Summary

A6NCL7

Homolog: Q978J0.
Function: Putative ankyrin repeat protein TV1425.

Statistics

Total GO Annotation: 582
Unique PROST Go: 77
Unique BLAST Go: 461

Total Homologs: 466
Unique PROST Homologs: 64
Unique BLAST Homologs: 357

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q978J0 (Putative ankyrin repeat protein TV1425) with a FATCAT P-Value: 9.03e-11 and RMSD of 2.11 angstrom. The sequence alignment identity is 9.6%.
Structural alignment shown in left. Query protein A6NCL7 colored as red in alignment, homolog Q978J0 colored as blue. Query protein A6NCL7 is also shown in right top, homolog Q978J0 showed in right bottom. They are colored based on secondary structures. 

  A6NCL7 MVLLAGTGPEGGGARCMTPPPPSPPRGAQVEEDPADYEEFEDFSSLPDTRSIASDDSFYPFEDEEEHG--VE---SAESVPEGVP------ESVPETATL 89
  Q978J0 ---------------------------------------------------------------MDKNGEIVEKIKDEKSINQNLDFLRNYRDSYNRTP-- 35

  A6NCL7 LRAACANNVGL---LRTLVRRGVSVEEAQETDRNGRTGLIVACYH---GFVDTVVALAECPHVDVNWQDSEGNTALITAAQAGHAIITNYLLNYFPGLDL 183
  Q978J0 LMVACM--LGMENAIDKLVE---NFDKLEDKDIEGSTALIWAVKNNRLGIAEKLLSKGS----NVNTKDFSGKTPLMWSIIFGYSEMSYFLLEH--GANV 124

  A6NCL7 ERRNAFGFTALMKAAMQGRTDCIRALMLAGADVHARDPRRGMSPQEWATYTGRVDAVRLMQRLLERPCPEQFWEKYRPELPPPPEAARKPAGSKNCLQRL 283
  Q978J0 NDRNLEGETPLIVASKYGRSEIVKKLLELGADISARD-LTGLTAEASARIFGRQEVIKIFTE-VRRA--------------------------------- 189

  A6NCL7 TDCVLSVLTPRSVRGPEDGGVLDHMVRMTTSLYSPAVAIVCQTVCPESPPSVGKRRLAVQEILAARAARGPQAQEEDEVGGAGQRGRTGQEDADSREGSP 383
  Q978J0 ---------------------------------------------------------------------------------------------------- 189

  A6NCL7 RAGLPPALGSRGPAAPAPRKASLLPLQRLRRRSVRPGVVVPRVRVSKAPAPTFQPERPARKGSTKDSGHLQIPKWRYKEAKEEKRKAEEAEKKRQAEAQK 483
  Q978J0 ---------------------------------------------------------------------------------------------------- 189

  A6NCL7 ERRTAPWKKRT 494
  Q978J0 ----------- 189

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0072114 pronephros morphogenesis
1. PB GO:0016055 Wnt signaling pathway
1. PB GO:0097543 ciliary inversin compartment
1. PB GO:0034587 piRNA metabolic process
1. PB GO:0030154 cell differentiation
1. PB GO:0032695 negative regulation of interleukin-12 production
1. PB GO:1904385 cellular response to angiotensin
1. PB GO:0035304 regulation of protein dephosphorylation
1. PB GO:1900127 positive regulation of hyaluronan biosynthetic process
1. PB GO:0071359 cellular response to dsRNA
1. PB GO:0042995 cell projection
1. PB GO:0071546 pi-body
1. PB GO:0071316 cellular response to nicotine
1. PB GO:0001822 kidney development
1. PB GO:0018230 peptidyl-L-cysteine S-palmitoylation
1. PB GO:0007283 spermatogenesis
1. PB GO:2000678 negative regulation of transcription regulatory region DNA binding
1. PB GO:0010956 negative regulation of calcidiol 1-monooxygenase activity
1. PB GO:0043065 positive regulation of apoptotic process
1. PB GO:1904632 cellular response to glucoside
1. PB GO:0016567 protein ubiquitination
1. PB GO:0007368 determination of left/right symmetry
1. PB GO:0043046 DNA methylation involved in gamete generation
1. PB GO:1904630 cellular response to diterpene
1. PB GO:0017020 myosin phosphatase regulator activity
1. PB GO:0072116 pronephros formation
1. PB GO:2000630 positive regulation of miRNA metabolic process
1. PB GO:0031901 early endosome membrane
1. PB GO:0019888 protein phosphatase regulator activity
1. PB GO:0010366 negative regulation of ethylene biosynthetic process
1. PB GO:0004842 ubiquitin-protein transferase activity
1. PB GO:0031047 gene silencing by RNA
1. PB GO:0060236 regulation of mitotic spindle organization
1. PB GO:0030660 Golgi-associated vesicle membrane
1. PB GO:0007140 male meiotic nuclear division
1. PB GO:0071354 cellular response to interleukin-6
1. PB GO:0035914 skeletal muscle cell differentiation
1. PB GO:0008157 protein phosphatase 1 binding
1. PB GO:0045807 positive regulation of endocytosis
1. PB GO:0042326 negative regulation of phosphorylation
1. PB GO:0005516 calmodulin binding
1. PB GO:0042802 identical protein binding
1. PB GO:0043066 negative regulation of apoptotic process
1. PB GO:1902412 regulation of mitotic cytokinesis
2. P GO:0001938 positive regulation of endothelial cell proliferation
2. P GO:0007080 mitotic metaphase plate congression
2. P GO:0090280 positive regulation of calcium ion import
2. P GO:0036312 phosphatidylinositol 3-kinase regulatory subunit binding
2. P GO:0001934 positive regulation of protein phosphorylation
2. P GO:0045121 membrane raft
2. P GO:0035307 positive regulation of protein dephosphorylation
2. P GO:0031122 cytoplasmic microtubule organization
2. P GO:0034123 positive regulation of toll-like receptor signaling pathway
2. P GO:1903670 regulation of sprouting angiogenesis
2. P GO:1990416 cellular response to brain-derived neurotrophic factor stimulus
2. P GO:0035308 negative regulation of protein dephosphorylation
2. P GO:0005262 calcium channel activity
2. P GO:0008017 microtubule binding
2. P GO:0008219 cell death
2. P GO:0036372 opsin transport
2. P GO:0051489 regulation of filopodium assembly
2. P GO:0031116 positive regulation of microtubule polymerization
2. P GO:0098703 calcium ion import across plasma membrane
2. P GO:0005795 Golgi stack
2. P GO:0034134 toll-like receptor 2 signaling pathway
2. P GO:0000922 spindle pole
2. P GO:0005216 ion channel activity
2. P GO:2000637 positive regulation of gene silencing by miRNA
2. P GO:1903078 positive regulation of protein localization to plasma membrane
2. P GO:0098840 protein transport along microtubule
2. P GO:0007417 central nervous system development
2. P GO:0005802 trans-Golgi network
2. P GO:0005783 endoplasmic reticulum
2. P GO:0071322 cellular response to carbohydrate stimulus
2. P GO:0055038 recycling endosome membrane
2. P GO:0036464 cytoplasmic ribonucleoprotein granule
2. P GO:0030950 establishment or maintenance of actin cytoskeleton polarity
2. P GO:0014068 positive regulation of phosphatidylinositol 3-kinase signaling
2. P GO:0034162 toll-like receptor 9 signaling pathway
2. P GO:0033391 chromatoid body
2. P GO:0031154 culmination involved in sorocarp development
2. P GO:0032588 trans-Golgi network membrane
2. P GO:0030176 integral component of endoplasmic reticulum membrane
2. P GO:0034154 toll-like receptor 7 signaling pathway
2. P GO:1902309 negative regulation of peptidyl-serine dephosphorylation
2. P GO:0042636 negative regulation of hair cycle
2. P GO:0042417 dopamine metabolic process
2. P GO:0034142 toll-like receptor 4 signaling pathway
2. P GO:0051010 microtubule plus-end binding
2. P GO:0034967 Set3 complex
2. P GO:0010469 regulation of signaling receptor activity
2. P GO:0034122 negative regulation of toll-like receptor signaling pathway
2. P GO:2000209 regulation of anoikis
2. P GO:0044091 membrane biogenesis
2. P GO:0010828 positive regulation of glucose transmembrane transport
2. P GO:0005819 spindle
2. P GO:0005102 signaling receptor binding
2. P GO:0007084 mitotic nuclear membrane reassembly
2. P GO:0031115 negative regulation of microtubule polymerization
2. P GO:0061028 establishment of endothelial barrier
2. P GO:0051865 protein autoubiquitination
2. P GO:0051721 protein phosphatase 2A binding
2. P GO:0010171 body morphogenesis
2. P GO:0010311 lateral root formation
2. P GO:0045444 fat cell differentiation
2. P GO:0014066 regulation of phosphatidylinositol 3-kinase signaling
2. P GO:0005789 endoplasmic reticulum membrane
2. P GO:1903589 positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis
2. P GO:0016740 transferase activity
2. P GO:0046928 regulation of neurotransmitter secretion
2. P GO:0002523 leukocyte migration involved in inflammatory response
2. P GO:0048471 perinuclear region of cytoplasm
2. P GO:0060027 convergent extension involved in gastrulation
2. P GO:0006621 protein retention in ER lumen
2. P GO:0035371 microtubule plus-end
2. P GO:0035594 ganglioside binding
2. P GO:0042281 dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase activity
2. P GO:0035844 cloaca development
2. P GO:0050727 regulation of inflammatory response
2. P GO:1901653 cellular response to peptide
2. P GO:0090083 regulation of inclusion body assembly
3. B GO:0034058 endosomal vesicle fusion
3. B GO:0005770 late endosome
3. B GO:0030837 negative regulation of actin filament polymerization
3. B GO:0071286 cellular response to magnesium ion
3. B GO:0090309 positive regulation of DNA methylation-dependent heterochromatin assembly
3. B GO:0034765 regulation of ion transmembrane transport
3. B GO:0007094 mitotic spindle assembly checkpoint signaling
3. B GO:0071625 vocalization behavior
3. B GO:0042006 masculinization of hermaphroditic germ-line
3. B GO:0000122 negative regulation of transcription by RNA polymerase II
3. B GO:0050729 positive regulation of inflammatory response
3. B GO:0060292 long-term synaptic depression
3. B GO:0090037 positive regulation of protein kinase C signaling
3. B GO:0051835 positive regulation of synapse structural plasticity
3. B GO:0043034 costamere
3. B GO:0006511 ubiquitin-dependent protein catabolic process
3. B GO:0032456 endocytic recycling
3. B GO:0007626 locomotory behavior
3. B GO:0001701 in utero embryonic development
3. B GO:0030046 parallel actin filament bundle assembly
3. B GO:0072104 glomerular capillary formation
3. B GO:0046843 dorsal appendage formation
3. B GO:0051059 NF-kappaB binding
3. B GO:0036166 phenotypic switching
3. B GO:0070563 negative regulation of vitamin D receptor signaling pathway
3. B GO:0030334 regulation of cell migration
3. B GO:0032421 stereocilium bundle
3. B GO:0001756 somitogenesis
3. B GO:0046469 platelet activating factor metabolic process
3. B GO:0007605 sensory perception of sound
3. B GO:2001259 positive regulation of cation channel activity
3. B GO:0039022 pronephric duct development
3. B GO:0070372 regulation of ERK1 and ERK2 cascade
3. B GO:0033184 positive regulation of histone ubiquitination
3. B GO:0019731 antibacterial humoral response
3. B GO:0005576 extracellular region
3. B GO:0002087 regulation of respiratory gaseous exchange by nervous system process
3. B GO:0019887 protein kinase regulator activity
3. B GO:0006306 DNA methylation
3. B GO:0097190 apoptotic signaling pathway
3. B GO:0046974 histone methyltransferase activity (H3-K9 specific)
3. B GO:0039513 suppression by virus of host catalytic activity
3. B GO:0018024 histone-lysine N-methyltransferase activity
3. B GO:0045814 negative regulation of gene expression, epigenetic
3. B GO:0047499 calcium-independent phospholipase A2 activity
3. B GO:0030018 Z disc
3. B GO:0042805 actinin binding
3. B GO:0051494 negative regulation of cytoskeleton organization
3. B GO:0048259 regulation of receptor-mediated endocytosis
3. B GO:0003950 NAD+ ADP-ribosyltransferase activity
3. B GO:0032420 stereocilium
3. B GO:0010957 negative regulation of vitamin D biosynthetic process
3. B GO:0050885 neuromuscular process controlling balance
3. B GO:0021519 spinal cord association neuron specification
3. B GO:0015095 magnesium ion transmembrane transporter activity
3. B GO:0036377 arbuscular mycorrhizal association
3. B GO:0045611 negative regulation of hemocyte differentiation
3. B GO:2000822 regulation of behavioral fear response
3. B GO:0043063 intercellular bridge organization
3. B GO:0046473 phosphatidic acid metabolic process
3. B GO:0045737 positive regulation of cyclin-dependent protein serine/threonine kinase activity
3. B GO:0099612 protein localization to axon
3. B GO:1902041 regulation of extrinsic apoptotic signaling pathway via death domain receptors
3. B GO:0047395 glycerophosphoinositol glycerophosphodiesterase activity
3. B GO:0005524 ATP binding
3. B GO:0033257 Bcl3/NF-kappaB2 complex
3. B GO:0007416 synapse assembly
3. B GO:0034968 histone lysine methylation
3. B GO:0007612 learning
3. B GO:0016571 histone methylation
3. B GO:0043254 regulation of protein-containing complex assembly
3. B GO:0035641 locomotory exploration behavior
3. B GO:2000291 regulation of myoblast proliferation
3. B GO:0030674 protein-macromolecule adaptor activity
3. B GO:0046338 phosphatidylethanolamine catabolic process
3. B GO:0071260 cellular response to mechanical stimulus
3. B GO:0010765 positive regulation of sodium ion transport
3. B GO:0097422 tubular endosome
3. B GO:0018027 peptidyl-lysine dimethylation
3. B GO:0035176 social behavior
3. B GO:0035690
3. B GO:0010960 magnesium ion homeostasis
3. B GO:0048549 positive regulation of pinocytosis
3. B GO:0001650 fibrillar center
3. B GO:0030534 adult behavior
3. B GO:0008542 visual learning
3. B GO:0072659 protein localization to plasma membrane
3. B GO:0042826 histone deacetylase binding
3. B GO:0086015 SA node cell action potential
3. B GO:0032466 negative regulation of cytokinesis
3. B GO:1990090 cellular response to nerve growth factor stimulus
3. B GO:0005886 plasma membrane
3. B GO:0035418 protein localization to synapse
3. B GO:1990404 protein ADP-ribosylase activity
3. B GO:0097107 postsynaptic density assembly
3. B GO:0007520 myoblast fusion
3. B GO:0035646 endosome to melanosome transport
3. B GO:0002039 p53 binding
3. B GO:0031234 extrinsic component of cytoplasmic side of plasma membrane
3. B GO:0031286 negative regulation of sorocarp stalk cell differentiation
3. B GO:0090212 negative regulation of establishment of blood-brain barrier
3. B GO:0001841 neural tube formation
3. B GO:0048899 anterior lateral line development
3. B GO:0033147 negative regulation of intracellular estrogen receptor signaling pathway
3. B GO:0001222 transcription corepressor binding
3. B GO:0042734 presynaptic membrane
3. B GO:0007009 plasma membrane organization
3. B GO:2000393 negative regulation of lamellipodium morphogenesis
3. B GO:0043292 contractile fiber
3. B GO:0032996 Bcl3-Bcl10 complex
3. B GO:0031462 Cul2-RING ubiquitin ligase complex
3. B GO:0043517 positive regulation of DNA damage response, signal transduction by p53 class mediator
3. B GO:0019843 rRNA binding
3. B GO:0070212 protein poly-ADP-ribosylation
3. B GO:1900271 regulation of long-term synaptic potentiation
3. B GO:0018026 peptidyl-lysine monomethylation
3. B GO:0005123 death receptor binding
3. B GO:0032426 stereocilium tip
3. B GO:0008608 attachment of spindle microtubules to kinetochore
3. B GO:0043409 negative regulation of MAPK cascade
3. B GO:0000151 ubiquitin ligase complex
3. B GO:1900273 positive regulation of long-term synaptic potentiation
3. B GO:0030160 synaptic receptor adaptor activity
3. B GO:0043008 ATP-dependent protein binding
3. B GO:0019228 neuronal action potential
3. B GO:0072073 kidney epithelium development
3. B GO:0051569 regulation of histone H3-K4 methylation
3. B GO:0004622 lysophospholipase activity
3. B GO:0035023 regulation of Rho protein signal transduction
3. B GO:0072357 PTW/PP1 phosphatase complex
3. B GO:0009925 basal plasma membrane
3. B GO:0043086 negative regulation of catalytic activity
3. B GO:0005764 lysosome
3. B GO:0008022 protein C-terminus binding
3. B GO:0010650 positive regulation of cell communication by electrical coupling
3. B GO:0050894 determination of affect
3. B GO:0000209 protein polyubiquitination
3. B GO:0097546 ciliary base
3. B GO:0001947 heart looping
3. B GO:0099562 maintenance of postsynaptic density structure
3. B GO:0090201 negative regulation of release of cytochrome c from mitochondria
3. B GO:0002027 regulation of heart rate
3. B GO:0021773 striatal medium spiny neuron differentiation
3. B GO:0010638 positive regulation of organelle organization
3. B GO:0045874 positive regulation of sevenless signaling pathway
3. B GO:0060998 regulation of dendritic spine development
3. B GO:0044325 transmembrane transporter binding
3. B GO:0006897 endocytosis
3. B GO:0070650 actin filament bundle distribution
3. B GO:0005634 nucleus
3. B GO:0055008 cardiac muscle tissue morphogenesis
3. B GO:1901339 regulation of store-operated calcium channel activity
3. B GO:0006887 exocytosis
3. B GO:0071314 cellular response to cocaine
3. B GO:2000096 positive regulation of Wnt signaling pathway, planar cell polarity pathway
3. B GO:0046875 ephrin receptor binding
3. B GO:0016604 nuclear body
3. B GO:1904357 negative regulation of telomere maintenance via telomere lengthening
3. B GO:0002789 negative regulation of antifungal peptide production
3. B GO:1900246 positive regulation of RIG-I signaling pathway
3. B GO:0098907 regulation of SA node cell action potential
3. B GO:0003408 optic cup formation involved in camera-type eye development
3. B GO:0070528 protein kinase C signaling
3. B GO:0060999 positive regulation of dendritic spine development
3. B GO:0007253 cytoplasmic sequestering of NF-kappaB
3. B GO:1901981 phosphatidylinositol phosphate binding
3. B GO:0035965 cardiolipin acyl-chain remodeling
3. B GO:0001568 blood vessel development
3. B GO:0003677 DNA binding
3. B GO:0031594 neuromuscular junction
3. B GO:0030155 regulation of cell adhesion
3. B GO:0086014 atrial cardiac muscle cell action potential
3. B GO:0016409 palmitoyltransferase activity
3. B GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus
3. B GO:1902911 protein kinase complex
3. B GO:0090461 glutamate homeostasis
3. B GO:0070213 protein auto-ADP-ribosylation
3. B GO:0004672 protein kinase activity
3. B GO:0030507 spectrin binding
3. B GO:0043518 negative regulation of DNA damage response, signal transduction by p53 class mediator
3. B GO:0031877 somatostatin receptor binding
3. B GO:0033292 T-tubule organization
3. B GO:0005769 early endosome
3. B GO:1904908 negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric
3. B GO:0036369 transcription factor catabolic process
3. B GO:0071356 cellular response to tumor necrosis factor
3. B GO:0047389 glycerophosphocholine phosphodiesterase activity
3. B GO:0045665 negative regulation of neuron differentiation
3. B GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
3. B GO:0071532 ankyrin repeat binding
3. B GO:0070682 proteasome regulatory particle assembly
3. B GO:0070936 protein K48-linked ubiquitination
3. B GO:1904108 protein localization to ciliary inversin compartment
3. B GO:0009950 dorsal/ventral axis specification
3. B GO:0070412 R-SMAD binding
3. B GO:0140439 protein-cysteine S-stearoyltransferase activity
3. B GO:1900245 positive regulation of MDA-5 signaling pathway
3. B GO:0051438 regulation of ubiquitin-protein transferase activity
3. B GO:0006915 apoptotic process
3. B GO:0031143 pseudopodium
3. B GO:0051017 actin filament bundle assembly
3. B GO:0097114 NMDA glutamate receptor clustering
3. B GO:0046475 glycerophospholipid catabolic process
3. B GO:0000792 heterochromatin
3. B GO:0048148 behavioral response to cocaine
3. B GO:0014832 urinary bladder smooth muscle contraction
3. B GO:0071889 14-3-3 protein binding
3. B GO:0014069 postsynaptic density
3. B GO:0007616 long-term memory
3. B GO:0090521 glomerular visceral epithelial cell migration
3. B GO:0002268 follicular dendritic cell differentiation
3. B GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B GO:0045944 positive regulation of transcription by RNA polymerase II
3. B GO:0071407 cellular response to organic cyclic compound
3. B GO:0031867 EP4 subtype prostaglandin E2 receptor binding
3. B GO:0000776 kinetochore
3. B GO:0039644 suppression by virus of host NF-kappaB cascade
3. B GO:0099092 postsynaptic density, intracellular component
3. B GO:0005249 voltage-gated potassium channel activity
3. B GO:0045211 postsynaptic membrane
3. B GO:0043266 regulation of potassium ion transport
3. B GO:0010976 positive regulation of neuron projection development
3. B GO:0031941 filamentous actin
3. B GO:0051091 positive regulation of DNA-binding transcription factor activity
3. B GO:0001838 embryonic epithelial tube formation
3. B GO:1902902 negative regulation of autophagosome assembly
3. B GO:2000651 positive regulation of sodium ion transmembrane transporter activity
3. B GO:0051967 negative regulation of synaptic transmission, glutamatergic
3. B GO:0061195 taste bud formation
3. B GO:0031398 positive regulation of protein ubiquitination
3. B GO:0018345 protein palmitoylation
3. B GO:0140031 phosphorylation-dependent protein binding
3. B GO:0051306 mitotic sister chromatid separation
3. B GO:0015271 outward rectifier potassium channel activity
3. B GO:0043619 regulation of transcription from RNA polymerase II promoter in response to oxidative stress
3. B GO:0071212 subsynaptic reticulum
3. B GO:2000304 positive regulation of ceramide biosynthetic process
3. B GO:0031670 cellular response to nutrient
3. B GO:0019208 phosphatase regulator activity
3. B GO:0090090 negative regulation of canonical Wnt signaling pathway
3. B GO:0048663 neuron fate commitment
3. B GO:0030016 myofibril
3. B GO:0030315 T-tubule
3. B GO:0060743 epithelial cell maturation involved in prostate gland development
3. B GO:0055117 regulation of cardiac muscle contraction
3. B GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
3. B GO:0006929 substrate-dependent cell migration
3. B GO:0043280 positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
3. B GO:0034451 centriolar satellite
3. B GO:1905936 regulation of germ cell proliferation
3. B GO:0007409 axonogenesis
3. B GO:0090263 positive regulation of canonical Wnt signaling pathway
3. B GO:0045171 intercellular bridge
3. B GO:0035255 ionotropic glutamate receptor binding
3. B GO:0032091 negative regulation of protein binding
3. B GO:0043069 negative regulation of programmed cell death
3. B GO:1902260 negative regulation of delayed rectifier potassium channel activity
3. B GO:0008306 associative learning
3. B GO:0031430 M band
3. B GO:0007394 dorsal closure, elongation of leading edge cells
3. B GO:0070198 protein localization to chromosome, telomeric region
3. B GO:0090238 positive regulation of arachidonic acid secretion
3. B GO:0045751 negative regulation of Toll signaling pathway
3. B GO:2000969 positive regulation of AMPA receptor activity
3. B GO:0007030 Golgi organization
3. B GO:0102545 phosphatidyl phospholipase B activity
3. B GO:0097062 dendritic spine maintenance
3. B GO:0031672 A band
3. B GO:0045869 negative regulation of single stranded viral RNA replication via double stranded DNA intermediate
3. B GO:0045838 positive regulation of membrane potential
3. B GO:0005929 cilium
3. B GO:0098910 regulation of atrial cardiac muscle cell action potential
3. B GO:0036371 protein localization to T-tubule
3. B GO:0043194 axon initial segment
3. B GO:0044030 regulation of DNA methylation
3. B GO:0060076 excitatory synapse
3. B GO:0070742 C2H2 zinc finger domain binding
3. B GO:0140627 ubiquitin-dependent protein catabolic process via the C-end degron rule pathway
3. B GO:0016279 protein-lysine N-methyltransferase activity
3. B GO:0007613 memory
3. B GO:2000812 regulation of barbed-end actin filament capping
3. B GO:0010424 DNA methylation on cytosine within a CG sequence
3. B GO:0007165 signal transduction
3. B GO:1904355 positive regulation of telomere capping
3. B GO:0014731 spectrin-associated cytoskeleton
3. B GO:0044309 neuron spine
3. B GO:0033270 paranode region of axon
3. B GO:0098978 glutamatergic synapse
3. B GO:2000001 regulation of DNA damage checkpoint
3. B GO:0055013 cardiac muscle cell development
3. B GO:0071560 cellular response to transforming growth factor beta stimulus
3. B GO:0045184 establishment of protein localization
3. B GO:0061630 ubiquitin protein ligase activity
3. B GO:1901223 negative regulation of NIK/NF-kappaB signaling
3. B GO:0017124 SH3 domain binding
3. B GO:0003847 1-alkyl-2-acetylglycerophosphocholine esterase activity
3. B GO:0010882 regulation of cardiac muscle contraction by calcium ion signaling
3. B GO:0043005 neuron projection
3. B GO:2001257 regulation of cation channel activity
3. B GO:0098871 postsynaptic actin cytoskeleton
3. B GO:0046822 regulation of nucleocytoplasmic transport
3. B GO:0048170 positive regulation of long-term neuronal synaptic plasticity
3. B GO:0014704 intercalated disc
3. B GO:0097113 AMPA glutamate receptor clustering
3. B GO:0007098 centrosome cycle
3. B GO:0048854 brain morphogenesis
3. B GO:0019901 protein kinase binding
3. B GO:0039517 modulation by virus of host protein serine/threonine phosphatase activity
3. B GO:0046959 habituation
3. B GO:0001955 blood vessel maturation
3. B GO:0099519 dense core granule cytoskeletal transport
3. B GO:0007219 Notch signaling pathway
3. B GO:0017171 serine hydrolase activity
3. B GO:0035994 response to muscle stretch
3. B GO:0009610 response to symbiotic fungus
3. B GO:0016235 aggresome
3. B GO:0035265 organ growth
3. B GO:0010881 regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion
3. B GO:0032232 negative regulation of actin filament bundle assembly
3. B GO:0034638 phosphatidylcholine catabolic process
3. B GO:0042383 sarcolemma
3. B GO:0060297 regulation of sarcomere organization
3. B GO:0021546 rhombomere development
3. B GO:0050931 pigment cell differentiation
3. B GO:0043001 Golgi to plasma membrane protein transport
3. B GO:0046976 histone methyltransferase activity (H3-K27 specific)
3. B GO:0030029 actin filament-based process
3. B GO:1905274 regulation of modification of postsynaptic actin cytoskeleton
3. B GO:0032212 positive regulation of telomere maintenance via telomerase
3. B GO:0042297 vocal learning
3. B GO:2000310 regulation of NMDA receptor activity
3. B GO:0045794 negative regulation of cell volume
3. B GO:0005856 cytoskeleton
3. B GO:0061001 regulation of dendritic spine morphogenesis
3. B GO:1904717 regulation of AMPA glutamate receptor clustering
3. B GO:0042048 olfactory behavior
3. B GO:2000279 negative regulation of DNA biosynthetic process
3. B GO:0071222 cellular response to lipopolysaccharide
3. B GO:0071447 cellular response to hydroperoxide
3. B GO:0032580 Golgi cisterna membrane
3. B GO:0061025 membrane fusion
3. B GO:0051386 regulation of neurotrophin TRK receptor signaling pathway
3. B GO:0016529 sarcoplasmic reticulum
3. B GO:0097110 scaffold protein binding
3. B GO:1990393 3M complex
3. B GO:0045199 maintenance of epithelial cell apical/basal polarity
3. B GO:0051225 spindle assembly
3. B GO:0051497 negative regulation of stress fiber assembly
3. B GO:0060013 righting reflex
3. B GO:0099175 regulation of postsynapse organization
3. B GO:1990830 cellular response to leukemia inhibitory factor
3. B GO:0030159 signaling receptor complex adaptor activity
3. B GO:0005096 GTPase activator activity
3. B GO:0030034 microvillar actin bundle assembly
3. B GO:1904743 negative regulation of telomeric DNA binding
3. B GO:0071347 cellular response to interleukin-1
3. B GO:1900383 regulation of synaptic plasticity by receptor localization to synapse
3. B GO:0072660 maintenance of protein location in plasma membrane
3. B GO:0090314 positive regulation of protein targeting to membrane
3. B GO:0015629 actin cytoskeleton
3. B GO:1900451 positive regulation of glutamate receptor signaling pathway
3. B GO:0086004 regulation of cardiac muscle cell contraction
3. B GO:0031674 I band
3. B GO:0048013 ephrin receptor signaling pathway
3. B GO:2000134 negative regulation of G1/S transition of mitotic cell cycle
3. B GO:1901019 regulation of calcium ion transmembrane transporter activity
3. B GO:1903147 negative regulation of autophagy of mitochondrion
3. B GO:0043197 dendritic spine
3. B GO:0102991 myristoyl-CoA hydrolase activity
3. B GO:0045162 clustering of voltage-gated sodium channels
3. B GO:1901187 regulation of ephrin receptor signaling pathway
3. B GO:0008285 negative regulation of cell population proliferation
3. B GO:0050728 negative regulation of inflammatory response
3. B GO:0043054 dauer exit
3. B GO:0048920 posterior lateral line neuromast primordium migration
3. B GO:0036309 protein localization to M-band
3. B GO:0033268 node of Ranvier
3. B GO:0048665 neuron fate specification
3. B GO:0090200 positive regulation of release of cytochrome c from mitochondria
3. B GO:0050750 low-density lipoprotein particle receptor binding
3. B GO:0019705 protein-cysteine S-myristoyltransferase activity
3. B GO:0035507 regulation of myosin-light-chain-phosphatase activity
3. B GO:0050807 regulation of synapse organization
3. B GO:0008092 cytoskeletal protein binding
3. B GO:0097117 guanylate kinase-associated protein clustering
3. B GO:0086069 bundle of His cell to Purkinje myocyte communication
3. B GO:0098919 structural constituent of postsynaptic density
3. B GO:0045732 positive regulation of protein catabolic process
3. B GO:0002357 defense response to tumor cell
3. B GO:0071709 membrane assembly
3. B GO:0002070 epithelial cell maturation
3. B GO:0045921 positive regulation of exocytosis
3. B GO:0043422 protein kinase B binding
3. B GO:0085042 periarbuscular membrane
3. B GO:1990756 ubiquitin ligase-substrate adaptor activity
3. B GO:0060992 response to fungicide
3. B GO:2000463 positive regulation of excitatory postsynaptic potential
3. B GO:0016290 palmitoyl-CoA hydrolase activity
3. B GO:0031432 titin binding
3. B GO:0014732 skeletal muscle atrophy
3. B GO:0030673 axolemma
3. B GO:0051968 positive regulation of synaptic transmission, glutamatergic
3. B GO:0019899 enzyme binding
3. B GO:0016322 neuron remodeling
3. B GO:0034112 positive regulation of homotypic cell-cell adhesion
3. B GO:0001967 suckling behavior
3. B GO:0060361 flight
3. B GO:1902554 serine/threonine protein kinase complex
3. B GO:0099173 postsynapse organization
3. B GO:0060442 branching involved in prostate gland morphogenesis
3. B GO:0051570 regulation of histone H3-K9 methylation
3. B GO:0006471 protein ADP-ribosylation
3. B GO:0060582 cell fate determination involved in pattern specification
3. B GO:0004857 enzyme inhibitor activity
3. B GO:0086070 SA node cell to atrial cardiac muscle cell communication
3. B GO:1900452 regulation of long-term synaptic depression
3. B GO:1902253 regulation of intrinsic apoptotic signaling pathway by p53 class mediator
3. B GO:0060997 dendritic spine morphogenesis
3. B GO:1901018 positive regulation of potassium ion transmembrane transporter activity
3. B GO:0050714 positive regulation of protein secretion
3. B GO:0060135 maternal process involved in female pregnancy
3. B GO:2000311 regulation of AMPA receptor activity
3. B GO:0070972 protein localization to endoplasmic reticulum
3. B GO:0090160 Golgi to lysosome transport
3. B GO:0038180 nerve growth factor signaling pathway
3. B GO:0043268 positive regulation of potassium ion transport
3. B GO:0086066 atrial cardiac muscle cell to AV node cell communication
3. B GO:1901021 positive regulation of calcium ion transmembrane transporter activity
3. B GO:0042981 regulation of apoptotic process
3. B GO:0031267 small GTPase binding
3. B GO:0016021 integral component of membrane
3. B GO:0060035 notochord cell development
3. B GO:0021654 rhombomere boundary formation
3. B GO:0045685 regulation of glial cell differentiation
3. B GO:0033256 I-kappaB/NF-kappaB complex
3. B GO:0051151 negative regulation of smooth muscle cell differentiation
3. B GO:0043293 apoptosome
3. B GO:0005829 cytosol
3. B GO:0046872 metal ion binding
3. B GO:0004861 cyclin-dependent protein serine/threonine kinase inhibitor activity
3. B GO:0035544 negative regulation of SNARE complex assembly
3. B GO:0035508 positive regulation of myosin-light-chain-phosphatase activity
3. B GO:0003779 actin binding
3. B GO:0007528 neuromuscular junction development
3. B GO:0000062 fatty-acyl-CoA binding
3. B GO:2000821 regulation of grooming behavior
3. B GO:0000139 Golgi membrane
3. B GO:1900827 positive regulation of membrane depolarization during cardiac muscle cell action potential
3. B GO:0035556 intracellular signal transduction
3. B GO:0048892 lateral line nerve development
3. B GO:0032049 cardiolipin biosynthetic process
3. B GO:0008093 cytoskeletal anchor activity
3. B GO:0019706 protein-cysteine S-palmitoyltransferase activity
3. B GO:0048916 posterior lateral line development
3. B GO:0019730 antimicrobial humoral response
3. B GO:0005938 cell cortex
3. B GO:0035640 exploration behavior
3. B GO:0044354 macropinosome
3. B GO:0060074 synapse maturation
3. B GO:0032088 negative regulation of NF-kappaB transcription factor activity
3. B GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q2QLC6 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.13e-02 9.55e-05 0.037
1. PB Q2IBB4 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.46e-03 4.16e-05 0.015
1. PB Q6KAE5 Probable E3 ubiquitin-protein ligase XBOS32 3.00e-04 2.70e-04 8.12e-06
1. PB Q8N9V6 Ankyrin repeat domain-containing protein 53 1.62e-03 1.05e-18 4.00e-04
1. PB A2ARS0 Ankyrin repeat domain-containing protein 63 4.54e-04 9.47e-12 6.01e-10
1. PB Q3U0L2 Ankyrin repeat domain-containing protein 33B 6.73e-09 1.41e-88 0.0
1. PB Q09YN0 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 6.32e-03 1.42e-05 0.011
1. PB Q54KA7 Ankyrin repeat, PH and SEC7 domain containing protein secG 1.21e-02 7.21e-04 9.45e-07
1. PB Q65XV2 E3 ubiquitin-protein ligase XB3 3.22e-04 2.95e-08 0.003
1. PB Q337A0 Probable E3 ubiquitin-protein ligase XBOS33 6.11e-04 4.56e-05 5.81e-04
1. PB Q96I34 Protein phosphatase 1 regulatory subunit 16A 1.91e-02 2.78e-12 0.046
1. PB P0C0T2 Ankyrin repeat and SAM domain-containing protein 6 7.47e-03 3.79e-02 1.42e-07
1. PB H3BUK9 POTE ankyrin domain family member B2 2.51e-02 7.68e-06 3.75e-04
1. PB P40480 Protein HOS4 1.33e-02 4.65e-04 1.79e-10
1. PB Q09YI3 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 3.14e-03 1.27e-04 0.012
1. PB Q8BXP5 Photoreceptor ankyrin repeat protein 4.04e-07 3.01e-21 5.83e-71
1. PB Q6AWW5 Ankyrin repeat-containing protein At5g02620 8.00e-04 6.70e-03 0.004
1. PB Q4FE45 E3 ubiquitin-protein ligase XBAT33 5.81e-04 3.15e-06 0.005
1. PB Q8WMX8 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.48e-03 2.86e-04 0.012
1. PB Q07E43 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 5.14e-03 5.96e-05 6.51e-04
1. PB A0A0A6YYL3 POTE ankyrin domain family member B 3.36e-03 7.68e-06 3.75e-04
1. PB Q07E30 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 5.69e-03 2.00e-05 0.025
1. PB Q6S8J7 POTE ankyrin domain family member A 5.22e-04 1.71e-06 0.013
1. PB Q2QLA4 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 5.53e-04 3.14e-05 0.017
1. PB Q94B55 Putative E3 ubiquitin-protein ligase XBAT31 4.18e-04 4.99e-09 0.006
1. PB Q3KP44 Ankyrin repeat domain-containing protein 55 1.50e-03 2.94e-13 4.72e-05
1. PB Q7EZ44 Probable E3 ubiquitin-protein ligase XBOS35 2.81e-04 7.51e-08 8.93e-06
1. PB Q68DC2 Ankyrin repeat and SAM domain-containing protein 6 6.36e-03 2.09e-03 1.01e-07
1. PB A6NCL7 Ankyrin repeat domain-containing protein 33B 0 2.20e-160 0.0
1. PB A1X154 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 4.14e-03 3.82e-04 0.014
1. PB C9JTQ0 Ankyrin repeat domain-containing protein 63 1.89e-03 5.73e-13 4.33e-10
1. PB Q71S21 Inversin-B 1.01e-01 2.14e-06 8.46e-04
1. PB Q8UVC1 Inversin 1.26e-02 2.92e-02 1.83e-05
1. PB Q8BLD6 Ankyrin repeat domain-containing protein 55 2.33e-03 3.68e-14 0.003
1. PB Q71S22 Inversin-A 5.75e-03 1.13e-04 9.34e-07
1. PB Q2QLH1 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 4.02e-03 2.66e-05 0.044
1. PB Q3V096 Ankyrin repeat domain-containing protein 42 9.52e-04 1.09e-06 0.025
1. PB Q4R739 Ankyrin repeat domain-containing protein 53 3.38e-03 2.47e-18 0.001
1. PB Q07E17 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.14e-02 6.98e-04 0.023
1. PB Q6NLQ8 E3 ubiquitin-protein ligase XBAT32 9.66e-04 2.68e-08 1.50e-04
1. PB Q63369 Nuclear factor NF-kappa-B p105 subunit (Fragment) 1.55e-03 2.04e-12 0.002
1. PB Q7Z3H0 Photoreceptor ankyrin repeat protein 2.49e-06 3.29e-30 7.88e-67
1. PB A0M8T3 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 3.40e-04 2.00e-05 0.049
1. PB Q09YJ5 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.94e-03 9.46e-04 0.011
1. PB Q923M0 Protein phosphatase 1 regulatory subunit 16A 5.36e-04 7.61e-11 0.008
2. P Q8VHQ3 Protein phosphatase 1 regulatory inhibitor subunit 16B 2.55e-03 7.03e-08 NA
2. P Q09YK6 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 3.25e-03 1.93e-05 NA
2. P Q8K424 Transient receptor potential cation channel subfamily V member 3 5.99e-03 3.15e-03 NA
2. P Q8WMX6 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.32e-03 6.26e-04 NA
2. P Q9ZU96 Ankyrin repeat-containing protein At2g01680 8.55e-05 3.88e-03 NA
2. P Q04749 Target of rapamycin complex 2 subunit AVO2 3.73e-04 4.60e-07 NA
2. P Q810N6 Ankyrin repeat domain-containing protein 45 1.56e-03 1.27e-04 NA
2. P Q99ME3 Synphilin-1 4.26e-02 2.68e-10 NA
2. P Q07DY6 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 7.74e-04 2.26e-04 NA
2. P Q5U243 CAP-Gly domain-containing linker protein 3 1.50e-02 6.56e-06 NA
2. P Q8WWH4 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 8.63e-04 6.61e-04 NA
2. P Q96DZ5 CAP-Gly domain-containing linker protein 3 1.64e-02 1.11e-08 NA
2. P Q7ZYD9 Ankyrin repeat domain-containing protein 13C-B 2.72e-02 2.75e-02 NA
2. P Q2QL84 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 8.05e-03 2.56e-04 NA
2. P Q07DX6 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 2.11e-04 1.17e-03 NA
2. P Q94CT7 Probable E3 ubiquitin-protein ligase XBOS31 1.27e-03 6.16e-08 NA
2. P Q2QLG0 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 3.63e-03 3.88e-06 NA
2. P Q07DV3 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.61e-03 4.86e-04 NA
2. P Q2QLB5 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 6.43e-04 5.37e-05 NA
2. P Q66HD5 CAP-Gly domain-containing linker protein 4 6.36e-02 2.24e-02 NA
2. P Q9FKV5 Protein POLLENLESS 3-LIKE 1 1.13e-01 9.96e-03 NA
2. P Q9UU77 Ankyrin repeat-containing protein P1E11.10 9.09e-04 4.39e-02 NA
2. P Q6P1H6 Ankyrin repeat and LEM domain-containing protein 2 6.71e-02 4.90e-06 NA
2. P Q86XL3 Ankyrin repeat and LEM domain-containing protein 2 2.46e-02 1.38e-07 NA
2. P Q6NRD0 Ankyrin repeat domain-containing protein 13C-A 1.97e-02 3.00e-02 NA
2. P Q07DZ7 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 3.07e-04 1.98e-03 NA
2. P Q7TP65 Ankyrin repeat and LEM domain-containing protein 2 2.06e-01 2.31e-05 NA
2. P Q8WMX7 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 4.93e-04 2.24e-04 NA
2. P Q9EQ32 Phosphoinositide 3-kinase adapter protein 1 3.32e-01 3.12e-04 NA
2. P Q09YH1 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 8.84e-03 7.78e-06 NA
2. P Q2IBG0 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 9.54e-04 1.61e-04 NA
2. P Q5R686 CAP-Gly domain-containing linker protein 3 6.69e-03 9.29e-09 NA
2. P Q96T49 Protein phosphatase 1 regulatory inhibitor subunit 16B 3.33e-04 8.26e-07 NA
2. P B9EHT4 CAP-Gly domain-containing linker protein 3 4.11e-02 4.92e-09 NA
2. P Q8NET8 Transient receptor potential cation channel subfamily V member 3 2.43e-02 1.63e-02 NA
2. P Q4R690 Palmitoyltransferase ZDHHC13 6.67e-04 4.93e-02 NA
2. P Q91ZU1 Ankyrin repeat and SOCS box protein 6 6.35e-03 2.27e-03 NA
2. P Q6TNT2 Ankyrin repeat domain-containing protein 46 6.36e-04 3.58e-02 NA
2. P Q3UX43 Ankyrin repeat domain-containing protein 13C 5.42e-02 1.22e-06 NA
2. P Q5TZF3 Ankyrin repeat domain-containing protein 45 2.97e-03 1.08e-08 NA
2. P P25631 Ankyrin repeat-containing protein YCR051W 2.08e-03 3.27e-04 NA
2. P H2KZB2 Ankyrin repeat and LEM domain-containing protein 2 homolog 2.46e-02 2.58e-08 NA
2. P Q00PJ3 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 4.08e-03 7.59e-05 NA
2. P Q6R795 Uncharacterized protein ORF116 NA 1.71e-03 NA
2. P A2CIR5 Ankyrin repeat-containing protein NPR4 3.65e-04 1.38e-03 NA
2. P Q95N27 Protein phosphatase 1 regulatory inhibitor subunit 16B 7.03e-04 1.32e-07 NA
2. P Q9C7A2 Ankyrin repeat-containing protein ITN1 2.84e-03 1.52e-02 NA
2. P Q8N6S4 Ankyrin repeat domain-containing protein 13C 2.42e-01 3.45e-05 NA
2. P Q6ZUJ8 Phosphoinositide 3-kinase adapter protein 1 6.21e-01 1.49e-04 NA
2. P Q6R798 Uncharacterized protein ORF119 NA 9.18e-03 NA
2. P Q3V0J4 Ankyrin repeat domain-containing protein 53 2.02e-03 3.38e-16 NA
2. P Q2IBF5 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 7.44e-04 5.03e-04 NA
2. P Q99LW0 Ankyrin repeat domain-containing protein 10 6.25e-03 8.13e-03 NA
2. P Q6NSI1 Putative ankyrin repeat domain-containing protein 26-like protein 4.95e-04 4.40e-11 NA
2. P Q108U1 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 4.90e-04 6.56e-06 NA
2. P Q2IBE3 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 2.43e-03 4.86e-04 NA
2. P Q9Y6H5 Synphilin-1 5.14e-02 2.44e-08 NA
2. P A4D7T3 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.35e-04 4.58e-03 NA
2. P Q1RJX2 Putative ankyrin repeat protein RBE_0261 2.47e-02 5.93e-04 NA
2. P Q28C34 Ankyrin repeat domain-containing protein 13C 9.36e-02 2.24e-02 NA
2. P A6NFN9 Protein ANKUB1 4.41e-03 8.86e-04 NA
2. P Q8VD46 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 4.06e-04 1.12e-05 NA
2. P Q2IBB1 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 2.62e-03 2.56e-04 NA
2. P Q83DF6 Putative ankyrin repeat protein CBU_0781 9.29e-04 7.50e-06 NA
3. B A2VDR2 Acyl-CoA-binding domain-containing protein 6 1.19e-03 NA 7.59e-05
3. B Q8BX02 KN motif and ankyrin repeat domain-containing protein 2 6.95e-03 NA 2.05e-09
3. B Q00PJ1 Cortactin-binding protein 2 1.52e-01 NA 5.93e-07
3. B Q9VCA8 Ankyrin repeat and KH domain-containing protein mask NA NA 3.34e-10
3. B Q8IUH5 Palmitoyltransferase ZDHHC17 1.43e-03 NA 3.91e-04
3. B F1MJR8 Inactive serine/threonine-protein kinase TEX14 2.90e-01 NA 3.70e-04
3. B Q25338 Delta-latroinsectotoxin-Lt1a 8.48e-02 NA 3.53e-07
3. B Q15327 Ankyrin repeat domain-containing protein 1 1.48e-04 NA 7.37e-05
3. B P59672 Ankyrin repeat and SAM domain-containing protein 1A 2.69e-02 NA 6.05e-05
3. B Q6AFL2 Putative ankyrin-containing lipoprotein Lxx09580 2.68e-04 NA 3.49e-04
3. B O14974 Protein phosphatase 1 regulatory subunit 12A 9.80e-02 NA 0.037
3. B Q99NH0 Ankyrin repeat domain-containing protein 17 2.51e-01 NA 1.16e-08
3. B Q86YT6 E3 ubiquitin-protein ligase MIB1 3.50e-02 NA 7.38e-04
3. B P57078 Receptor-interacting serine/threonine-protein kinase 4 4.97e-03 NA 5.28e-04
3. B Q6P9J5 KN motif and ankyrin repeat domain-containing protein 4 2.22e-02 NA 1.10e-04
3. B Q499M5 Ankyrin repeat domain-containing protein 16 2.58e-03 NA 0.001
3. B O89019 Inversin 2.14e-02 NA 1.19e-04
3. B P0C6P7 Protein fem-1 homolog B 5.57e-03 NA 0.001
3. B Q8CEF1 Protein fem-1 homolog C 8.75e-03 NA 7.10e-08
3. B D3J162 Protein VAPYRIN 3.01e-02 NA 0.002
3. B Q0P5B9 Ankyrin repeat domain-containing protein 39 1.30e-06 NA 0.001
3. B Q69ZU8 Ankyrin repeat domain-containing protein 6 3.56e-03 NA 4.33e-06
3. B Q06527 Ankyrin homolog 5.40e-04 NA 1.80e-06
3. B Q9UM47 Neurogenic locus notch homolog protein 3 4.57e-01 NA 0.010
3. B Q01317 Ankyrin repeat protein nuc-2 5.65e-02 NA 0.001
3. B P14585 Protein lin-12 1.87e-01 NA 0.001
3. B Q60773 Cyclin-dependent kinase 4 inhibitor D 6.92e-09 NA 0.047
3. B Q2IBB2 Cortactin-binding protein 2 3.87e-01 NA 1.46e-07
3. B O14593 DNA-binding protein RFXANK 5.15e-06 NA 0.005
3. B Q9EQG6 Kinase D-interacting substrate of 220 kDa 1.29e-01 NA 2.34e-10
3. B P13264 Glutaminase kidney isoform, mitochondrial 1.54e-01 NA 0.044
3. B Q07E41 Cortactin-binding protein 2 1.70e-01 NA 3.21e-08
3. B Q2QLG9 Cortactin-binding protein 2 2.04e-01 NA 6.19e-07
3. B Q9Z2X2 26S proteasome non-ATPase regulatory subunit 10 8.55e-07 NA 0.005
3. B P97819 85/88 kDa calcium-independent phospholipase A2 2.78e-02 NA 0.001
3. B Q4R544 Ankyrin repeat and SOCS box protein 8 6.68e-04 NA 0.022
3. B Q5ZJJ9 Osteoclast-stimulating factor 1 4.63e-05 NA 0.006
3. B Q9WV06 Ankyrin repeat domain-containing protein 2 3.76e-06 NA 1.67e-06
3. B B2RU33 POTE ankyrin domain family member C 9.14e-05 NA 0.011
3. B Q60772 Cyclin-dependent kinase 4 inhibitor C 9.55e-10 NA 1.36e-04
3. B Q9UVH3 Palmitoyltransferase AKR1 (Fragment) 3.32e-03 NA 1.85e-04
3. B Q02357 Ankyrin-1 1.41e-01 NA 2.19e-06
3. B O44997 Death-associated protein kinase dapk-1 1.42e-01 NA 4.71e-07
3. B P0CG38 POTE ankyrin domain family member I 1.45e-02 NA 0.026
3. B Q5FVC7 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 1.00e-02 NA 0.032
3. B A0JP26 POTE ankyrin domain family member B3 3.46e-04 NA 7.51e-04
3. B Q8N8A2 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B 3.84e-02 NA 0.001
3. B Q9D504 Ankyrin repeat domain-containing protein 7 3.55e-04 NA 0.004
3. B Q29RM5 Protein fem-1 homolog A 2.41e-03 NA 3.83e-10
3. B Q5TYM7 CARD- and ANK-domain containing inflammasome adapter protein 1.24e-02 NA 4.42e-04
3. B Q5F478 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B 2.08e-02 NA 2.20e-05
3. B Q5U312 Ankycorbin 4.43e-03 NA 6.96e-09
3. B Q21920 Ankyrin repeat and KH domain-containing protein mask-1 4.23e-01 NA 1.31e-07
3. B Q62422 Osteoclast-stimulating factor 1 5.68e-04 NA 2.52e-04
3. B Q5R6D7 Ankyrin repeat and SOCS box protein 8 1.94e-04 NA 0.007
3. B Q9Z2G0 Protein fem-1 homolog B 3.47e-03 NA 8.80e-04
3. B Q8IV38 Ankyrin repeat and MYND domain-containing protein 2 1.47e-03 NA 4.55e-04
3. B A1ZBY1 Protein fem-1 homolog B 4.73e-03 NA 0.036
3. B G5E8K5 Ankyrin-3 1.73e-01 NA 5.19e-04
3. B Q9VUX2 E3 ubiquitin-protein ligase mind-bomb 4.47e-02 NA 0.018
3. B P53356 Tyrosine-protein kinase HTK16 3.53e-03 NA 0.011
3. B Q6DD51 Caskin-2 2.48e-02 NA 3.34e-04
3. B Q5VW22 Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 6 1.59e-01 NA 0.034
3. B Q3TYA6 M-phase phosphoprotein 8 2.90e-02 NA 2.01e-04
3. B Q6P6B7 Ankyrin repeat domain-containing protein 16 2.98e-04 NA 7.25e-05
3. B O70511 Ankyrin-3 3.15e-01 NA 2.29e-04
3. B Q3U0D9 E3 ubiquitin-protein ligase HACE1 3.24e-03 NA 0.027
3. B Q9H765 Ankyrin repeat and SOCS box protein 8 2.98e-04 NA 0.007
3. B Q99549 M-phase phosphoprotein 8 4.36e-02 NA 1.04e-04
3. B Q9Z2X3 26S proteasome non-ATPase regulatory subunit 10 8.65e-07 NA 0.022
3. B Q7T163 Kinase D-interacting substrate of 220 kDa B 9.03e-02 NA 3.09e-07
3. B Q7XUW4 Potassium channel KOR2 6.31e-04 NA 0.004
3. B Q1RJR6 Putative ankyrin repeat protein RBE_0317 1.97e-04 NA 4.87e-04
3. B Q15057 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 2.49e-02 NA 0.012
3. B Q10728 Protein phosphatase 1 regulatory subunit 12A 6.68e-02 NA 0.024
3. B Q1RMI3 GA-binding protein subunit beta-1 2.46e-04 NA 0.005
3. B Q9WV48 SH3 and multiple ankyrin repeat domains protein 1 3.76e-01 NA 3.35e-04
3. B Q07DV1 Cortactin-binding protein 2 1.91e-01 NA 5.39e-07
3. B Q07DW4 Cortactin-binding protein 2 1.16e-01 NA 2.96e-08
3. B A2A690 Protein TANC2 1.48e-01 NA 7.09e-06
3. B Q4R3S3 Ankyrin repeat domain-containing protein 7 5.78e-04 NA 3.91e-05
3. B Q63ZY3 KN motif and ankyrin repeat domain-containing protein 2 1.61e-02 NA 5.43e-09
3. B Q07DX4 Cortactin-binding protein 2 1.31e-01 NA 4.67e-06
3. B Q9CR42 Ankyrin repeat domain-containing protein 1 7.97e-05 NA 3.37e-05
3. B A6NK59 Ankyrin repeat and SOCS box protein 14 4.06e-03 NA 0.007
3. B Q61982 Neurogenic locus notch homolog protein 3 3.35e-01 NA 0.016
3. B Q6C520 Palmitoyltransferase AKR1 1.60e-03 NA 4.06e-04
3. B Q7T3P8 Protein fem-1 homolog C 1.07e-02 NA 4.29e-08
3. B Q2QLA2 Cortactin-binding protein 2 1.61e-01 NA 1.27e-07
3. B P17221 Sex-determining protein fem-1 4.06e-03 NA 2.67e-04
3. B Q9Z2F6 B-cell lymphoma 3 protein homolog 3.78e-03 NA 0.004
3. B O75179 Ankyrin repeat domain-containing protein 17 3.18e-01 NA 1.02e-08
3. B Q9HYV6 Putative ankyrin repeat protein PA3287 3.27e-10 NA 8.50e-04
3. B Q5ZMD2 Ankyrin repeat and MYND domain-containing protein 2 1.73e-03 NA 0.005
3. B Q09YM8 Cortactin-binding protein 2 1.64e-01 NA 3.87e-08
3. B A7MB89 Protein fem-1 homolog C 1.02e-02 NA 7.81e-08
3. B Q6GPE5 Protein fem-1 homolog B 5.95e-03 NA 1.40e-04
3. B Q8WXE0 Caskin-2 3.44e-02 NA 0.006
3. B P0C965 IkB-like protein NA NA 7.79e-11
3. B Q9D061 Acyl-CoA-binding domain-containing protein 6 1.55e-03 NA 2.00e-04
3. B Q5DW34 Histone-lysine N-methyltransferase EHMT1 1.48e-01 NA 2.51e-08
3. B Q06547 GA-binding protein subunit beta-1 6.35e-05 NA 0.005
3. B Q80YE7 Death-associated protein kinase 1 4.94e-02 NA 1.32e-07
3. B A6NHY2 Ankyrin repeat and death domain-containing protein 1B 5.34e-03 NA 0.013
3. B E9PTT0 Palmitoyltransferase ZDHHC17 2.70e-03 NA 4.59e-04
3. B P0DJE3 Alpha-latrotoxin-Lhe1a 6.00e-02 NA 4.97e-05
3. B Q2IBD4 Cortactin-binding protein 2 1.14e-01 NA 1.13e-06
3. B P0CG39 POTE ankyrin domain family member J 2.38e-02 NA 0.028
3. B Q978J0 Putative ankyrin repeat protein TV1425 9.03e-11 NA 2.46e-05
3. B Q6TGW5 Osteoclast-stimulating factor 1 6.11e-05 NA 0.007
3. B Q63618 Espin 5.99e-03 NA 4.16e-04
3. B Q3UYR4 Espin-like protein 3.64e-02 NA 9.92e-07
3. B Q8IWZ3 Ankyrin repeat and KH domain-containing protein 1 2.44e-01 NA 1.50e-11
3. B B9EJA2 Cortactin-binding protein 2 1.60e-01 NA 9.32e-08
3. B Q8MJ50 Osteoclast-stimulating factor 1 5.67e-03 NA 6.58e-04
3. B Q4V890 Protein fem-1 homolog A 2.60e-03 NA 1.01e-10
3. B Q8CGB3 Uveal autoantigen with coiled-coil domains and ankyrin repeats 2.90e-02 NA 7.22e-04
3. B Q8IWB6 Inactive serine/threonine-protein kinase TEX14 1.90e-01 NA 7.66e-04
3. B A5WVX9 Palmitoyltransferase ZDHHC17 2.58e-03 NA 5.26e-04
3. B Q91ZT9 Ankyrin repeat and SOCS box protein 8 5.83e-04 NA 0.011
3. B Q9J4Z4 Putative ankyrin repeat protein FPV246 NA NA 0.028
3. B A6NC57 Ankyrin repeat domain-containing protein 62 4.44e-03 NA 4.73e-06
3. B Q4ACU6 SH3 and multiple ankyrin repeat domains protein 3 1.41e-01 NA 0.001
3. B Q9Y2G4 Ankyrin repeat domain-containing protein 6 2.38e-03 NA 3.76e-04
3. B Q8C6Y6 Ankyrin repeat and SOCS box protein 14 3.78e-03 NA 0.007
3. B Q5UPJ9 Putative ankyrin repeat protein L122 NA NA 0.009
3. B Q91974 NF-kappa-B inhibitor alpha 3.47e-05 NA 0.004
3. B Q54F46 Homeobox protein Wariai 9.35e-03 NA 3.09e-04
3. B F1LTE0 Protein TANC2 2.18e-01 NA 6.23e-06
3. B Q108T9 Cortactin-binding protein 2 8.82e-02 NA 7.39e-08
3. B B1AK53 Espin 3.90e-02 NA 3.02e-09
3. B Q9ET47 Espin 5.78e-03 NA 8.91e-05
3. B Q9P2R3 Rabankyrin-5 2.64e-02 NA 2.30e-04
3. B Q9GKW8 Ankyrin repeat and death domain-containing protein 1A (Fragment) 4.98e-03 NA 1.67e-09
3. B Q8UVC3 Inversin 2.40e-02 NA 0.010
3. B Q5ZIJ9 E3 ubiquitin-protein ligase MIB2 1.78e-02 NA 4.99e-07
3. B Q05921 2-5A-dependent ribonuclease 1.73e-02 NA 0.002
3. B Q9SCX5 Probable potassium channel AKT5 2.16e-02 NA 0.024
3. B Q05823 2-5A-dependent ribonuclease 2.85e-02 NA 0.006
3. B A6NHS1 Putative uncharacterized protein ENSP00000347057 6.84e-01 NA 2.55e-26
3. B Q75HP9 Potassium channel AKT2 2.64e-02 NA 5.81e-06
3. B Q4X251 Palmitoyltransferase akr1 7.93e-03 NA 0.005
3. B Q08E43 Ankyrin repeat and SOCS box protein 8 1.96e-04 NA 0.006
3. B Q02979 Glycerophosphocholine phosphodiesterase GDE1 2.40e-01 NA 0.002
3. B Q76U48 IkB-like protein NA NA 5.36e-13
3. B Q14678 KN motif and ankyrin repeat domain-containing protein 1 4.24e-02 NA 2.88e-07
3. B Q5ZLC8 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C 2.26e-02 NA 1.16e-05
3. B Q505D1 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A 4.36e-02 NA 2.31e-04
3. B Q68LP1 E3 ubiquitin-protein ligase MIB2 3.08e-02 NA 1.84e-04
3. B Q01484 Ankyrin-2 NA NA 8.04e-07
3. B Q9UK73 Protein fem-1 homolog B 8.49e-04 NA 0.001
3. B Q9VUW9 Palmitoyltransferase Hip14 4.69e-03 NA 0.003
3. B Q96Q27 Ankyrin repeat and SOCS box protein 2 5.60e-03 NA 0.009
3. B Q00420 GA-binding protein subunit beta-1 1.36e-04 NA 0.003
3. B Q9DBR7 Protein phosphatase 1 regulatory subunit 12A 6.04e-02 NA 0.021
3. B P0C964 IkB-like protein NA NA 2.02e-12
3. B Q9Y283 Inversin 1.42e-02 NA 2.00e-04
3. B Q8R516 E3 ubiquitin-protein ligase MIB2 2.49e-02 NA 3.16e-04
3. B Q495B1 Ankyrin repeat and death domain-containing protein 1A 2.24e-03 NA 3.73e-11
3. B P83757 NF-kappa-B inhibitor cactus NA NA 0.003
3. B Q6ZVH7 Espin-like protein 9.30e-03 NA 3.28e-05
3. B Q9M8S6 Potassium channel SKOR 1.17e-02 NA 0.007
3. B Q3C1V9 Putative uncharacterized protein ENSP00000334305 8.15e-01 NA 1.26e-19
3. B Q8BG95 Protein phosphatase 1 regulatory subunit 12B 4.07e-02 NA 0.002
3. B Q9ULH0 Kinase D-interacting substrate of 220 kDa 1.03e-01 NA 6.50e-11
3. B Q9C0D5 Protein TANC1 1.44e-01 NA 1.22e-04
3. B Q9Z1P7 KN motif and ankyrin repeat domain-containing protein 3 7.99e-03 NA 1.21e-07
3. B Q5BKI6 Ankyrin repeat domain-containing protein 1 1.33e-04 NA 0.001
3. B Q6ZQK5 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 1.26e-02 NA 0.033
3. B Q5UPG5 Putative ankyrin repeat protein L93 NA NA 3.07e-07
3. B Q9WV72 Ankyrin repeat and SOCS box protein 3 1.61e-03 NA 1.34e-06
3. B Q86SG2 Ankyrin repeat domain-containing protein 23 5.55e-05 NA 0.008
3. B Q07DZ5 Cortactin-binding protein 2 9.53e-02 NA 1.12e-07
3. B D3YZU1 SH3 and multiple ankyrin repeat domains protein 1 6.85e-01 NA 3.00e-04
3. B Q92527 Ankyrin repeat domain-containing protein 7 6.31e-05 NA 2.83e-04
3. B Q80SY4 E3 ubiquitin-protein ligase MIB1 2.63e-02 NA 5.85e-04
3. B Q4I8B6 Palmitoyltransferase AKR1 9.23e-03 NA 0.010
3. B Q60J38 Ankyrin repeat and KH domain-containing protein CBG24701 5.93e-01 NA 3.97e-05
3. B P16157 Ankyrin-1 1.77e-01 NA 2.45e-06
3. B Q502M6 Ankyrin repeat domain-containing protein 29 1.15e-04 NA 1.17e-06
3. B D3ZD05 KN motif and ankyrin repeat domain-containing protein 2 1.26e-02 NA 3.52e-10
3. B Q8T2Q0 Putative ZDHHC-type palmitoyltransferase 6 7.07e-03 NA 3.14e-05
3. B Q0VGY8 Protein TANC1 2.05e-01 NA 1.48e-05
3. B O95271 Poly [ADP-ribose] polymerase tankyrase-1 6.71e-02 NA 2.23e-04
3. B B2RXR6 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B 1.66e-02 NA 6.19e-05
3. B Q502K3 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C 1.66e-02 NA 4.00e-06
3. B Q3TPE9 Ankyrin repeat and MYND domain-containing protein 2 3.12e-02 NA 0.001
3. B Q66H07 Fibronectin type 3 and ankyrin repeat domains 1 protein 6.87e-04 NA 1.02e-04
3. B Q7M6U3 Inactive serine/threonine-protein kinase TEX14 1.24e-01 NA 1.46e-05
3. B G0LXV8 Alpha-latrotoxin-Lh1a (Fragment) 1.03e-01 NA 2.64e-05
3. B Q9EP71 Ankycorbin 3.57e-02 NA 3.67e-09
3. B Q2QLB3 Cortactin-binding protein 2 1.55e-01 NA 2.71e-07
3. B Q05753 Ankyrin repeat domain-containing protein, chloroplastic 1.04e-03 NA 1.27e-04
3. B Q8HYY4 Uveal autoantigen with coiled-coil domains and ankyrin repeats protein 1.82e-02 NA 0.001
3. B Q9Y566 SH3 and multiple ankyrin repeat domains protein 1 3.12e-01 NA 7.36e-05
3. B Q653P0 Potassium channel KOR1 1.91e-02 NA 8.87e-06
3. B Q6PFX9 Poly [ADP-ribose] polymerase tankyrase-1 9.47e-02 NA 5.64e-05
3. B Q8MJ49 Osteoclast-stimulating factor 1 6.00e-03 NA 5.83e-04
3. B Q3SX45 Ankyrin repeat and SOCS box protein 2 4.84e-03 NA 0.009
3. B C7B178 Protein VAPYRIN 5.87e-03 NA 1.27e-06
3. B Q4V8X4 Acyl-CoA-binding domain-containing protein 6 2.08e-03 NA 0.036
3. B Q8VHK2 Caskin-1 6.82e-02 NA 3.00e-05
3. B Q9R172 Neurogenic locus notch homolog protein 3 4.17e-01 NA 0.021
3. B Q09YI1 Cortactin-binding protein 2 1.95e-01 NA 4.84e-08
3. B Q3UMT1 Protein phosphatase 1 regulatory subunit 12C 1.94e-03 NA 0.011
3. B Q4P6L3 Palmitoyltransferase AKR1 6.61e-03 NA 3.91e-07
3. B Q9P0K7 Ankycorbin 2.28e-03 NA 1.00e-10
3. B Q8N6D5 Ankyrin repeat domain-containing protein 29 1.43e-04 NA 4.38e-10
3. B O15084 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A 2.82e-02 NA 7.01e-04
3. B Q7T2B9 Myotrophin 9.40e-08 NA 0.021
3. B Q96AX9 E3 ubiquitin-protein ligase MIB2 1.64e-02 NA 0.002
3. B A0A3L7I2I8 85/88 kDa calcium-independent phospholipase A2 1.47e-02 NA 1.00e-04
3. B Q5RFS1 Ankyrin repeat and SOCS box protein 11 1.89e-04 NA 8.59e-04
3. B Q6P9Z4 Protein fem-1 homolog A 2.98e-03 NA 1.36e-07
3. B Q8BTI7 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C 2.51e-02 NA 1.60e-05
3. B Q5UPH0 Putative ankyrin repeat protein L100 NA NA 0.009
3. B E5RJM6 Ankyrin repeat domain-containing protein 65 1.23e-03 NA 3.05e-04
3. B Q9GZV1 Ankyrin repeat domain-containing protein 2 1.83e-04 NA 5.80e-05
3. B Q6GQX6 Ankyrin repeat and SAM domain-containing protein 6 1.70e-02 NA 4.17e-07
3. B Q86YR6 POTE ankyrin domain family member D 3.95e-03 NA 0.014
3. B Q6IVG4 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 1.83e-02 NA 0.011
3. B Q6F3J0 Nuclear factor NF-kappa-B p105 subunit 6.65e-02 NA 0.018
3. B Q8N9B4 Ankyrin repeat domain-containing protein 42 1.41e-03 NA 0.020
3. B Q59H18 Serine/threonine-protein kinase TNNI3K 9.65e-03 NA 0.004
3. B Q7ZYG4 Osteoclast-stimulating factor 1 1.30e-04 NA 0.001
3. B Q99PE2 Ankyrin repeat family A protein 2 2.30e-05 NA 0.032
3. B Q9BSK4 Protein fem-1 homolog A 1.12e-03 NA 1.60e-10
3. B Q9H9B1 Histone-lysine N-methyltransferase EHMT1 5.86e-02 NA 1.72e-07
3. B Q07E28 Cortactin-binding protein 2 2.65e-01 NA 4.52e-08
3. B P42773 Cyclin-dependent kinase 4 inhibitor C 5.77e-10 NA 1.77e-04
3. B Q28BK1 E3 ubiquitin-protein ligase HACE1 7.13e-03 NA 0.028
3. B Q92625 Ankyrin repeat and SAM domain-containing protein 1A 2.57e-02 NA 1.62e-04
3. B Q9BZF9 Uveal autoantigen with coiled-coil domains and ankyrin repeats 1.45e-02 NA 0.004
3. B A0M8T5 Cortactin-binding protein 2 1.54e-01 NA 5.76e-08
3. B Q9DAM9 Fibronectin type 3 and ankyrin repeat domains 1 protein 3.70e-04 NA 1.15e-05
3. B Q8N283 Ankyrin repeat domain-containing protein 35 3.22e-03 NA 8.39e-04
3. B Q8WXH4 Ankyrin repeat and SOCS box protein 11 8.57e-03 NA 2.84e-04
3. B Q5ZM55 Protein fem-1 homolog B 8.26e-04 NA 2.06e-04
3. B Q2KI79 Ankyrin repeat family A protein 2 1.51e-05 NA 0.028
3. B Q07E15 Cortactin-binding protein 2 1.58e-01 NA 8.33e-08
3. B Q9XZC0 Alpha-latrocrustotoxin-Lt1a (Fragment) 9.07e-02 NA 0.004
3. B A6QPE7 Ankyrin repeat domain-containing protein 65 7.97e-04 NA 0.006
3. B O60733 85/88 kDa calcium-independent phospholipase A2 5.03e-02 NA 0.007
3. B Q9V7A7 G patch domain and ankyrin repeat-containing protein 1 homolog 5.99e-02 NA 0.001
3. B Q94A76 Potassium channel GORK 1.11e-02 NA 0.007
3. B Q9ERK0 Receptor-interacting serine/threonine-protein kinase 4 4.22e-03 NA 1.90e-04
3. B A0A1D8PNZ7 Glycerophosphocholine phosphodiesterase GDE1 1.87e-01 NA 0.002
3. B Q810B6 Rabankyrin-5 7.61e-02 NA 0.021
3. B Q8Q0U0 Putative ankyrin repeat protein MM_0045 4.55e-04 NA 3.20e-09
3. B Q09YJ3 Cortactin-binding protein 2 2.53e-01 NA 5.36e-08
3. B Q12955 Ankyrin-3 NA NA 1.09e-04
3. B Q8C0T1 Protein fem-1 homolog A-B 5.42e-03 NA 1.96e-10
3. B Q2QL82 Cortactin-binding protein 2 1.62e-01 NA 5.01e-08
3. B Q38998 Potassium channel AKT1 2.63e-02 NA 2.52e-05
3. B Q80TN5 Palmitoyltransferase ZDHHC17 2.70e-03 NA 4.27e-04
3. B Q6XJU9 Osteoclast-stimulating factor 1 3.20e-03 NA 0.002
3. B P0C966 IkB-like protein NA NA 4.97e-13
3. B Q7S3M5 Palmitoyltransferase akr1 6.70e-04 NA 4.46e-05
3. B Q9XX14 Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 5.59e-01 NA 0.013
3. B Q03017 NF-kappa-B inhibitor cactus 5.66e-04 NA 0.022
3. B Q6P686 Osteoclast-stimulating factor 1 5.87e-03 NA 3.20e-04
3. B Q5M9H0 Ankyrin repeat and SAM domain-containing protein 3 4.29e-04 NA 1.49e-07
3. B O75832 26S proteasome non-ATPase regulatory subunit 10 1.73e-09 NA 0.022
3. B F1M5M3 Inactive serine/threonine-protein kinase TEX14 NA NA 0.001
3. B Q5UPA0 Putative ankyrin repeat protein L25 NA NA 0.008
3. B Q6ZW76 Ankyrin repeat and SAM domain-containing protein 3 4.56e-04 NA 1.19e-07
3. B Q9BYB0 SH3 and multiple ankyrin repeat domains protein 3 2.53e-01 NA 0.001
3. B Q6NY19 KN motif and ankyrin repeat domain-containing protein 3 3.35e-02 NA 3.09e-07
3. B P19838 Nuclear factor NF-kappa-B p105 subunit 1.40e-02 NA 0.001
3. B A0M8S4 Cortactin-binding protein 2 1.47e-01 NA 1.55e-05
3. B Q8GXE6 Potassium channel AKT6 1.16e-02 NA 1.29e-04
3. B Q24145 Tyrosine-protein kinase Shark 3.31e-02 NA 0.006
3. B Q09YK4 Cortactin-binding protein 2 2.04e-01 NA 4.21e-06
3. B Q8C8R3 Ankyrin-2 NA NA 7.43e-07
3. B E1C656 E3 ubiquitin-protein ligase HACE1 1.98e-03 NA 0.043
3. B Q9TU71 Ankyrin repeat domain-containing protein 1 3.37e-04 NA 2.54e-04
3. B Q6F6B3 Protein TANC1 1.64e-01 NA 2.68e-05
3. B A6QR20 SMC5-SMC6 complex localization factor protein 1 7.10e-02 NA 0.018
3. B Q5RF15 Serine/threonine-protein kinase TNNI3K 2.83e-03 NA 0.019
3. B Q9H9E1 Ankyrin repeat family A protein 2 1.96e-05 NA 0.026
3. B Q5T7N3 KN motif and ankyrin repeat domain-containing protein 4 2.73e-02 NA 3.79e-05
3. B Q7ZT11 Ankyrin repeat domain-containing protein 1 9.31e-05 NA 5.26e-05
3. B Q9VFD5 Protein fem-1 homolog CG6966 1.01e-02 NA 2.71e-09
3. B Q6P9K8 Caskin-1 1.11e-01 NA 3.44e-05
3. B Q8TC84 Fibronectin type 3 and ankyrin repeat domains protein 1 4.27e-04 NA 2.24e-06
3. B Q96P50 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3 4.22e-02 NA 2.43e-04
3. B O36972 IkB-like protein NA NA 7.64e-11
3. B Q9BZL4 Protein phosphatase 1 regulatory subunit 12C 2.73e-03 NA 0.011
3. B P42570 DNA replication inhibitor plutonium 1.20e-05 NA 0.004
3. B P97570 85/88 kDa calcium-independent phospholipase A2 6.56e-02 NA 0.001
3. B Q2IBA2 Cortactin-binding protein 2 1.64e-01 NA 1.51e-05
3. B Q3UMR0 Ankyrin repeat domain-containing protein 27 2.27e-02 NA 0.008
3. B Q812A3 Ankyrin repeat domain-containing protein 23 1.03e-04 NA 0.007
3. B Q811D2 Ankyrin repeat domain-containing protein 26 1.05e-01 NA 0.001
3. B Q07DY4 Cortactin-binding protein 2 1.99e-01 NA 1.53e-05
3. B A5PMU4 Ankyrin repeat and sterile alpha motif domain-containing protein 1B 2.30e-02 NA 1.92e-05
3. B A1X157 Cortactin-binding protein 2 1.73e-01 NA 5.57e-09
3. B Q9HCD6 Protein TANC2 1.76e-01 NA 7.92e-06
3. B Q9Z148 Histone-lysine N-methyltransferase EHMT2 1.93e-01 NA 3.43e-05
3. B Q9GL21 Uveal autoantigen with coiled-coil domains and ankyrin repeats 8.31e-03 NA 0.003
3. B Q9CZK6 Ankyrin repeat and SAM domain-containing protein 3 1.08e-03 NA 2.14e-09
3. B Q5UPF8 Putative ankyrin repeat protein L88 NA NA 4.79e-04
3. B Q5UR87 Putative ankyrin repeat protein R634 NA NA 0.020
3. B Q96KQ7 Histone-lysine N-methyltransferase EHMT2 6.50e-02 NA 1.88e-05
3. B Q2QLF8 Cortactin-binding protein 2 1.96e-01 NA 3.39e-07
3. B Q2IBF7 Cortactin-binding protein 2 1.31e-01 NA 5.55e-06
3. B Q9HFE7 Ankyrin repeat-containing protein P16F5.05c 5.23e-04 NA 0.002
3. B Q92882 Osteoclast-stimulating factor 1 5.84e-03 NA 2.95e-04
3. B Q6GNY1 E3 ubiquitin-protein ligase mib1 1.04e-02 NA 7.19e-05
3. B Q9JLU4 SH3 and multiple ankyrin repeat domains protein 3 1.32e-01 NA 0.001
3. B Q9BZ19 Ankyrin repeat domain-containing protein 60 9.91e-03 NA 2.09e-04
3. B Q4UMH6 Putative ankyrin repeat protein RF_0381 1.33e-02 NA 4.99e-04
3. B P53355 Death-associated protein kinase 1 5.82e-02 NA 4.92e-07
3. B Q804S5 E3 ubiquitin-protein ligase mib1 1.28e-02 NA 1.59e-04
3. B Q8IYU2 E3 ubiquitin-protein ligase HACE1 5.36e-03 NA 0.034
3. B Q9Z2G1 Protein fem-1 homolog A-A 4.97e-03 NA 2.79e-11
3. B Q875S9 Palmitoyltransferase AKR1 2.90e-03 NA 0.004
3. B X1WE18 KN motif and ankyrin repeat domain-containing protein 2 2.97e-02 NA 5.91e-06
3. B A8MXQ7 IQ motif and ankyrin repeat domain-containing protein 1 1.26e-02 NA 0.006
3. B D3Z7P3 Glutaminase kidney isoform, mitochondrial 1.50e-01 NA 0.043
3. B Q6B858 Fibronectin type 3 and ankyrin repeat domains protein 1 9.26e-04 NA 1.09e-04
3. B Q8WXK1 Ankyrin repeat and SOCS box protein 15 3.36e-03 NA 0.012
3. B Q2IBF8 Cortactin-binding protein 2 2.15e-01 NA 1.10e-07
3. B Q2T9K6 Protein fem-1 homolog C 3.50e-03 NA 1.33e-07
3. B Q9ULJ7 Ankyrin repeat domain-containing protein 50 1.00e-01 NA 1.23e-11
3. B Q8NB46 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C 1.89e-02 NA 3.33e-05
3. B Q0VCS9 Ankyrin repeat and MYND domain-containing protein 2 8.14e-04 NA 5.15e-04
3. B P0C927 Ankyrin repeat and SOCS box protein 14 2.85e-03 NA 1.85e-04
3. B Q5REW9 Ankyrin repeat domain-containing protein 27 2.31e-02 NA 0.002
3. B Q8VHK1 Caskin-2 4.03e-02 NA 0.002
3. B G3V8T1 M-phase phosphoprotein 8 3.08e-02 NA 1.06e-04
3. B Q6JAN1 Inversin 2.48e-02 NA 2.01e-04
3. B Q5RJK8 Acyl-CoA-binding domain-containing protein 6 1.35e-03 NA 8.72e-04
3. B D3ZBM7 E3 ubiquitin-protein ligase HACE1 3.29e-03 NA 0.045
3. B Q2IBE6 Cortactin-binding protein 2 1.64e-01 NA 3.83e-06
3. B A2AS55 Ankyrin repeat domain-containing protein 16 8.80e-04 NA 3.08e-04
3. B Q3ZBX7 Ankyrin repeat domain-containing protein 1 1.31e-04 NA 0.002
3. B Q09YG9 Cortactin-binding protein 2 1.75e-01 NA 4.66e-07
3. B P23631 Alpha-latrotoxin-Lt1a 4.93e-02 NA 6.42e-06
3. B Q52T38 Protein S-acyltransferase 24 2.95e-04 NA 0.043
3. B Q8WXD9 Caskin-1 4.93e-02 NA 3.13e-06
3. B Q8R560 Ankyrin repeat domain-containing protein 1 1.53e-04 NA 1.75e-04
3. B Q96JP0 Protein fem-1 homolog C 3.15e-03 NA 7.48e-08
3. B Q9FY48 E3 ubiquitin-protein ligase KEG 8.68e-02 NA 4.87e-04
3. B F1N6G5 E3 ubiquitin-protein ligase HACE1 4.51e-03 NA 0.033
3. B Q8WZ74 Cortactin-binding protein 2 1.48e-01 NA 5.79e-06
3. B Q3EC11 Probable protein S-acyltransferase 23 1.30e-03 NA 0.010
3. B Q865U8 Ankyrin repeat domain-containing protein 1 1.53e-04 NA 1.63e-04
3. B Q8NFD2 Ankyrin repeat and protein kinase domain-containing protein 1 4.29e-03 NA 0.021
3. B Q6DRG7 Protein phosphatase 1 regulatory subunit 12A 1.27e-01 NA 0.037
3. B Q3SZE4 Ankyrin repeat and SOCS box protein 11 6.13e-03 NA 0.026
3. B O60237 Protein phosphatase 1 regulatory subunit 12B 4.95e-02 NA 1.99e-04
3. B Q9VBP3 Poly [ADP-ribose] polymerase tankyrase 5.08e-02 NA 0.001
3. B Q6DCL5 E3 ubiquitin-protein ligase HACE1 9.53e-03 NA 0.033
3. B Q1LZH7 KN motif and ankyrin repeat domain-containing protein 2 1.82e-02 NA 2.75e-09
3. B Q9BR61 Acyl-CoA-binding domain-containing protein 6 1.33e-03 NA 0.002
3. B Q96NW4 Ankyrin repeat domain-containing protein 27 8.80e-02 NA 0.002