Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
F1QEG2
(Kelch-like protein 41b) with a FATCAT P-Value: 0.0 and RMSD of 3.15 angstrom. The sequence alignment identity is 22.7%.
Structural alignment shown in left. Query protein A6NCF5 colored as red in alignment, homolog F1QEG2 colored as blue.
Query protein A6NCF5 is also shown in right top, homolog F1QEG2 showed in right bottom. They are colored based on secondary structures.
A6NCF5 -----------------------------------------------------------MLLS--GMRESQGTEVSLRTISTQDLRLLVSFAYSGVVRAR 39 F1QEG2 MDPKAIKEELRLFQSTLLQDGLKELLNENKFVDCTLKIGDRCFPCHRLIMAACSPYFRELFFSEDGKEKDIGKEVVLDDVDPNIMDMILQYLYSAEI--- 97 A6NCF5 WPGLL-RAAQA--AL--QYQSSSCLDLCQKGLARGLSPARCLALFPMAEAPGL----ERLWSKARHYLLTHLPAVALCPAFPSL-PAACLAELLDSDELH 129 F1QEG2 --DLVDDNVQEIFAVANRFQIPSVFTVCVNYLQQKLSMANCLAVFRL----GLVLSVPRLAIAARDFIADRFETVSSEEEFLQLAPHELLA-LIGGDMLN 190 A6NCF5 VQEE---FEAFVAARCWLAANPETQESEAKALLR---CVRFGRM----STRELRRVRAAGLLPPLTPDLLHQLMVEAD-----VP-------------GQ 201 F1QEG2 VEKEEVVFESVMK---WV-RND--KANRVKSLAEAFDCIRF-RLLPEKYFRE--KVETDDIIKG-DPELLKKLQLVKDAFKGKLPEKKPKEKKEGEVNGE 280 A6NCF5 ERRRE--P----D-RALVVIGGDGLRPDMALR-QPSRAVWW-ARAFRCGVGLVRTVEWGQLPALPAPGRFRHGAASLA--GSELYVCGG--QDFYSHSNT 288 F1QEG2 EEGEEMLPGFLNDNRRL---GMYG-R-DLIVMINDTAAVAYDVVENEC--FLAAMAE--QVPK-------NH--VSLCTKKNQLFIVGGLFVDEESKESP 362 A6NCF5 L-ASTLRWEPSQEDWEEMAPLSQARSLFSLVALDGKLYALGGRH---NDVALDSVETYNPELNVWRPAPALPAPCFAHAAAIL-EGQL-YVSGGC-GG-T 380 F1QEG2 LQCYFYQLDSFSSDWRALPPMPSPRCLFNLGESENLLFAIAGKDLQTNE-SLDSVMCFDTERMKWSETKKL--PLHIHGHSVVSHNNLVY----CIGGKT 455 A6NCF5 --GQYLASLMHYDPKLEKPGTFLSPMGVPRA--GHVMAALGGRLYVAGGLGETED-L--LSFEAYELRTDSW-THLA-PLPSPHVGAASAVLQGELLVLG 471 F1QEG2 DDNKALSKMFVYNHK-QSEWRELASMKTPRAMFGAVVHK--GKIIVTGGV--NEDGLTALS-ETYDFDTNKWDTFTEFPQERSSVNLVSS--GGNLFSIG 547 A6NCF5 GYS-----HRTYALSHL--IHAY------CPG-LG--RWL----CLGTLPRPR-AEMPACILTLPAVQHIALVPTPHQTKPAG 533 F1QEG2 GFAIVELEDKNIGPSEITDIWQYEEDKKTWSGMLREMRYASGSSCVGM--RLNAARMPK--L--------------------- 605
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0045604 | regulation of epidermal cell differentiation |
| 1. PB | GO:0016055 | Wnt signaling pathway |
| 1. PB | GO:0071466 | cellular response to xenobiotic stimulus |
| 1. PB | GO:0032886 | regulation of microtubule-based process |
| 1. PB | GO:0007094 | mitotic spindle assembly checkpoint signaling |
| 1. PB | GO:0048873 | homeostasis of number of cells within a tissue |
| 1. PB | GO:0045886 | negative regulation of synaptic assembly at neuromuscular junction |
| 1. PB | GO:0042994 | cytoplasmic sequestering of transcription factor |
| 1. PB | GO:0072156 | distal tubule morphogenesis |
| 1. PB | GO:0031398 | positive regulation of protein ubiquitination |
| 1. PB | GO:0031463 | Cul3-RING ubiquitin ligase complex |
| 1. PB | GO:0006511 | ubiquitin-dependent protein catabolic process |
| 1. PB | GO:0071353 | cellular response to interleukin-4 |
| 1. PB | GO:0035020 | regulation of Rac protein signal transduction |
| 1. PB | GO:0001887 | selenium compound metabolic process |
| 1. PB | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process |
| 1. PB | GO:0030424 | axon |
| 1. PB | GO:0034451 | centriolar satellite |
| 1. PB | GO:0045109 | intermediate filament organization |
| 1. PB | GO:0001701 | in utero embryonic development |
| 1. PB | GO:0045171 | intercellular bridge |
| 1. PB | GO:0016567 | protein ubiquitination |
| 1. PB | GO:0031430 | M band |
| 1. PB | GO:0070294 | renal sodium ion absorption |
| 1. PB | GO:0032435 | negative regulation of proteasomal ubiquitin-dependent protein catabolic process |
| 1. PB | GO:0031672 | A band |
| 1. PB | GO:0014032 | neural crest cell development |
| 1. PB | GO:0045214 | sarcomere organization |
| 1. PB | GO:0004842 | ubiquitin-protein transferase activity |
| 1. PB | GO:0006888 | endoplasmic reticulum to Golgi vesicle-mediated transport |
| 1. PB | GO:0014029 | neural crest formation |
| 1. PB | GO:0031275 | obsolete regulation of lateral pseudopodium assembly |
| 1. PB | GO:0071233 | cellular response to leucine |
| 1. PB | GO:0002467 | germinal center formation |
| 1. PB | GO:0043066 | negative regulation of apoptotic process |
| 1. PB | GO:0001726 | ruffle |
| 1. PB | GO:0006513 | protein monoubiquitination |
| 1. PB | GO:0032465 | regulation of cytokinesis |
| 1. PB | GO:0051301 | cell division |
| 1. PB | GO:0032839 | dendrite cytoplasm |
| 1. PB | GO:0007420 | brain development |
| 1. PB | GO:0005884 | actin filament |
| 1. PB | GO:2000291 | regulation of myoblast proliferation |
| 1. PB | GO:0010507 | negative regulation of autophagy |
| 1. PB | GO:0030036 | actin cytoskeleton organization |
| 1. PB | GO:0039648 | modulation by virus of host protein ubiquitination |
| 1. PB | GO:0016605 | PML body |
| 1. PB | GO:0030057 | desmosome |
| 1. PB | GO:0019964 | interferon-gamma binding |
| 1. PB | GO:0005802 | trans-Golgi network |
| 1. PB | GO:0043025 | neuronal cell body |
| 1. PB | GO:2001014 | regulation of skeletal muscle cell differentiation |
| 1. PB | GO:0016235 | aggresome |
| 1. PB | GO:0048808 | male genitalia morphogenesis |
| 1. PB | GO:0005886 | plasma membrane |
| 1. PB | GO:0071322 | cellular response to carbohydrate stimulus |
| 1. PB | GO:0010506 | regulation of autophagy |
| 1. PB | GO:0097718 | disordered domain specific binding |
| 1. PB | GO:0050801 | ion homeostasis |
| 1. PB | GO:1904263 | positive regulation of TORC1 signaling |
| 1. PB | GO:0071630 | nuclear protein quality control by the ubiquitin-proteasome system |
| 1. PB | GO:0005856 | cytoskeleton |
| 1. PB | GO:0039649 | modulation by virus of host ubiquitin-protein ligase activity |
| 1. PB | GO:0034599 | cellular response to oxidative stress |
| 1. PB | GO:0097602 | cullin family protein binding |
| 1. PB | GO:0035914 | skeletal muscle cell differentiation |
| 1. PB | GO:0005912 | adherens junction |
| 1. PB | GO:0098528 | skeletal muscle fiber differentiation |
| 1. PB | GO:1990390 | protein K33-linked ubiquitination |
| 1. PB | GO:0006446 | regulation of translational initiation |
| 1. PB | GO:0016234 | inclusion body |
| 1. PB | GO:2001243 | negative regulation of intrinsic apoptotic signaling pathway |
| 1. PB | GO:0014728 | regulation of the force of skeletal muscle contraction |
| 1. PB | GO:0030239 | myofibril assembly |
| 1. PB | GO:0030430 | host cell cytoplasm |
| 1. PB | GO:0015629 | actin cytoskeleton |
| 1. PB | GO:0061061 | muscle structure development |
| 1. PB | GO:0031674 | I band |
| 1. PB | GO:0005819 | spindle |
| 1. PB | GO:0005764 | lysosome |
| 1. PB | GO:0048741 | skeletal muscle fiber development |
| 1. PB | GO:0051865 | protein autoubiquitination |
| 1. PB | GO:0048208 | COPII vesicle coating |
| 1. PB | GO:0072686 | mitotic spindle |
| 1. PB | GO:0031397 | negative regulation of protein ubiquitination |
| 1. PB | GO:0030134 | COPII-coated ER to Golgi transport vesicle |
| 1. PB | GO:0060028 | convergent extension involved in axis elongation |
| 1. PB | GO:0033150 | cytoskeletal calyx |
| 1. PB | GO:0030496 | midbody |
| 1. PB | GO:0009968 | negative regulation of signal transduction |
| 1. PB | GO:0031208 | POZ domain binding |
| 1. PB | GO:0005634 | nucleus |
| 1. PB | GO:1901992 | positive regulation of mitotic cell cycle phase transition |
| 1. PB | GO:0005827 | polar microtubule |
| 1. PB | GO:0046329 | negative regulation of JNK cascade |
| 1. PB | GO:0006895 | Golgi to endosome transport |
| 1. PB | GO:0007049 | cell cycle |
| 1. PB | GO:0007010 | cytoskeleton organization |
| 1. PB | GO:0000070 | mitotic sister chromatid segregation |
| 1. PB | GO:0045661 | regulation of myoblast differentiation |
| 1. PB | GO:0042803 | protein homodimerization activity |
| 1. PB | GO:0061912 | selective autophagy |
| 1. PB | GO:0048471 | perinuclear region of cytoplasm |
| 1. PB | GO:0035853 | chromosome passenger complex localization to spindle midzone |
| 1. PB | GO:0036268 | swimming |
| 1. PB | GO:0051015 | actin filament binding |
| 1. PB | GO:0060090 | molecular adaptor activity |
| 1. PB | GO:0030127 | COPII vesicle coat |
| 1. PB | GO:2000312 | regulation of kainate selective glutamate receptor activity |
| 1. PB | GO:0070936 | protein K48-linked ubiquitination |
| 1. PB | GO:0007286 | spermatid development |
| 1. PB | GO:0031143 | pseudopodium |
| 1. PB | GO:0033017 | sarcoplasmic reticulum membrane |
| 1. PB | GO:0005829 | cytosol |
| 1. PB | GO:0009566 | fertilization |
| 1. PB | GO:0047485 | protein N-terminus binding |
| 1. PB | GO:0071889 | 14-3-3 protein binding |
| 1. PB | GO:0003779 | actin binding |
| 1. PB | GO:0001933 | negative regulation of protein phosphorylation |
| 1. PB | GO:0071379 | cellular response to prostaglandin stimulus |
| 1. PB | GO:2000042 | negative regulation of double-strand break repair via homologous recombination |
| 1. PB | GO:0090076 | relaxation of skeletal muscle |
| 1. PB | GO:0032436 | positive regulation of proteasomal ubiquitin-dependent protein catabolic process |
| 1. PB | GO:0030307 | positive regulation of cell growth |
| 1. PB | GO:0042802 | identical protein binding |
| 1. PB | GO:0008584 | male gonad development |
| 1. PB | GO:0005654 | nucleoplasm |
| 2. P | GO:0120197 | mucociliary clearance |
| 2. P | GO:1904672 | regulation of somatic stem cell population maintenance |
| 2. P | GO:0035455 | response to interferon-alpha |
| 2. P | GO:0097066 | response to thyroid hormone |
| 2. P | GO:0000398 | mRNA splicing, via spliceosome |
| 2. P | GO:0043966 | histone H3 acetylation |
| 2. P | GO:0010499 | proteasomal ubiquitin-independent protein catabolic process |
| 2. P | GO:0008380 | RNA splicing |
| 2. P | GO:1990716 | axonemal central apparatus |
| 2. P | GO:0007638 | mechanosensory behavior |
| 2. P | GO:0071230 | cellular response to amino acid stimulus |
| 2. P | GO:0071005 | U2-type precatalytic spliceosome |
| 2. P | GO:0005813 | centrosome |
| 2. P | GO:0036464 | cytoplasmic ribonucleoprotein granule |
| 2. P | GO:0014069 | postsynaptic density |
| 2. P | GO:0016607 | nuclear speck |
| 2. P | GO:0071011 | precatalytic spliceosome |
| 2. P | GO:0050853 | B cell receptor signaling pathway |
| 2. P | GO:0030914 | |
| 2. P | GO:0048644 | muscle organ morphogenesis |
| 2. P | GO:0000381 | regulation of alternative mRNA splicing, via spliceosome |
| 2. P | GO:0033276 | transcription factor TFTC complex |
| 3. B | GO:0009881 | photoreceptor activity |
| 3. B | GO:0030326 | embryonic limb morphogenesis |
| 3. B | GO:0042074 | cell migration involved in gastrulation |
| 3. B | GO:1990752 | microtubule end |
| 3. B | GO:1902410 | mitotic cytokinetic process |
| 3. B | GO:0009888 | tissue development |
| 3. B | GO:0051285 | cell cortex of cell tip |
| 3. B | GO:0007300 | ovarian nurse cell to oocyte transport |
| 3. B | GO:0019762 | glucosinolate catabolic process |
| 3. B | GO:2001007 | negative regulation of cellulose biosynthetic process |
| 3. B | GO:0007301 | female germline ring canal formation |
| 3. B | GO:0030723 | ovarian fusome organization |
| 3. B | GO:0071907 | determination of digestive tract left/right asymmetry |
| 3. B | GO:0102522 | tRNA 4-demethylwyosine alpha-amino-alpha-carboxypropyltransferase activity |
| 3. B | GO:0009753 | response to jasmonic acid |
| 3. B | GO:0030234 | enzyme regulator activity |
| 3. B | GO:0005975 | carbohydrate metabolic process |
| 3. B | GO:0140627 | ubiquitin-dependent protein catabolic process via the C-end degron rule pathway |
| 3. B | GO:0060627 | regulation of vesicle-mediated transport |
| 3. B | GO:1990896 | protein localization to cell cortex of cell tip |
| 3. B | GO:0048704 | embryonic skeletal system morphogenesis |
| 3. B | GO:0009887 | animal organ morphogenesis |
| 3. B | GO:0010017 | red or far-red light signaling pathway |
| 3. B | GO:0000935 | division septum |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:0031466 | Cul5-RING ubiquitin ligase complex |
| 3. B | GO:0007297 | ovarian follicle cell migration |
| 3. B | GO:0048842 | positive regulation of axon extension involved in axon guidance |
| 3. B | GO:0019005 | SCF ubiquitin ligase complex |
| 3. B | GO:0099070 | static microtubule bundle |
| 3. B | GO:0035183 | female germline ring canal inner rim |
| 3. B | GO:0060972 | left/right pattern formation |
| 3. B | GO:0080028 | nitrile biosynthetic process |
| 3. B | GO:0045879 | negative regulation of smoothened signaling pathway |
| 3. B | GO:0055038 | recycling endosome membrane |
| 3. B | GO:0140014 | mitotic nuclear division |
| 3. B | GO:0070875 | positive regulation of glycogen metabolic process |
| 3. B | GO:0060976 | coronary vasculature development |
| 3. B | GO:0045172 | germline ring canal |
| 3. B | GO:0042597 | periplasmic space |
| 3. B | GO:0098813 | nuclear chromosome segregation |
| 3. B | GO:0031462 | Cul2-RING ubiquitin ligase complex |
| 3. B | GO:0021680 | cerebellar Purkinje cell layer development |
| 3. B | GO:0044665 | MLL1/2 complex |
| 3. B | GO:0009637 | response to blue light |
| 3. B | GO:0016358 | dendrite development |
| 3. B | GO:0007623 | circadian rhythm |
| 3. B | GO:1990615 | Kelch-containing formin regulatory complex |
| 3. B | GO:0016857 | racemase and epimerase activity, acting on carbohydrates and derivatives |
| 3. B | GO:0035324 | female germline ring canal |
| 3. B | GO:1904511 | cytoplasmic microtubule plus-end |
| 3. B | GO:0000755 | cytogamy |
| 3. B | GO:0035108 | limb morphogenesis |
| 3. B | GO:0030425 | dendrite |
| 3. B | GO:0035839 | non-growing cell tip |
| 3. B | GO:0090337 | regulation of formin-nucleated actin cable assembly |
| 3. B | GO:1990756 | ubiquitin ligase-substrate adaptor activity |
| 3. B | GO:0035840 | old growing cell tip |
| 3. B | GO:0060971 | embryonic heart tube left/right pattern formation |
| 3. B | GO:0097094 | craniofacial suture morphogenesis |
| 3. B | GO:0001100 | negative regulation of exit from mitosis |
| 3. B | GO:0003143 | embryonic heart tube morphogenesis |
| 3. B | GO:0005794 | Golgi apparatus |
| 3. B | GO:0061246 | establishment or maintenance of bipolar cell polarity regulating cell shape |
| 3. B | GO:0016021 | integral component of membrane |
| 3. B | GO:0061371 | determination of heart left/right asymmetry |
| 3. B | GO:0015630 | microtubule cytoskeleton |
| 3. B | GO:0097155 | fasciculation of sensory neuron axon |
| 3. B | GO:0046872 | metal ion binding |
| 3. B | GO:0000062 | fatty-acyl-CoA binding |
| 3. B | GO:0055113 | epiboly involved in gastrulation with mouth forming second |
| 3. B | GO:0005934 | cellular bud tip |
| 3. B | GO:0032874 | positive regulation of stress-activated MAPK cascade |
| 3. B | GO:0010114 | response to red light |
| 3. B | GO:0007628 | adult walking behavior |
| 3. B | GO:0046580 | negative regulation of Ras protein signal transduction |
| 3. B | GO:0110070 | cellularization cleavage furrow |
| 3. B | GO:2000762 | regulation of phenylpropanoid metabolic process |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | E9QIN8 | Kelch-like protein 41a | 5.44e-15 | 1.71e-24 | 3.22e-22 |
| 1. PB | Q9Y2M5 | Kelch-like protein 20 | 0.00e+00 | 2.28e-11 | 2.37e-41 |
| 1. PB | Q5REP9 | Kelch-like protein 3 | 0.00e+00 | 1.09e-15 | 5.11e-30 |
| 1. PB | A0A1B8YAB1 | Kelch repeat and BTB domain-containing protein 8 | 0.00e+00 | 2.09e-18 | 3.57e-27 |
| 1. PB | Q9JFG1 | Kelch repeat protein C2 | NA | 2.77e-28 | 1.93e-14 |
| 1. PB | Q8JZP3 | Kelch-like protein 2 | 0.00e+00 | 8.50e-16 | 2.18e-28 |
| 1. PB | A6NCF5 | Kelch-like protein 33 | 0 | 1.23e-133 | 0.0 |
| 1. PB | Q1LYM6 | Kelch-like protein 38 | 0.00e+00 | 1.32e-25 | 1.35e-20 |
| 1. PB | Q16RL8 | Kelch-like protein diablo | 0.00e+00 | 4.33e-21 | 3.75e-40 |
| 1. PB | Q9CZ49 | Kelch-like protein 35 | 0.00e+00 | 5.36e-24 | 1.70e-19 |
| 1. PB | B3DIV9 | Kelch-like protein 40a | 7.77e-16 | 1.31e-23 | 5.86e-29 |
| 1. PB | P21037 | Kelch repeat protein C2 | NA | 3.51e-28 | 6.04e-15 |
| 1. PB | A2AUC9 | Kelch-like protein 41 | 0.00e+00 | 5.46e-24 | 2.64e-28 |
| 1. PB | Q8BNW9 | Kelch repeat and BTB domain-containing protein 11 | 5.67e-11 | 1.15e-10 | 2.45e-11 |
| 1. PB | Q6TFL4 | Kelch-like protein 24 | 0.00e+00 | 2.93e-14 | 1.70e-24 |
| 1. PB | Q8BFQ9 | Kelch-like protein 42 | 2.03e-10 | 7.52e-27 | 2.91e-16 |
| 1. PB | Q9NVX7 | Kelch repeat and BTB domain-containing protein 4 | 1.41e-12 | 2.23e-14 | 1.44e-15 |
| 1. PB | A2AAX3 | Kelch-like protein 15 | 0.00e+00 | 6.88e-32 | 2.54e-27 |
| 1. PB | P32228 | Protein C4 | NA | 2.01e-29 | 2.61e-07 |
| 1. PB | Q14145 | Kelch-like ECH-associated protein 1 | 0.00e+00 | 9.91e-11 | 3.93e-45 |
| 1. PB | Q5ZLD3 | Kelch-like protein 13 | 0.00e+00 | 5.76e-17 | 1.75e-58 |
| 1. PB | P32206 | Protein C13 | NA | 1.14e-19 | 7.91e-08 |
| 1. PB | Q5RGB8 | Kelch-like protein 26 | 0.00e+00 | 7.27e-19 | 2.19e-45 |
| 1. PB | Q8BWA5 | Kelch-like protein 31 | 0.00e+00 | 3.40e-19 | 1.53e-52 |
| 1. PB | F1MBP6 | Kelch-like protein 3 | 0.00e+00 | 1.26e-15 | 6.99e-32 |
| 1. PB | Q684M4 | Kelch-like ECH-associated protein 1 | 0.00e+00 | 1.04e-09 | 3.30e-46 |
| 1. PB | Q5ZKD9 | Kelch-like protein 20 | 0.00e+00 | 6.67e-12 | 3.65e-41 |
| 1. PB | Q7QGL0 | Kelch-like protein diablo | 0.00e+00 | 5.46e-19 | 1.78e-38 |
| 1. PB | B3NDN0 | Kelch-like protein diablo | 0.00e+00 | 1.21e-10 | 5.35e-39 |
| 1. PB | O94819 | Kelch repeat and BTB domain-containing protein 11 | 2.85e-11 | 1.63e-07 | 6.48e-12 |
| 1. PB | Q8IY47 | Kelch repeat and BTB domain-containing protein 2 | 4.33e-15 | 4.32e-32 | 2.22e-21 |
| 1. PB | Q3ZB90 | Kelch repeat and BTB domain-containing protein 12 | 0.00e+00 | 3.43e-33 | 6.59e-17 |
| 1. PB | D3ZZC3 | Kelch-like protein 22 | 1.89e-15 | 2.61e-29 | 3.56e-37 |
| 1. PB | Q3UQV5 | Kelch repeat and BTB domain-containing protein 8 | 0.00e+00 | 4.96e-18 | 2.90e-25 |
| 1. PB | Q8IXQ5 | Kelch-like protein 7 | 0.00e+00 | 7.47e-21 | 5.10e-26 |
| 1. PB | Q9UH77 | Kelch-like protein 3 | 0.00e+00 | 3.30e-16 | 6.82e-31 |
| 1. PB | E9Q4F2 | Kelch-like protein 18 | 0.00e+00 | 1.89e-22 | 2.49e-35 |
| 1. PB | Q3U410 | Kelch-like protein 21 | 0.00e+00 | 1.07e-18 | 1.72e-25 |
| 1. PB | Q6JEL2 | Kelch-like protein 10 | 0.00e+00 | 5.01e-25 | 7.68e-33 |
| 1. PB | O35709 | Ectoderm-neural cortex protein 1 | 1.11e-16 | 1.06e-22 | 3.36e-23 |
| 1. PB | Q8BUL5 | Kelch-like protein 7 | 0.00e+00 | 4.18e-21 | 3.03e-25 |
| 1. PB | Q6Q7X9 | Kelch-like protein 31 | 0.00e+00 | 1.27e-17 | 3.88e-48 |
| 1. PB | Q2M0J9 | Kelch-like protein diablo | 0.00e+00 | 2.87e-10 | 4.15e-39 |
| 1. PB | Q8QQ16 | Kelch repeat and BTB domain-containing protein 1 | NA | 1.81e-32 | 9.55e-20 |
| 1. PB | Q8N4N3 | Kelch-like protein 36 | 0.00e+00 | 4.79e-27 | 3.43e-44 |
| 1. PB | Q5U374 | Kelch-like protein 12 | 0.00e+00 | 7.18e-25 | 1.59e-32 |
| 1. PB | Q9H2C0 | Gigaxonin | 0.00e+00 | 1.14e-32 | 1.06e-29 |
| 1. PB | Q10579 | Spermatocyte protein spe-26 | 0.00e+00 | 3.60e-30 | 1.44e-14 |
| 1. PB | Q3B7M1 | Kelch-like protein 36 | 0.00e+00 | 3.20e-29 | 5.91e-44 |
| 1. PB | Q28068 | Calicin | 0.00e+00 | 3.04e-21 | 2.44e-05 |
| 1. PB | Q5U575 | Kelch-like protein 21 | 0.00e+00 | 9.43e-20 | 2.75e-28 |
| 1. PB | O72756 | Kelch repeat and BTB domain-containing protein 2 | NA | 4.33e-21 | 1.07e-10 |
| 1. PB | Q5RG82 | Influenza virus NS1A-binding protein homolog A | 8.13e-11 | 1.92e-26 | 2.84e-22 |
| 1. PB | Q8WVZ9 | Kelch repeat and BTB domain-containing protein 7 | 2.47e-12 | 7.11e-14 | 8.97e-14 |
| 1. PB | Q8BHI4 | Kelch repeat and BTB domain-containing protein 3 | 2.11e-15 | 6.57e-20 | 6.82e-16 |
| 1. PB | D2HEW7 | Kelch-like protein 22 | 6.77e-15 | 1.46e-26 | 4.10e-38 |
| 1. PB | F1LZ52 | Kelch-like protein 3 | 0.00e+00 | 3.63e-16 | 2.82e-31 |
| 1. PB | Q6NYM1 | Kelch-like protein 21 | 0.00e+00 | 1.67e-22 | 9.70e-32 |
| 1. PB | Q6DFF6 | Kelch-like protein 20 | 0.00e+00 | 4.06e-13 | 4.32e-41 |
| 1. PB | P28575 | Actin-binding protein IPP | 0.00e+00 | 5.41e-25 | 1.39e-36 |
| 1. PB | P08073 | Kelch repeat protein M-T9 | NA | 7.05e-25 | 6.23e-08 |
| 1. PB | Q5R774 | Kelch-like ECH-associated protein 1 | 0.00e+00 | 5.59e-10 | 8.02e-45 |
| 1. PB | Q8WZ60 | Kelch-like protein 6 | 0.00e+00 | 5.06e-16 | 1.33e-23 |
| 1. PB | Q9P2N7 | Kelch-like protein 13 | 0.00e+00 | 3.61e-13 | 5.49e-56 |
| 1. PB | Q0GNN1 | Kelch repeat and BTB domain-containing protein 2 | NA | 1.56e-24 | 1.87e-08 |
| 1. PB | Q0D2A9 | Kelch-like protein 25 | 0.00e+00 | 1.21e-21 | 3.70e-22 |
| 1. PB | Q6RZS3 | Kelch repeat protein C2 | NA | 1.61e-28 | 2.95e-14 |
| 1. PB | D3Z8N4 | Kelch-like protein 20 | 0.00e+00 | 2.28e-11 | 2.37e-41 |
| 1. PB | Q6PF15 | Kelch-like protein 35 | 0.00e+00 | 4.33e-21 | 1.11e-17 |
| 1. PB | Q6DEL7 | Kelch-like protein 15 | 0.00e+00 | 1.88e-33 | 9.18e-27 |
| 1. PB | Q6V595 | Kelch-like protein 6 | 2.22e-16 | 1.44e-16 | 1.32e-23 |
| 1. PB | D3ZA50 | Kelch-like protein 15 | 0.00e+00 | 6.88e-32 | 2.54e-27 |
| 1. PB | Q8NAB2 | Kelch repeat and BTB domain-containing protein 3 | 2.00e-15 | 6.05e-18 | 4.73e-15 |
| 1. PB | O57174 | Kelch repeat protein F3 | NA | 1.75e-15 | 1.02e-04 |
| 1. PB | B4L0G9 | Kelch-like protein diablo | 0.00e+00 | 8.49e-09 | 1.47e-39 |
| 1. PB | P59280 | Kelch-like protein 8 | 0.00e+00 | 7.38e-13 | 2.43e-38 |
| 1. PB | Q8R2H4 | Kelch-like protein 12 | 0.00e+00 | 4.40e-23 | 6.14e-35 |
| 1. PB | B4HIK1 | Kelch-like protein diablo | 0.00e+00 | 1.14e-10 | 7.79e-39 |
| 1. PB | Q6DFU2 | Influenza virus NS1A-binding protein homolog | 3.93e-09 | 4.64e-25 | 8.59e-22 |
| 1. PB | O14682 | Ectoderm-neural cortex protein 1 | 0.00e+00 | 3.41e-23 | 1.03e-23 |
| 1. PB | Q5U504 | Kelch-like protein 40 | 1.89e-15 | 1.01e-25 | 2.89e-28 |
| 1. PB | Q8CDE2 | Calicin | 0.00e+00 | 2.21e-20 | 0.002 |
| 1. PB | Q6JEL3 | Kelch-like protein 10 | 0.00e+00 | 6.87e-26 | 4.40e-33 |
| 1. PB | Q08CY1 | Kelch-like protein 22 | 0.00e+00 | 2.87e-27 | 2.74e-45 |
| 1. PB | Q9Z2X8 | Kelch-like ECH-associated protein 1 | 0.00e+00 | 6.72e-10 | 3.36e-44 |
| 1. PB | Q9Y573 | Actin-binding protein IPP | 0.00e+00 | 1.21e-23 | 1.11e-34 |
| 1. PB | Q8BRG6 | Kelch-like protein 24 | 0.00e+00 | 2.89e-14 | 6.97e-24 |
| 1. PB | Q9NVR0 | Kelch-like protein 11 | 8.06e-12 | 1.56e-08 | 5.31e-17 |
| 1. PB | Q9CR40 | Kelch-like protein 28 | 0.00e+00 | 2.73e-18 | 1.37e-39 |
| 1. PB | Q2T9Z7 | Kelch-like protein 9 | 0.00e+00 | 8.20e-25 | 2.62e-56 |
| 1. PB | E1B932 | Kelch-like protein 12 | 0.00e+00 | 6.01e-23 | 8.81e-32 |
| 1. PB | Q5ZI33 | Kelch-like protein 7 | 0.00e+00 | 9.72e-21 | 1.57e-25 |
| 1. PB | Q08DS0 | Kelch-like protein 21 | 4.44e-16 | 3.94e-18 | 2.72e-25 |
| 1. PB | B4GRJ2 | Kelch-like protein diablo | 0.00e+00 | 2.48e-10 | 5.18e-39 |
| 1. PB | Q8JLI4 | Kelch repeat protein C2 | NA | 1.25e-27 | 1.43e-14 |
| 1. PB | Q9Y6Y0 | Influenza virus NS1A-binding protein | 1.64e-08 | 1.84e-24 | 1.63e-23 |
| 1. PB | Q776A6 | Kelch repeat protein C2 | NA | 2.60e-28 | 1.36e-14 |
| 1. PB | C9JR72 | Kelch repeat and BTB domain-containing protein 13 | 2.76e-07 | 3.57e-27 | 5.27e-09 |
| 1. PB | Q8BGY4 | Kelch-like protein 26 | 0.00e+00 | 4.32e-23 | 7.27e-41 |
| 1. PB | Q08DK3 | Kelch-like protein 20 | 0.00e+00 | 2.28e-11 | 2.37e-41 |
| 1. PB | Q8R179 | Kelch repeat and BTB domain-containing protein 4 | 3.40e-11 | 4.94e-11 | 1.40e-15 |
| 1. PB | Q9P2G3 | Kelch-like protein 14 | 0.00e+00 | 4.42e-15 | 1.51e-38 |
| 1. PB | Q9NXS3 | Kelch-like protein 28 | 0.00e+00 | 2.04e-19 | 5.26e-41 |
| 1. PB | Q9UJP4 | Kelch-like protein 21 | 2.00e-15 | 2.50e-19 | 2.31e-25 |
| 1. PB | B4LIG6 | Kelch-like protein diablo | 0.00e+00 | 4.18e-12 | 1.47e-39 |
| 1. PB | Q8R124 | Kelch-like protein 36 | 0.00e+00 | 7.17e-31 | 3.54e-47 |
| 1. PB | Q5R7B8 | Kelch-like protein 20 | 0.00e+00 | 4.74e-11 | 2.03e-40 |
| 1. PB | Q96M94 | Kelch-like protein 15 | 0.00e+00 | 8.67e-32 | 2.29e-28 |
| 1. PB | Q53G59 | Kelch-like protein 12 | 0.00e+00 | 9.53e-24 | 1.35e-34 |
| 1. PB | Q0GNQ5 | Kelch repeat and BTB domain-containing protein 1 | NA | 3.25e-31 | 5.01e-20 |
| 1. PB | P17371 | Kelch repeat protein C2 | NA | 2.45e-28 | 1.11e-14 |
| 1. PB | Q9P2J3 | Kelch-like protein 9 | 1.11e-16 | 1.99e-24 | 1.47e-56 |
| 1. PB | Q53HC5 | Kelch-like protein 26 | 0.00e+00 | 4.04e-17 | 4.93e-45 |
| 1. PB | Q8L736 | F-box/kelch-repeat protein SKIP11 | 2.21e-08 | 9.04e-03 | 8.89e-08 |
| 1. PB | B1H285 | Kelch repeat and BTB domain-containing protein 8 | 0.00e+00 | 1.62e-27 | 1.23e-24 |
| 1. PB | Q8BZM0 | Kelch-like protein 12 | 0.00e+00 | 6.59e-23 | 1.25e-34 |
| 1. PB | Q9VUU5 | Kelch-like protein diablo | 0.00e+00 | 1.14e-10 | 7.79e-39 |
| 1. PB | P24768 | Kelch repeat and BTB domain-containing protein A55 | NA | 2.18e-31 | 1.10e-20 |
| 1. PB | Q8NBE8 | Kelch-like protein 23 | 2.22e-16 | 5.39e-22 | 3.76e-24 |
| 1. PB | O60662 | Kelch-like protein 41 | 0.00e+00 | 1.44e-24 | 3.39e-32 |
| 1. PB | Q69ZK5 | Kelch-like protein 14 | 0.00e+00 | 1.47e-13 | 5.94e-38 |
| 1. PB | Q8CA72 | Gigaxonin | 0.00e+00 | 5.38e-33 | 1.68e-30 |
| 1. PB | Q9D783 | Kelch-like protein 40 | 2.89e-15 | 5.77e-26 | 9.39e-23 |
| 1. PB | P21073 | Kelch repeat and BTB domain-containing protein 1 | NA | 1.21e-31 | 5.67e-21 |
| 1. PB | E9QJ30 | Kelch-like protein 40b | 3.33e-16 | 1.13e-23 | 1.02e-25 |
| 1. PB | B4PD06 | Kelch-like protein diablo | 0.00e+00 | 1.14e-10 | 7.79e-39 |
| 1. PB | D4A2K4 | Kelch-like protein 21 | 3.33e-16 | 3.51e-19 | 1.69e-24 |
| 1. PB | Q5RCQ9 | Kelch-like protein 23 | 0.00e+00 | 3.50e-22 | 7.76e-23 |
| 1. PB | P57790 | Kelch-like ECH-associated protein 1 | 0.00e+00 | 8.84e-12 | 8.63e-43 |
| 1. PB | Q9JFS4 | Kelch repeat and BTB domain-containing protein 2 | NA | 7.91e-19 | 6.30e-10 |
| 1. PB | Q4KLM4 | Kelch-like protein 25 | 0.00e+00 | 3.53e-20 | 9.02e-29 |
| 1. PB | O72736 | Kelch repeat and BTB domain-containing protein 1 | NA | 5.45e-32 | 1.89e-21 |
| 1. PB | Q8N239 | Kelch-like protein 34 | 0.00e+00 | 1.30e-26 | 2.83e-17 |
| 1. PB | Q5F3N5 | Kelch-like protein 14 | 0.00e+00 | 4.38e-17 | 3.75e-37 |
| 1. PB | E7F6F9 | Kelch-like protein 3 | 0.00e+00 | 2.50e-15 | 6.34e-30 |
| 1. PB | Q9D618 | Kelch repeat and BTB domain-containing protein 12 | 2.39e-14 | 2.62e-35 | 3.68e-20 |
| 1. PB | Q5R663 | Kelch repeat and BTB domain-containing protein 3 | 4.22e-15 | 8.42e-18 | 8.92e-15 |
| 1. PB | Q8R2P1 | Kelch-like protein 25 | 0.00e+00 | 2.06e-20 | 1.76e-28 |
| 1. PB | Q6DFF7 | Kelch-like protein 25 | 0.00e+00 | 4.50e-22 | 1.30e-27 |
| 1. PB | Q99JN2 | Kelch-like protein 22 | 0.00e+00 | 9.35e-29 | 4.43e-36 |
| 1. PB | Q8C828 | Kelch repeat and BTB domain-containing protein 13 | 1.62e-07 | 1.27e-25 | 1.52e-10 |
| 1. PB | E0CZ16 | Kelch-like protein 3 | 0.00e+00 | 2.11e-16 | 2.79e-31 |
| 1. PB | Q9D5V2 | Kelch-like protein 10 | 0.00e+00 | 1.05e-25 | 4.44e-33 |
| 1. PB | O95198 | Kelch-like protein 2 | 0.00e+00 | 8.91e-16 | 3.74e-28 |
| 1. PB | A0A2R8Q1W5 | Kelch-like ECH-associated protein 1B | 0.00e+00 | 1.57e-18 | 7.26e-40 |
| 1. PB | Q6GQU2 | Kelch-like protein 23 | 2.22e-16 | 1.63e-21 | 1.93e-23 |
| 1. PB | Q8QMQ2 | Kelch repeat and BTB domain-containing protein 1 | NA | 4.13e-34 | 1.91e-19 |
| 1. PB | Q8V2Z3 | Kelch repeat protein C2 | NA | 2.60e-28 | 1.36e-14 |
| 1. PB | Q6INL2 | Kelch-like protein 30 | 0.00e+00 | 1.88e-26 | 1.96e-12 |
| 1. PB | Q08CL3 | Kelch repeat and BTB domain-containing protein 8 | 0.00e+00 | 5.93e-20 | 1.45e-21 |
| 1. PB | Q920Q8 | Influenza virus NS1A-binding protein homolog | 3.28e-09 | 2.63e-24 | 8.60e-25 |
| 1. PB | Q8C3F7 | Kelch-like protein 30 | 0.00e+00 | 3.18e-25 | 1.36e-21 |
| 1. PB | Q5XHZ6 | Kelch-like protein 7 | 0.00e+00 | 6.45e-22 | 1.13e-25 |
| 1. PB | Q9ER30 | Kelch-like protein 41 | 0.00e+00 | 3.00e-24 | 1.03e-27 |
| 1. PB | B3M9V8 | Kelch-like protein diablo | 0.00e+00 | 1.29e-08 | 1.09e-38 |
| 1. PB | Q5BK60 | Kelch-like protein 38 | 0.00e+00 | 1.66e-23 | 1.82e-22 |
| 1. PB | O94889 | Kelch-like protein 18 | 0.00e+00 | 4.11e-22 | 5.25e-34 |
| 1. PB | Q5ZJU2 | Kelch-like protein 15 | 2.22e-15 | 1.39e-13 | 9.11e-15 |
| 1. PB | P24357 | Kelch repeat protein F3 | NA | 3.12e-13 | 2.24e-04 |
| 1. PB | Q56A24 | Kelch-like protein 24 | 0.00e+00 | 2.89e-14 | 6.97e-24 |
| 1. PB | Q8JL69 | Kelch repeat and BTB domain-containing protein 1 | NA | 2.23e-31 | 1.48e-16 |
| 1. PB | Q96G42 | Kelch domain-containing protein 7B | 1.72e-07 | 1.23e-07 | 2.93e-11 |
| 1. PB | Q6TDP3 | Kelch-like protein 17 | 0.00e+00 | 2.58e-13 | 9.12e-40 |
| 1. PB | Q6NRH0 | Kelch-like protein 12 | 0.00e+00 | 6.10e-24 | 1.62e-32 |
| 1. PB | Q503R4 | Kelch-like protein 36 | 0.00e+00 | 1.45e-25 | 1.29e-40 |
| 1. PB | Q9H511 | Kelch-like protein 31 | 0.00e+00 | 1.42e-18 | 1.76e-48 |
| 1. PB | Q5EB39 | Kelch-like protein 40 | 2.22e-15 | 2.95e-24 | 8.32e-25 |
| 1. PB | Q8QMN3 | Kelch repeat and BTB domain-containing protein 2 | NA | 8.59e-22 | 2.16e-10 |
| 1. PB | A6QQY2 | Kelch-like protein 13 | 0.00e+00 | 1.21e-12 | 3.85e-56 |
| 1. PB | Q86V97 | Kelch repeat and BTB domain-containing protein 6 | 2.40e-12 | 1.59e-12 | 4.39e-15 |
| 1. PB | Q1ECZ2 | Kelch-like ECH-associated protein 1A | 0.00e+00 | 1.17e-16 | 2.51e-43 |
| 1. PB | B4MXW3 | Kelch-like protein diablo | 0.00e+00 | 5.95e-09 | 1.14e-38 |
| 1. PB | P87617 | Kelch repeat protein C2 | NA | 1.89e-28 | 3.19e-14 |
| 1. PB | P34569 | Kelch repeat-containing protein kel-10 | 0.00e+00 | 1.02e-20 | 1.04e-05 |
| 1. PB | Q6ZPT1 | Kelch-like protein 9 | 0.00e+00 | 1.01e-24 | 1.32e-57 |
| 1. PB | Q6TDP4 | Kelch-like protein 17 | 0.00e+00 | 2.58e-12 | 6.21e-41 |
| 1. PB | Q7ZVQ8 | Influenza virus NS1A-binding protein homolog B | 6.01e-09 | 2.60e-28 | 1.40e-20 |
| 1. PB | Q2TBA0 | Kelch-like protein 40 | 8.88e-16 | 7.89e-25 | 6.20e-13 |
| 1. PB | F1QEG2 | Kelch-like protein 41b | 0.00e+00 | 3.56e-21 | 1.80e-20 |
| 1. PB | Q8K430 | Kelch-like protein 17 | 0.00e+00 | 2.58e-13 | 9.12e-40 |
| 1. PB | Q5RDY3 | Kelch repeat and BTB domain-containing protein 2 | 3.16e-12 | 3.15e-32 | 3.26e-21 |
| 1. PB | Q80TF4 | Kelch-like protein 13 | 5.55e-16 | 2.23e-14 | 1.72e-55 |
| 1. PB | Q53GT1 | Kelch-like protein 22 | 2.22e-16 | 1.76e-27 | 2.86e-39 |
| 1. PB | B0WWP2 | Kelch-like protein diablo | 0.00e+00 | 2.22e-19 | 4.00e-40 |
| 1. PB | Q13939 | Calicin | 0.00e+00 | 3.02e-19 | 8.78e-05 |
| 1. PB | Q8NFY9 | Kelch repeat and BTB domain-containing protein 8 | 0.00e+00 | 5.95e-18 | 5.67e-27 |
| 1. PB | Q0D2K2 | Kelch-like protein 30 | 0.00e+00 | 1.93e-22 | 3.97e-22 |
| 1. PB | Q3ZCT8 | Kelch repeat and BTB domain-containing protein 12 | 3.00e-15 | 8.82e-34 | 7.34e-23 |
| 1. PB | Q5R4S6 | Kelch repeat and BTB domain-containing protein 4 | 2.51e-11 | 2.60e-14 | 1.25e-15 |
| 1. PB | B4QLQ2 | Kelch-like protein diablo | 0.00e+00 | 8.65e-11 | 7.67e-38 |
| 1. PB | Q8BSF5 | Kelch-like protein 38 | 0.00e+00 | 2.07e-22 | 4.96e-20 |
| 1. PB | Q9P2G9 | Kelch-like protein 8 | 0.00e+00 | 7.50e-18 | 3.19e-42 |
| 1. PB | B4J045 | Kelch-like protein diablo | 0.00e+00 | 1.57e-10 | 1.31e-39 |
| 1. PB | Q9H0H3 | Kelch-like protein 25 | 0.00e+00 | 1.10e-20 | 2.39e-28 |
| 1. PB | Q9P2K6 | Kelch-like protein 42 | 3.23e-08 | 8.32e-26 | 1.19e-16 |
| 1. PB | Q96NJ5 | Kelch-like protein 32 | 0.00e+00 | 1.72e-27 | 2.79e-36 |
| 1. PB | F1LZF0 | Kelch-like protein 2 | 0.00e+00 | 5.39e-16 | 2.99e-28 |
| 1. PB | Q8CE33 | Kelch-like protein 11 | 4.58e-10 | 5.30e-09 | 2.10e-16 |
| 1. PB | Q2WGJ6 | Kelch-like protein 38 | 0.00e+00 | 3.76e-24 | 1.97e-20 |
| 1. PB | Q09563 | Kelch repeat and BTB domain-containing protein F47D12.7 | 1.11e-15 | 2.39e-22 | 2.48e-04 |
| 1. PB | Q66HD2 | Kelch-like protein 36 | 0.00e+00 | 5.14e-31 | 5.11e-46 |
| 1. PB | P21013 | Kelch repeat protein F3 | NA | 2.29e-13 | 0.002 |
| 1. PB | G5ED84 | Kelch-like protein 8 | 0.00e+00 | 1.93e-08 | 2.26e-32 |
| 1. PB | Q9N010 | Kelch repeat and BTB domain-containing protein 4 | 1.80e-14 | 2.29e-10 | 3.33e-16 |
| 1. PB | Q8VCK5 | Kelch-like protein 20 | 0.00e+00 | 1.28e-12 | 3.45e-41 |
| 2. P | Q5SP67 | WD repeat-containing protein 26 | 6.94e-04 | 1.52e-02 | NA |
| 2. P | Q6NRT3 | WD40 repeat-containing protein SMU1 | 1.10e-03 | 3.64e-03 | NA |
| 2. P | Q9FND4 | WD repeat-containing protein WDS homolog | 4.12e-04 | 5.91e-03 | NA |
| 2. P | O75529 | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L | 1.47e-03 | 6.38e-05 | NA |
| 2. P | Q8W117 | Suppressor of mec-8 and unc-52 protein homolog 1 | 1.04e-03 | 1.93e-07 | NA |
| 2. P | Q8SQS4 | Transcription initiation factor TFIID subunit 5 | 3.94e-04 | 1.91e-04 | NA |
| 2. P | Q54Y96 | WD40 repeat-containing protein smu1 | 1.19e-03 | 1.37e-03 | NA |
| 2. P | Q7ZVA0 | WD40 repeat-containing protein SMU1 | 1.27e-03 | 1.99e-04 | NA |
| 2. P | Q8K450 | Sperm-associated antigen 16 protein | 3.85e-03 | 6.75e-03 | NA |
| 2. P | F1LTR1 | WD repeat-containing protein 26 | 3.45e-04 | 2.57e-04 | NA |
| 2. P | Q6P4J8 | WD40 repeat-containing protein SMU1 | 1.27e-03 | 2.05e-03 | NA |
| 2. P | G5EEG7 | Smu-1 suppressor of mec-8 and unc-52 protein | 9.06e-04 | 6.80e-05 | NA |
| 2. P | Q5UQ07 | Putative BTB/POZ domain-containing protein L788 | NA | 4.99e-03 | NA |
| 2. P | P0DPA1 | WD repeat-containing protein DDB_G0349043 | 5.28e-04 | 5.43e-03 | NA |
| 2. P | Q9UT85 | Uncharacterized WD repeat-containing protein C343.04c | 5.99e-04 | 2.91e-03 | NA |
| 2. P | Q76B40 | WD40 repeat-containing protein SMU1 | 1.40e-03 | 5.53e-04 | NA |
| 2. P | Q5UQT6 | Uncharacterized WD repeat-containing protein L344 | NA | 3.15e-03 | NA |
| 2. P | Q2TAY7 | WD40 repeat-containing protein SMU1 | 2.02e-03 | 5.53e-04 | NA |
| 2. P | Q99M63 | WD40 repeat-containing protein SMU1 | 1.13e-03 | 9.32e-04 | NA |
| 2. P | Q2TBS9 | WD40 repeat-containing protein SMU1 | 1.23e-03 | 5.53e-04 | NA |
| 2. P | Q9FII1 | F-box/kelch-repeat protein At5g42360 | 1.27e-02 | 7.15e-03 | NA |
| 2. P | Q91WQ5 | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L | 7.41e-04 | 7.49e-05 | NA |
| 2. P | Q5XI58 | Calicin | 0.00e+00 | 5.44e-20 | NA |
| 2. P | Q5ZME8 | WD40 repeat-containing protein SMU1 | 1.57e-03 | 7.56e-04 | NA |
| 2. P | P22611 | Kelch repeat protein M-T8 | NA | 6.43e-27 | NA |
| 2. P | Q86J11 | Kelch repeat-containing protein DDB_G0274267 | 3.82e-07 | 3.90e-02 | NA |
| 2. P | Q9FII2 | F-box/kelch-repeat protein At5g42350 | 3.90e-05 | 8.62e-03 | NA |
| 2. P | Q5UNZ2 | Putative BTB/POZ domain and WD-repeat protein R739 | NA | 8.44e-04 | NA |
| 2. P | Q3UKJ7 | WD40 repeat-containing protein SMU1 | 1.40e-03 | 5.53e-04 | NA |
| 3. B | P80197 | Actin-fragmin kinase | 3.21e-05 | NA | 1.54e-06 |
| 3. B | Q1C8L8 | N-acetylneuraminate epimerase | 2.00e-09 | NA | 0.012 |
| 3. B | Q5ZJ37 | Rab9 effector protein with kelch motifs | 1.10e-07 | NA | 2.05e-05 |
| 3. B | P87061 | Tip elongation aberrant protein 1 | 4.95e-04 | NA | 3.94e-05 |
| 3. B | Q0V7S6 | F-box/kelch-repeat protein OR23 | 4.82e-07 | NA | 0.019 |
| 3. B | Q84M94 | F-box/kelch-repeat protein At1g26930 | 1.31e-07 | NA | 0.008 |
| 3. B | Q9LK86 | Putative F-box/kelch-repeat protein At3g27910 | 5.61e-05 | NA | 6.43e-05 |
| 3. B | Q5VTJ3 | Kelch domain-containing protein 7A | 1.09e-04 | NA | 6.81e-11 |
| 3. B | Q9M2C9 | F-box/kelch-repeat protein SKIP4 | 7.07e-08 | NA | 0.003 |
| 3. B | Q5Z8K3 | Adagio-like protein 1 | 2.38e-04 | NA | 0.001 |
| 3. B | Q75LJ4 | Acyl-CoA-binding domain-containing protein 6 | 3.05e-05 | NA | 0.009 |
| 3. B | Q9LYY3 | F-box/kelch-repeat protein At5g03020 | 7.25e-04 | NA | 0.020 |
| 3. B | P39371 | N-acetylneuraminate epimerase | 3.03e-13 | NA | 6.99e-04 |
| 3. B | Q9C0H6 | Kelch-like protein 4 | 1.11e-16 | NA | 9.68e-40 |
| 3. B | Q1PE10 | F-box/kelch-repeat protein At4g39590 | 2.44e-04 | NA | 0.014 |
| 3. B | Q8RY71 | Epithiospecifier protein | 3.05e-09 | NA | 0.005 |
| 3. B | Q5U580 | Kelch domain-containing protein 10 | 3.05e-07 | NA | 7.01e-04 |
| 3. B | Q5R866 | Kelch domain-containing protein 7A (Fragment) | 6.28e-06 | NA | 2.11e-10 |
| 3. B | Q8LAW2 | F-box protein AFR | 3.41e-07 | NA | 0.004 |
| 3. B | Q8IYD2 | Kelch domain-containing protein 8A | 5.52e-14 | NA | 1.19e-14 |
| 3. B | Q9SDM9 | Nitrile-specifier protein 1 | 1.05e-07 | NA | 6.85e-05 |
| 3. B | Q31T32 | N-acetylneuraminate epimerase | 3.10e-13 | NA | 8.11e-04 |
| 3. B | O04318 | Nitrile-specifier protein 3 | 6.25e-07 | NA | 7.12e-05 |
| 3. B | Q1CHD7 | N-acetylneuraminate epimerase | 5.28e-12 | NA | 0.012 |
| 3. B | Q67UX0 | Putative adagio-like protein 2 | 3.82e-04 | NA | 2.45e-04 |
| 3. B | Q91XA8 | Kelch domain-containing protein 8A | 3.66e-15 | NA | 8.51e-15 |
| 3. B | Q86L99 | Rho GTPase-activating protein gacHH | 3.58e-03 | NA | 9.81e-05 |
| 3. B | Q04652 | Ring canal kelch protein | NA | NA | 1.40e-30 |
| 3. B | Q9V410 | Leucine-zipper-like transcriptional regulator 1 homolog | 1.36e-04 | NA | 8.60e-07 |
| 3. B | A4TK48 | N-acetylneuraminate epimerase | 1.55e-07 | NA | 0.012 |
| 3. B | A1JMV0 | N-acetylneuraminate epimerase | 1.08e-09 | NA | 0.001 |
| 3. B | Q9D2D9 | Kelch domain-containing protein 8B | 6.77e-15 | NA | 1.25e-10 |
| 3. B | P0C2F9 | Putative F-box/kelch-repeat protein At4g39756 | 6.78e-05 | NA | 0.008 |
| 3. B | O82374 | Putative F-box/kelch-repeat protein At2g29820 | 5.18e-05 | NA | 0.001 |
| 3. B | Q9CKB7 | N-acetylneuraminate epimerase | 1.53e-13 | NA | 1.31e-04 |
| 3. B | Q7Z6M1 | Rab9 effector protein with kelch motifs | 1.53e-11 | NA | 1.54e-05 |
| 3. B | Q9SVA0 | F-box/kelch-repeat protein At4g39580 | 1.50e-05 | NA | 2.64e-08 |
| 3. B | Q3YU63 | N-acetylneuraminate epimerase | 3.14e-12 | NA | 1.64e-04 |
| 3. B | Q6AYI2 | Kelch domain-containing protein 3 | 1.27e-09 | NA | 2.15e-08 |
| 3. B | Q25390 | Alpha-scruin | 3.24e-06 | NA | 1.86e-12 |
| 3. B | Q9MA55 | Acyl-CoA-binding domain-containing protein 4 | 2.30e-04 | NA | 3.97e-04 |
| 3. B | P44544 | N-acetylneuraminate epimerase | 1.75e-11 | NA | 0.004 |
| 3. B | Q5RCW7 | Kelch domain-containing protein 8B | 1.59e-12 | NA | 1.38e-09 |
| 3. B | Q8N653 | Leucine-zipper-like transcriptional regulator 1 | 5.01e-05 | NA | 2.84e-08 |
| 3. B | A7FJ01 | N-acetylneuraminate epimerase | 2.71e-09 | NA | 0.012 |
| 3. B | Q5XIA9 | Kelch domain-containing protein 8B | 1.98e-12 | NA | 8.03e-10 |
| 3. B | Q8X554 | N-acetylneuraminate epimerase | 2.61e-12 | NA | 7.70e-04 |
| 3. B | Q96CT2 | Kelch-like protein 29 | 0.00e+00 | NA | 5.10e-23 |
| 3. B | Q7M3S9 | RING finger protein B | 8.39e-06 | NA | 4.29e-06 |
| 3. B | Q8CVR2 | N-acetylneuraminate epimerase 1 | 1.43e-13 | NA | 6.35e-05 |
| 3. B | P38853 | Kelch repeat-containing protein 1 | 2.49e-03 | NA | 6.31e-07 |
| 3. B | Q9FPW6 | BTB/POZ domain-containing protein POB1 | 1.46e-03 | NA | 6.84e-06 |
| 3. B | O82370 | Putative F-box/kelch-repeat protein At2g29860 | 1.40e-04 | NA | 0.008 |
| 3. B | A2APT9 | Kelch domain-containing protein 7A | 8.89e-08 | NA | 2.97e-10 |
| 3. B | Q2QM47 | Serine/threonine-protein phosphatase BSL2 homolog | 6.63e-06 | NA | 0.046 |
| 3. B | Q9T035 | Putative F-box/kelch-repeat protein At4g39290 | 6.18e-05 | NA | 0.002 |
| 3. B | Q5RDA9 | F-box only protein 42 | 1.63e-04 | NA | 0.030 |
| 3. B | Q1R2K5 | N-acetylneuraminate epimerase | 3.29e-13 | NA | 6.81e-04 |
| 3. B | O82373 | F-box/kelch-repeat protein At2g29830 | 1.23e-05 | NA | 0.020 |
| 3. B | Q6AXB2 | Rab9 effector protein with kelch motifs | 1.15e-11 | NA | 0.001 |
| 3. B | Q25386 | Beta-scruin | 4.53e-06 | NA | 4.26e-11 |
| 3. B | Q58CV6 | Kelch domain-containing protein 3 | 1.44e-09 | NA | 1.22e-07 |
| 3. B | Q9CAG8 | F-box/kelch-repeat protein At1g67480 | 9.84e-07 | NA | 3.61e-10 |
| 3. B | Q1PE09 | F-box/kelch-repeat protein At4g39753 | 9.74e-05 | NA | 0.007 |
| 3. B | Q9M2B5 | Putative F-box/kelch-repeat protein At3g43710 | 1.98e-04 | NA | 0.010 |
| 3. B | Q9CQ33 | Leucine-zipper-like transcriptional regulator 1 | 8.26e-05 | NA | 3.34e-08 |
| 3. B | A8A834 | N-acetylneuraminate epimerase | 7.84e-13 | NA | 0.001 |
| 3. B | O14248 | Tip elongation aberrant protein 3 | 3.09e-04 | NA | 2.39e-05 |
| 3. B | Q9NR64 | Kelch-like protein 1 | 1.11e-16 | NA | 1.05e-37 |
| 3. B | Q96PQ7 | Kelch-like protein 5 | 0.00e+00 | NA | 4.75e-38 |
| 3. B | Q9SZZ9 | F-box/kelch-repeat protein At4g25710 | 3.96e-05 | NA | 0.003 |
| 3. B | A1AJH6 | N-acetylneuraminate epimerase | 3.19e-13 | NA | 6.81e-04 |
| 3. B | Q9FFV4 | Putative F-box/kelch-repeat protein At5g38680 | 1.81e-04 | NA | 0.005 |
| 3. B | O04316 | Nitrile-specifier protein 4 | 9.98e-07 | NA | 1.06e-04 |
| 3. B | O49618 | Putative F-box/kelch-repeat protein At4g35120 | 2.87e-05 | NA | 5.47e-04 |
| 3. B | Q9LI89 | F-box/kelch-repeat protein At3g27150 | 1.93e-08 | NA | 7.31e-05 |
| 3. B | Q93W93 | F-box/kelch-repeat protein At1g55270 | 1.54e-06 | NA | 4.27e-05 |
| 3. B | Q9LQ95 | BTB/POZ domain-containing protein At1g01640 | 5.46e-04 | NA | 0.029 |
| 3. B | Q9V4C8 | Host cell factor | 6.78e-03 | NA | 0.030 |
| 3. B | Q6PID8 | Kelch domain-containing protein 10 | 1.05e-06 | NA | 6.46e-05 |
| 3. B | A5UB03 | N-acetylneuraminate epimerase | 1.92e-10 | NA | 0.006 |
| 3. B | Q97Z97 | Kelch domain-containing protein SSO1033 | 2.88e-06 | NA | 2.48e-05 |
| 3. B | A5UFV3 | N-acetylneuraminate epimerase | 3.82e-13 | NA | 0.010 |
| 3. B | P50090 | Kelch repeat-containing protein 2 | 2.89e-04 | NA | 0.015 |
| 3. B | A7ZVK8 | N-acetylneuraminate epimerase | 2.41e-12 | NA | 7.18e-04 |
| 3. B | Q9FI70 | F-box/kelch-repeat protein At5g49000 | 8.65e-06 | NA | 1.52e-04 |
| 3. B | Q0SXL5 | N-acetylneuraminate epimerase | 3.02e-13 | NA | 6.57e-04 |
| 3. B | Q9C6Z0 | F-box/kelch-repeat protein At1g30090 | 3.85e-06 | NA | 2.01e-11 |
| 3. B | Q4V8F4 | Rab9 effector protein with kelch motifs | 1.46e-11 | NA | 0.001 |
| 3. B | Q4QP39 | N-acetylneuraminate epimerase | 1.76e-11 | NA | 0.015 |
| 3. B | Q8VEM9 | Kelch domain-containing protein 3 | 1.42e-09 | NA | 2.19e-08 |
| 3. B | Q83IN1 | N-acetylneuraminate epimerase | 3.09e-13 | NA | 6.57e-04 |
| 3. B | Q8CVG5 | N-acetylneuraminate epimerase 2 | 3.26e-13 | NA | 0.004 |
| 3. B | Q9SY96 | Putative F-box/kelch-repeat protein At1g61540 | 6.95e-05 | NA | 0.004 |
| 3. B | O49488 | Putative F-box/kelch-repeat protein At4g34170 | 2.00e-05 | NA | 0.007 |
| 3. B | Q6PAR0 | Kelch domain-containing protein 10 | 3.14e-08 | NA | 1.43e-04 |
| 3. B | Q9ZW38 | F-box/kelch-repeat protein At2g29600 | 4.09e-04 | NA | 0.025 |
| 3. B | Q7CI10 | N-acetylneuraminate epimerase | 4.97e-12 | NA | 0.012 |
| 3. B | Q6NPN5 | F-box/kelch-repeat protein At5g26960 | 3.89e-07 | NA | 2.05e-04 |
| 3. B | Q5U3Y0 | Kelch domain-containing protein 10 | 2.50e-08 | NA | 2.37e-04 |
| 3. B | Q9JI74 | Kelch-like protein 1 | 0.00e+00 | NA | 2.08e-37 |
| 3. B | Q5E9V5 | Kelch domain-containing protein 8B | 4.55e-15 | NA | 1.81e-10 |
| 3. B | O82343 | BTB/POZ domain-containing protein At2g46260 | 2.33e-03 | NA | 1.36e-04 |
| 3. B | Q8N7A1 | Kelch domain-containing protein 1 | 3.57e-08 | NA | 0.037 |
| 3. B | Q67XN8 | F-box/kelch-repeat protein At4g39560 | 2.98e-04 | NA | 0.006 |
| 3. B | P60882 | Multiple epidermal growth factor-like domains protein 8 | NA | NA | 0.034 |
| 3. B | Q9FZJ3 | Putative F-box/kelch-repeat protein At1g27420 | 2.02e-09 | NA | 1.10e-07 |
| 3. B | Q9FKJ0 | F-box/kelch-repeat protein At5g60570 | 1.93e-07 | NA | 0.026 |
| 3. B | Q93XW5 | Nitrile-specifier protein 5 | 8.80e-13 | NA | 0.044 |
| 3. B | Q973G3 | Kelch domain-containing protein STK_09390 | 6.50e-06 | NA | 1.75e-08 |
| 3. B | Q9QYP0 | Multiple epidermal growth factor-like domains protein 8 | NA | NA | 0.024 |
| 3. B | Q9LM55 | F-box/kelch-repeat protein At1g22040 | 3.10e-06 | NA | 0.027 |
| 3. B | Q0IIC2 | Kelch domain-containing protein 10 | 3.98e-07 | NA | 6.87e-05 |
| 3. B | Q6GQN7 | Rab9 effector protein with kelch motifs | 1.70e-10 | NA | 0.046 |
| 3. B | Q9M1W7 | F-box/kelch-repeat protein SKIP30 | 4.65e-10 | NA | 5.03e-07 |
| 3. B | Q0T900 | N-acetylneuraminate epimerase | 3.21e-13 | NA | 6.81e-04 |
| 3. B | Q94BT6 | Adagio protein 1 | 2.02e-04 | NA | 0.021 |
| 3. B | Q0WW40 | F-box/kelch-repeat protein At1g16250 | 6.43e-09 | NA | 2.28e-06 |
| 3. B | Q8H4D4 | tRNA wybutosine-synthesizing protein 2/3/4 | 6.02e-03 | NA | 0.020 |
| 3. B | Q10AZ7 | Protein GLUTELIN PRECURSOR ACCUMULATION 3 | 5.10e-09 | NA | 0.035 |
| 3. B | Q19981 | Putative protein tag-53 | 1.93e-04 | NA | 0.010 |
| 3. B | Q8IXV7 | Kelch domain-containing protein 8B | 6.22e-15 | NA | 1.55e-09 |
| 3. B | Q5EA50 | Rab9 effector protein with kelch motifs | 1.72e-08 | NA | 7.19e-05 |
| 3. B | Q54C94 | Ras guanine nucleotide exchange factor F | 3.49e-04 | NA | 0.001 |
| 3. B | Q9SVA3 | F-box/kelch-repeat protein At4g39550 | 1.59e-05 | NA | 0.003 |
| 3. B | Q9BQ90 | Kelch domain-containing protein 3 | 1.56e-09 | NA | 2.03e-07 |
| 3. B | Q6NL02 | F-box/kelch-repeat protein At5g39560 | 8.29e-07 | NA | 6.85e-06 |
| 3. B | Q8W420 | Adagio protein 2 | 1.53e-04 | NA | 0.036 |
| 3. B | Q2R2W1 | Adagio-like protein 3 | 4.75e-04 | NA | 0.001 |
| 3. B | Q5R4Q7 | Leucine-zipper-like transcriptional regulator 1 | 2.49e-04 | NA | 4.61e-08 |
| 3. B | Q9SJ04 | F-box/kelch-repeat protein SKIP6 | 3.39e-07 | NA | 0.004 |
| 3. B | Q28DE7 | Kelch domain-containing protein 10 | 3.39e-07 | NA | 0.001 |
| 3. B | Q70JS2 | Ring canal kelch homolog | NA | NA | 3.00e-27 |
| 3. B | Q66BP2 | N-acetylneuraminate epimerase | 4.45e-13 | NA | 0.012 |
| 3. B | Q8VCH5 | Rab9 effector protein with kelch motifs | 1.20e-07 | NA | 2.62e-04 |
| 3. B | Q80T74 | Kelch-like protein 29 | 0.00e+00 | NA | 1.00e-22 |
| 3. B | O49326 | Nitrile-specifier protein 2 | 1.65e-07 | NA | 4.97e-05 |
| 3. B | Q0D1P4 | Kelch-like protein terF | 8.02e-08 | NA | 1.46e-16 |