3. B	D3ZBM7	E3 ubiquitin-protein ligase HACE1	1.63e-02	NA	5.03e-11
3. B	Q9J5G9	Putative ankyrin repeat protein FPV034	NA	NA	4.97e-07
3. B	Q2QLA4	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.28e-05	NA	1.84e-05
3. B	P23631	Alpha-latrotoxin-Lt1a	1.50e-01	NA	4.79e-07
3. B	Q5U5A6	Notch-regulated ankyrin repeat-containing protein	2.33e-04	NA	0.005
3. B	P39010	Palmitoyltransferase AKR1	2.89e-03	NA	1.95e-08
3. B	Q8WXD9	Caskin-1	7.68e-03	NA	1.78e-06
3. B	Q8R560	Ankyrin repeat domain-containing protein 1	1.65e-05	NA	1.08e-09
3. B	Q60778	NF-kappa-B inhibitor beta	6.70e-05	NA	0.007
3. B	Q9FY48	E3 ubiquitin-protein ligase KEG	1.14e-02	NA	0.003
3. B	Q8WZ74	Cortactin-binding protein 2	1.37e-01	NA	2.35e-04
3. B	Q3EC11	Probable protein S-acyltransferase 23	5.07e-05	NA	1.56e-04
3. B	Q5B0V6	Palmitoyltransferase akr1	1.74e-03	NA	3.33e-07
3. B	Q8BLD6	Ankyrin repeat domain-containing protein 55	1.19e-04	NA	3.53e-05
3. B	Q6DRG7	Protein phosphatase 1 regulatory subunit 12A	4.84e-03	NA	4.96e-04
3. B	Q9VBP3	Poly [ADP-ribose] polymerase tankyrase	2.78e-02	NA	4.70e-07
3. B	Q6DCL5	E3 ubiquitin-protein ligase HACE1	7.09e-03	NA	2.04e-10
3. B	Q9BR61	Acyl-CoA-binding domain-containing protein 6	2.45e-03	NA	2.21e-04
3. B	Q2QL82	Cortactin-binding protein 2	1.22e-01	NA	1.07e-04
3. B	Q96NW4	Ankyrin repeat domain-containing protein 27	2.39e-03	NA	2.23e-06
3. B	A7E2S9	Putative ankyrin repeat domain-containing protein 30B-like	2.29e-05	NA	1.32e-50
3. B	Q8VE42	Ankyrin repeat domain-containing protein 49	2.31e-03	NA	2.32e-05