Summary

A6NCS6

Homolog: Q5VVC0.
Function: Protein SPO16 homolog.

Statistics

Total GO Annotation: 30
Unique PROST Go: 24
Unique BLAST Go: 6

Total Homologs: 20
Unique PROST Homologs: 14
Unique BLAST Homologs: 4

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q5VVC0 (Protein SPO16 homolog) with a FATCAT P-Value: 0.0171 and RMSD of 2.89 angstrom. The sequence alignment identity is 13.3%.
Structural alignment shown in left. Query protein A6NCS6 colored as red in alignment, homolog Q5VVC0 colored as blue. Query protein A6NCS6 is also shown in right top, homolog Q5VVC0 showed in right bottom. They are colored based on secondary structures. 

  A6NCS6 MERELEALAARLARPAEPPFQALVEAAGGRGQVLLVGELWEREQSRALLRDFARAVFPPEPGAAKPGGAAAEGAGPGAARGAQRAARAAGAAGAAAAAAR 100
  Q5VVC0 ---------------------------------------------------------------------------------------------MAESGKE 7

  A6NCS6 AIRSPLVFVLCRASSL------AAREPR-RRLREMLRD-VRGRRRAGA---ALVGV--LVAEAGPEDAVAPGLRLLEALLRAV--F--GRQAGGPVQAAA 183
  Q5VVC0 KIKWTTTIII--SSSLKSYEVATALENRSHKVR--YSDSVEN----GSIIFSLSGVAFLLMDT--KECL---LSTEEIFLAKIEKFINIHQNSFLVLSAA 94

  A6NCS6 YCPGLPASC-LA--VQ--AAAC--RALQAAGAGQPVEGAWERPGLPGL-LACFSWGPWSRRKNQDVAAC-RS-SAQEDF---QEPE----EELPLT--AI 264
  Q5VVC0 -LHG-PEEWKLMFRIQQRFLGCNLRIL-------PVHNT-----VNAINLMC-TIAKTTSKPYID-SICYRMITAKA-YIIEQSPVWKTLQKIKLNSDSV 177

  A6NCS6 FPNGDCDDLGRGSKACDGVVHTPAEPTGDSR 295
  Q5VVC0 NPN---------------------------- 180

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0030286 dynein complex
2. P GO:0005868 cytoplasmic dynein complex
2. P GO:0005881 cytoplasmic microtubule
2. P GO:0097730 non-motile cilium
2. P GO:0060170 ciliary membrane
2. P GO:0015031 protein transport
2. P GO:0005694 chromosome
2. P GO:0050821 protein stabilization
2. P GO:0005874 microtubule
2. P GO:0030674 protein-macromolecule adaptor activity
2. P GO:0030473 nuclear migration along microtubule
2. P GO:0007130 synaptonemal complex assembly
2. P GO:0000724 double-strand break repair via homologous recombination
2. P GO:1905515 non-motile cilium assembly
2. P GO:0030217 T cell differentiation
2. P GO:0005789 endoplasmic reticulum membrane
2. P GO:0097500 receptor localization to non-motile cilium
2. P GO:0007131 reciprocal meiotic recombination
2. P GO:0005741 mitochondrial outer membrane
2. P GO:0005525 GTP binding
2. P GO:0097196 Shu complex
2. P GO:0030183 B cell differentiation
2. P GO:0000002 mitochondrial genome maintenance
2. P GO:0031514 motile cilium
3. B GO:0003899 DNA-directed 5'-3' RNA polymerase activity
3. B GO:0000287 magnesium ion binding
3. B GO:0006351 transcription, DNA-templated
3. B GO:0032549 ribonucleoside binding
3. B GO:0008270 zinc ion binding
3. B GO:0003677 DNA binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A6NCS6 Uncharacterized protein C2orf72 0 1.67e-155 0.0
1. PB Q9CYS6 Uncharacterized protein C2orf72 homolog 1.95e-07 2.82e-25 1.09e-116
2. P Q751N0 Cytoplasmic dynein intermediate light chain DYN3 1.58e-01 1.19e-02 NA
2. P A7TQS6 Increased recombination centers protein 6 6.73e-02 1.82e-02 NA
2. P Q8VCI7 ATPase SWSAP1 1.66e-01 2.72e-03 NA
2. P Q6CX98 Cytoplasmic dynein intermediate light chain DYN3 3.57e-02 1.34e-04 NA
2. P Q5H913 ADP-ribosylation factor-like protein 13A 2.77e-02 1.87e-02 NA
2. P P70224 GTPase IMAP family member 1 8.31e-02 1.27e-03 NA
2. P Q6PD74 Alpha- and gamma-adaptin-binding protein p34 5.23e-01 3.22e-02 NA
2. P Q5RET3 Alpha- and gamma-adaptin-binding protein p34 4.60e-01 2.09e-02 NA
2. P Q5VVC0 Protein SPO16 homolog 1.71e-02 3.48e-03 NA
2. P Q6FIK5 Cytoplasmic dynein intermediate light chain DYN3 1.56e-01 1.87e-02 NA
2. P Q3KQP7 Protein SPO16 homolog 1.71e-02 1.06e-03 NA
2. P Q99MI6 GTPase IMAP family member 3 5.77e-02 8.24e-03 NA
2. P Q04949 Cytoplasmic dynein intermediate light chain DYN3 1.52e-01 2.90e-04 NA
2. P Q2TA05 Protein SPO16 homolog 1.88e-02 6.41e-03 NA
3. B Q7VJ82 Bifunctional DNA-directed RNA polymerase subunit beta-beta' NA NA 0.008
3. B Q7MA56 Bifunctional DNA-directed RNA polymerase subunit beta-beta' NA NA 0.031
3. B A6Q1M3 DNA-directed RNA polymerase subunit beta 9.13e-01 NA 0.046
3. B Q30TP7 DNA-directed RNA polymerase subunit beta 9.39e-01 NA 0.032