Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
P35545
(Ubiquitin-like protein FUBI) with a FATCAT P-Value: 0.0 and RMSD of 0.73 angstrom. The sequence alignment identity is 57.8%.
Structural alignment shown in left. Query protein A6NDN8 colored as red in alignment, homolog P35545 colored as blue.
Query protein A6NDN8 is also shown in right top, homolog P35545 showed in right bottom. They are colored based on secondary structures.
A6NDN8 MRGRRRAWRGAWRGGGAADLSLLCPQVAYVRARELHTLEVTGLETVAQSKAHVASLEGLIPEDKVVLLAGSPLQNEATLGQCGVEALTTLEVVGRRLGVH 100 P35545 ------------------------MQL-FVRAQELHTLEVTGQETVAQIKDHVASLEGIAPEDQVVLLAGSPLEDEATLGQCGVEALTTLEVAGRMLGG- 74 A6NDN8 NV 102 P35545 -- 74
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0031625 | ubiquitin protein ligase binding |
| 1. PB | GO:0035096 | larval midgut cell programmed cell death |
| 1. PB | GO:0005829 | cytosol |
| 1. PB | GO:0031386 | protein tag |
| 1. PB | GO:0005634 | nucleus |
| 1. PB | GO:0061844 | antimicrobial humoral immune response mediated by antimicrobial peptide |
| 2. P | GO:0097352 | autophagosome maturation |
| 2. P | GO:0110039 | positive regulation of nematode male tail tip morphogenesis |
| 2. P | GO:0060021 | roof of mouth development |
| 2. P | GO:1901355 | response to rapamycin |
| 2. P | GO:0005770 | late endosome |
| 2. P | GO:0016236 | macroautophagy |
| 2. P | GO:0008134 | transcription factor binding |
| 2. P | GO:0106068 | SUMO ligase complex |
| 2. P | GO:0044389 | ubiquitin-like protein ligase binding |
| 2. P | GO:0044754 | autolysosome |
| 2. P | GO:0044388 | small protein activating enzyme binding |
| 2. P | GO:0000422 | autophagy of mitochondrion |
| 2. P | GO:0046965 | retinoid X receptor binding |
| 2. P | GO:0005874 | microtubule |
| 2. P | GO:0071965 | multicellular organismal locomotion |
| 2. P | GO:0070257 | positive regulation of mucus secretion |
| 2. P | GO:0050821 | protein stabilization |
| 2. P | GO:0006995 | cellular response to nitrogen starvation |
| 2. P | GO:0071280 | cellular response to copper ion |
| 2. P | GO:0051306 | mitotic sister chromatid separation |
| 2. P | GO:0045892 | negative regulation of transcription, DNA-templated |
| 2. P | GO:0042308 | negative regulation of protein import into nucleus |
| 2. P | GO:0086004 | regulation of cardiac muscle cell contraction |
| 2. P | GO:1901896 | positive regulation of ATPase-coupled calcium transmembrane transporter activity |
| 2. P | GO:0070301 | cellular response to hydrogen peroxide |
| 2. P | GO:0031965 | nuclear membrane |
| 2. P | GO:0071276 | cellular response to cadmium ion |
| 2. P | GO:0030578 | PML body organization |
| 2. P | GO:0005543 | phospholipid binding |
| 2. P | GO:1990592 | protein K69-linked ufmylation |
| 2. P | GO:1902260 | negative regulation of delayed rectifier potassium channel activity |
| 2. P | GO:0015459 | potassium channel regulator activity |
| 2. P | GO:0012505 | endomembrane system |
| 2. P | GO:0009267 | cellular response to starvation |
| 2. P | GO:0000423 | mitophagy |
| 2. P | GO:1990426 | mitotic recombination-dependent replication fork processing |
| 2. P | GO:1901098 | positive regulation of autophagosome maturation |
| 2. P | GO:0031647 | regulation of protein stability |
| 2. P | GO:0032781 | positive regulation of ATP-dependent activity |
| 2. P | GO:0008017 | microtubule binding |
| 2. P | GO:0016604 | nuclear body |
| 2. P | GO:0005930 | axoneme |
| 2. P | GO:0008429 | phosphatidylethanolamine binding |
| 2. P | GO:0043278 | response to morphine |
| 2. P | GO:0031410 | cytoplasmic vesicle |
| 2. P | GO:0120290 | stalled replication fork localization to nuclear periphery |
| 2. P | GO:0060216 | definitive hemopoiesis |
| 2. P | GO:0097001 | ceramide binding |
| 2. P | GO:0030998 | linear element |
| 2. P | GO:0000045 | autophagosome assembly |
| 2. P | GO:0006891 | intra-Golgi vesicle-mediated transport |
| 2. P | GO:0000149 | SNARE binding |
| 2. P | GO:0010621 | negative regulation of transcription by transcription factor localization |
| 2. P | GO:1905037 | autophagosome organization |
| 2. P | GO:0043009 | chordate embryonic development |
| 2. P | GO:0010040 | response to iron(II) ion |
| 2. P | GO:0140220 | pathogen-containing vacuole |
| 2. P | GO:0034613 | cellular protein localization |
| 2. P | GO:0001778 | plasma membrane repair |
| 2. P | GO:1900180 | regulation of protein localization to nucleus |
| 2. P | GO:0051573 | negative regulation of histone H3-K9 methylation |
| 2. P | GO:0005940 | septin ring |
| 2. P | GO:0019789 | SUMO transferase activity |
| 2. P | GO:0097165 | nuclear stress granule |
| 2. P | GO:1903379 | regulation of mitotic chromosome condensation |
| 2. P | GO:0070972 | protein localization to endoplasmic reticulum |
| 2. P | GO:0000421 | autophagosome membrane |
| 2. P | GO:0051117 | ATPase binding |
| 2. P | GO:0016605 | PML body |
| 2. P | GO:0010288 | response to lead ion |
| 2. P | GO:0005776 | autophagosome |
| 2. P | GO:0090204 | protein localization to nuclear pore |
| 2. P | GO:0031334 | positive regulation of protein-containing complex assembly |
| 2. P | GO:0001650 | fibrillar center |
| 2. P | GO:0043231 | intracellular membrane-bounded organelle |
| 2. P | GO:0043392 | negative regulation of DNA binding |
| 2. P | GO:0071441 | negative regulation of histone H3-K14 acetylation |
| 2. P | GO:0098792 | xenophagy |
| 2. P | GO:0050811 | GABA receptor binding |
| 2. P | GO:0031090 | organelle membrane |
| 2. P | GO:0001741 | XY body |
| 2. P | GO:0034502 | protein localization to chromosome |
| 2. P | GO:0033235 | positive regulation of protein sumoylation |
| 2. P | GO:0070194 | synaptonemal complex disassembly |
| 2. P | GO:1990381 | ubiquitin-specific protease binding |
| 2. P | GO:0045202 | synapse |
| 2. P | GO:0016607 | nuclear speck |
| 2. P | GO:1901799 | negative regulation of proteasomal protein catabolic process |
| 2. P | GO:0034605 | cellular response to heat |
| 2. P | GO:0034198 | cellular response to amino acid starvation |
| 2. P | GO:0016925 | protein sumoylation |
| 2. P | GO:0034274 | Atg12-Atg5-Atg16 complex |
| 2. P | GO:0061723 | glycophagy |
| 2. P | GO:0032436 | positive regulation of proteasomal ubiquitin-dependent protein catabolic process |
| 2. P | GO:0045759 | negative regulation of action potential |
| 2. P | GO:0045944 | positive regulation of transcription by RNA polymerase II |
| 2. P | GO:0051572 | negative regulation of histone H3-K4 methylation |
| 2. P | GO:0050830 | defense response to Gram-positive bacterium |
| 2. P | GO:0006914 | autophagy |
| 2. P | GO:1903169 | regulation of calcium ion transmembrane transport |
| 2. P | GO:0043433 | negative regulation of DNA-binding transcription factor activity |
| 3. B | GO:0005737 | cytoplasm |
| 3. B | GO:0008585 | female gonad development |
| 3. B | GO:0033621 | nuclear-transcribed mRNA catabolic process, meiosis-specific transcripts |
| 3. B | GO:0060613 | fat pad development |
| 3. B | GO:0031398 | positive regulation of protein ubiquitination |
| 3. B | GO:0043005 | neuron projection |
| 3. B | GO:0008584 | male gonad development |
| 3. B | GO:0022627 | cytosolic small ribosomal subunit |
| 3. B | GO:0004857 | enzyme inhibitor activity |
| 3. B | GO:0021888 | hypothalamus gonadotrophin-releasing hormone neuron development |
| 3. B | GO:0002020 | protease binding |
| 3. B | GO:0097009 | energy homeostasis |
| 3. B | GO:0048812 | neuron projection morphogenesis |
| 3. B | GO:0006511 | ubiquitin-dependent protein catabolic process |
| 3. B | GO:0002109 | maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, LSU-rRNA,5S) |
| 3. B | GO:0010008 | endosome membrane |
| 3. B | GO:1902255 | positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator |
| 3. B | GO:0003735 | structural constituent of ribosome |
| 3. B | GO:0047497 | mitochondrion transport along microtubule |
| 3. B | GO:0043209 | myelin sheath |
| 3. B | GO:0005840 | ribosome |
| 3. B | GO:0003729 | mRNA binding |
| 3. B | GO:0007141 | male meiosis I |
| 3. B | GO:0022626 | cytosolic ribosome |
| 3. B | GO:0016567 | protein ubiquitination |
| 3. B | GO:0005783 | endoplasmic reticulum |
| 3. B | GO:0030666 | endocytic vesicle membrane |
| 3. B | GO:0061136 | regulation of proteasomal protein catabolic process |
| 3. B | GO:0072520 | seminiferous tubule development |
| 3. B | GO:0019941 | modification-dependent protein catabolic process |
| 3. B | GO:0042254 | ribosome biogenesis |
| 3. B | GO:0051881 | regulation of mitochondrial membrane potential |
| 3. B | GO:0000055 | ribosomal large subunit export from nucleus |
| 3. B | GO:0031982 | vesicle |
| 3. B | GO:0006464 | cellular protein modification process |
| 3. B | GO:0060612 | adipose tissue development |
| 3. B | GO:1901214 | regulation of neuron death |
| 3. B | GO:0005741 | mitochondrial outer membrane |
| 3. B | GO:0022625 | cytosolic large ribosomal subunit |
| 3. B | GO:0006412 | translation |
| 3. B | GO:1902527 | positive regulation of protein monoubiquitination |
| 3. B | GO:0007144 | female meiosis I |
| 3. B | GO:0017085 | response to insecticide |
| 3. B | GO:0009949 | polarity specification of anterior/posterior axis |
| 3. B | GO:0002181 | cytoplasmic translation |
| 3. B | GO:0005654 | nucleoplasm |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q05474 | Ubiquitin-like protein FUBI | 6.66e-16 | 2.71e-03 | 4.18e-35 |
| 1. PB | P35544 | Ubiquitin-like protein FUBI | 2.22e-16 | 6.24e-03 | 2.64e-34 |
| 1. PB | A6NDN8 | Putative ubiquitin-like protein FUBI-like protein ENSP00000310146 | 0 | 1.18e-139 | 4.86e-68 |
| 1. PB | Q60435 | Ubiquitin-like protein FUBI | 8.88e-16 | 1.12e-03 | 1.08e-33 |
| 1. PB | P35545 | Ubiquitin-like protein FUBI | 0.00e+00 | 2.93e-03 | 2.85e-34 |
| 1. PB | P62865 | Ubiquitin-like protein FUBI | 2.22e-16 | 9.45e-03 | 1.25e-33 |
| 1. PB | P0C2F1 | Ubiquitin-like protein FUBI | 1.11e-16 | 2.82e-03 | 5.09e-34 |
| 1. PB | P62868 | Ubiquitin-like protein FUBI | 0.00e+00 | 2.93e-03 | 2.85e-34 |
| 1. PB | P55812 | Ubiquitin-like protein FUBI | 4.55e-15 | 6.36e-03 | 1.25e-34 |
| 2. P | Q6DI05 | Small ubiquitin-related modifier 3 | 2.09e-09 | 4.43e-03 | NA |
| 2. P | A6NCE7 | Microtubule-associated proteins 1A/1B light chain 3 beta 2 | 2.85e-04 | 4.09e-02 | NA |
| 2. P | Q9H492 | Microtubule-associated proteins 1A/1B light chain 3A | 2.34e-04 | 1.81e-02 | NA |
| 2. P | A7WLH8 | Small ubiquitin-related modifier 1 | 1.85e-07 | 1.66e-07 | NA |
| 2. P | Q6DHL4 | Small ubiquitin-related modifier 2 | 1.69e-10 | 2.94e-04 | NA |
| 2. P | Q7SZ22 | Small ubiquitin-related modifier 3 | 2.06e-09 | 3.10e-03 | NA |
| 2. P | P55857 | Small ubiquitin-related modifier 1 | 1.57e-07 | 5.94e-06 | NA |
| 2. P | Q5EAX4 | Small ubiquitin-related modifier 1-B | 2.54e-08 | 8.49e-08 | NA |
| 2. P | Q6XVN8 | Microtubule-associated proteins 1A/1B light chain 3A | 1.95e-04 | 1.81e-02 | NA |
| 2. P | Q28H04 | Small ubiquitin-related modifier 2 | 1.48e-08 | 1.83e-04 | NA |
| 2. P | Q9MZD5 | Small ubiquitin-related modifier 1 | 8.39e-08 | 6.60e-07 | NA |
| 2. P | Q9FKC6 | Putative small ubiquitin-related modifier 6 | 1.26e-07 | 6.38e-04 | NA |
| 2. P | O13351 | Ubiquitin-like protein pmt3/smt3 | 2.70e-08 | 8.42e-06 | NA |
| 2. P | Q9HGL0 | Uncharacterized ubiquitin-like protein C800.12c | 2.40e-07 | 2.10e-03 | NA |
| 2. P | Q9GZQ8 | Microtubule-associated proteins 1A/1B light chain 3B | 3.42e-04 | 3.10e-02 | NA |
| 2. P | Q9FLP6 | Small ubiquitin-related modifier 2 | 2.39e-09 | 2.34e-02 | NA |
| 2. P | P60519 | Gamma-aminobutyric acid receptor-associated protein-like 2 | 4.99e-05 | 3.12e-02 | NA |
| 2. P | P61959 | Small ubiquitin-related modifier 2 | 5.59e-08 | 5.54e-04 | NA |
| 2. P | Q2EF74 | Small ubiquitin-related modifier 1 | 4.06e-08 | 1.19e-07 | NA |
| 2. P | P61955 | Small ubiquitin-related modifier 2 | 7.24e-08 | 5.54e-04 | NA |
| 2. P | P60522 | Gamma-aminobutyric acid receptor-associated protein-like 2 | 4.84e-05 | 3.12e-02 | NA |
| 2. P | P60521 | Gamma-aminobutyric acid receptor-associated protein-like 2 | 4.98e-05 | 3.12e-02 | NA |
| 2. P | Q2PFW2 | Small ubiquitin-related modifier 2 | 4.10e-08 | 5.54e-04 | NA |
| 2. P | Q9FKC5 | Putative small ubiquitin-related modifier 4 | 1.24e-06 | 6.96e-06 | NA |
| 2. P | P60520 | Gamma-aminobutyric acid receptor-associated protein-like 2 | 5.13e-05 | 3.12e-02 | NA |
| 2. P | Q9PT08 | Small ubiquitin-related modifier 1 | 2.79e-09 | 1.22e-07 | NA |
| 2. P | P63165 | Small ubiquitin-related modifier 1 | 2.87e-07 | 1.66e-07 | NA |
| 2. P | Q6EEV6 | Small ubiquitin-related modifier 4 | 1.66e-08 | 2.73e-04 | NA |
| 2. P | Q5ZHQ1 | Small ubiquitin-related modifier 3 | 6.07e-10 | 7.13e-03 | NA |
| 2. P | P63166 | Small ubiquitin-related modifier 1 | 5.52e-07 | 1.66e-07 | NA |
| 2. P | Q5I0H3 | Small ubiquitin-related modifier 1 | 1.01e-07 | 1.66e-07 | NA |
| 2. P | Q2RBS4 | Autophagy-related protein 8D | 4.17e-05 | 3.33e-02 | NA |
| 2. P | P61956 | Small ubiquitin-related modifier 2 | 5.24e-08 | 5.54e-04 | NA |
| 2. P | Q5E9D1 | Small ubiquitin-related modifier 1 | 6.15e-08 | 1.66e-07 | NA |
| 2. P | Q86CR8 | Autophagy-related protein 8 | 8.61e-05 | 3.52e-03 | NA |
| 2. P | Q5R6J4 | Small ubiquitin-related modifier 1 | 7.25e-07 | 1.66e-07 | NA |
| 2. P | Q94DM8 | Ubiquitin-fold modifier 1 | 1.40e-06 | 2.99e-02 | NA |
| 2. P | O57686 | Small ubiquitin-related modifier 1-A | 6.67e-09 | 6.83e-07 | NA |
| 2. P | P55509 | Uncharacterized protein y4jI | 7.45e-07 | 1.70e-06 | NA |
| 2. P | P61957 | Small ubiquitin-related modifier 2 | 4.99e-08 | 5.54e-04 | NA |
| 2. P | Q5ZJM9 | Small ubiquitin-related modifier 2 | 3.74e-08 | 5.54e-04 | NA |
| 2. P | Q8VZI7 | Small ubiquitin-related modifier 5 | 9.97e-08 | 2.29e-10 | NA |
| 2. P | Q7SZR5 | Small ubiquitin-related modifier 1 | 5.03e-08 | 4.63e-07 | NA |
| 2. P | Q7ZTK7 | Small ubiquitin-related modifier 2-A | 1.40e-08 | 1.86e-04 | NA |
| 2. P | O41515 | Microtubule-associated proteins 1A/1B light chain 3B | 1.95e-04 | 3.64e-02 | NA |
| 2. P | P34661 | Ubiquitin-fold modifier 1 | 3.64e-06 | 2.79e-04 | NA |
| 2. P | Q6NV25 | Small ubiquitin-related modifier 3-like | 3.25e-09 | 1.83e-03 | NA |
| 2. P | P55853 | Small ubiquitin-related modifier | 1.04e-12 | 1.62e-06 | NA |
| 2. P | G2XKQ0 | Small ubiquitin-related modifier 5 | 5.72e-08 | 2.74e-07 | NA |
| 2. P | A7WLI0 | Small ubiquitin-related modifier 4 | 3.79e-08 | 3.88e-05 | NA |
| 2. P | Q8QGH2 | Small ubiquitin-related modifier 1 | 1.15e-07 | 6.15e-07 | NA |
| 2. P | Q6DEP7 | Small ubiquitin-related modifier 1 | 2.79e-09 | 8.49e-08 | NA |
| 2. P | Q9CQV6 | Microtubule-associated proteins 1A/1B light chain 3B | 2.79e-04 | 2.68e-02 | NA |
| 2. P | Q2HJ23 | Microtubule-associated proteins 1A/1B light chain 3A | 1.99e-04 | 4.09e-02 | NA |
| 2. P | Q12306 | Ubiquitin-like protein SMT3 | 2.95e-07 | 1.58e-06 | NA |
| 2. P | Q6LDZ8 | Small ubiquitin-related modifier 2 | 5.36e-08 | 5.54e-04 | NA |
| 2. P | Q91VR7 | Microtubule-associated proteins 1A/1B light chain 3A | 2.42e-04 | 1.81e-02 | NA |
| 2. P | Q6DK72 | Small ubiquitin-related modifier 3 | 2.69e-09 | 3.10e-03 | NA |
| 2. P | Q9BY60 | Gamma-aminobutyric acid receptor-associated protein-like 3 | 4.85e-05 | 8.61e-03 | NA |
| 2. P | Q6GPW2 | Small ubiquitin-related modifier 2-B | 2.04e-08 | 2.13e-04 | NA |
| 2. P | P61958 | Small ubiquitin-related modifier 2 | 5.20e-08 | 5.54e-04 | NA |
| 2. P | Q9VTU1 | Autophagy protein 12-like | 2.37e-04 | 1.88e-04 | NA |
| 2. P | Q23536 | Protein lgg-2 | 7.81e-04 | 3.21e-02 | NA |
| 3. B | P0CG66 | Polyubiquitin-C | 2.17e-02 | NA | 0.014 |
| 3. B | Q865C5 | Ubiquitin | 1.25e-13 | NA | 0.003 |
| 3. B | P40909 | Ubiquitin-60S ribosomal protein L40 | 3.11e-10 | NA | 0.004 |
| 3. B | P0CH27 | Ubiquitin-60S ribosomal protein L40 | 2.42e-03 | NA | 0.040 |
| 3. B | P69201 | Ubiquitin-60S ribosomal protein L40 | 1.17e-08 | NA | 0.027 |
| 3. B | P84589 | Ubiquitin (Fragment) | 3.46e-11 | NA | 0.002 |
| 3. B | P63053 | Ubiquitin-60S ribosomal protein L40 | 3.21e-10 | NA | 0.002 |
| 3. B | P33190 | Ubiquitin-60S ribosomal protein L40 | 2.42e-10 | NA | 0.005 |
| 3. B | P62983 | Ubiquitin-40S ribosomal protein S27a | 8.22e-09 | NA | 0.005 |
| 3. B | Q1EC66 | Polyubiquitin 3 | 7.80e-05 | NA | 0.008 |
| 3. B | P69325 | Polyubiquitin | 7.08e-05 | NA | 0.008 |
| 3. B | P59232 | Ubiquitin-40S ribosomal protein S27a-2 | 6.33e-11 | NA | 0.003 |
| 3. B | P69317 | Ubiquitin | 1.42e-11 | NA | 0.001 |
| 3. B | P62981 | Ubiquitin-40S ribosomal protein S27a | 3.72e-08 | NA | 0.003 |
| 3. B | P62979 | Ubiquitin-40S ribosomal protein S27a | 6.58e-08 | NA | 0.004 |
| 3. B | P49636 | Ubiquitin-60S ribosomal protein L40 | 5.30e-10 | NA | 0.001 |
| 3. B | Q63429 | Polyubiquitin-C | 5.13e-02 | NA | 0.013 |
| 3. B | P0CG62 | Polyubiquitin-B | 4.11e-04 | NA | 0.014 |
| 3. B | Q8SWD4 | Ubiquitin | 9.93e-14 | NA | 0.007 |
| 3. B | P0CG86 | Ubiquitin-40S ribosomal protein S27a | 5.57e-08 | NA | 0.002 |
| 3. B | P49632 | Ubiquitin-60S ribosomal protein L40 | 3.65e-10 | NA | 0.002 |
| 3. B | P0C016 | Ubiquitin-40S ribosomal protein S27a | 5.01e-11 | NA | 0.011 |
| 3. B | P23398 | Polyubiquitin (Fragment) | 9.97e-07 | NA | 0.013 |
| 3. B | P27923 | Ubiquitin-40S ribosomal protein S27a | 1.30e-09 | NA | 0.003 |
| 3. B | P0C275 | Ubiquitin-60S ribosomal protein L40 | 2.97e-10 | NA | 0.002 |
| 3. B | P0C030 | Ubiquitin-NEDD8-like protein RUB1 | 6.03e-08 | NA | 0.005 |
| 3. B | P0C032 | Ubiquitin-like protein-NEDD8-like protein RUB3 | 3.42e-07 | NA | 0.001 |
| 3. B | P79781 | Ubiquitin-40S ribosomal protein S27a | 5.67e-10 | NA | 0.005 |
| 3. B | P0CG47 | Polyubiquitin-B | 5.42e-05 | NA | 0.014 |
| 3. B | P0C8R3 | Ubiquitin-40S ribosomal protein S27b | 3.18e-09 | NA | 0.013 |
| 3. B | P0CG50 | Polyubiquitin-C | 4.32e-02 | NA | 0.013 |
| 3. B | P62976 | Polyubiquitin | 2.76e-02 | NA | 0.013 |
| 3. B | P0C031 | Ubiquitin-NEDD8-like protein RUB2 | 9.92e-06 | NA | 0.005 |
| 3. B | P0CH08 | Ubiquitin-60S ribosomal protein L40 | 3.75e-10 | NA | 0.004 |
| 3. B | Q42202 | Ubiquitin-60S ribosomal protein L40-2 | 2.82e-10 | NA | 0.001 |
| 3. B | P0CG51 | Polyubiquitin-B | 1.13e-03 | NA | 0.014 |
| 3. B | P0DJ25 | Ubiquitin-60S ribosomal protein L40 | 2.00e-10 | NA | 0.005 |
| 3. B | P0CG80 | Polyubiquitin-I | 7.11e-05 | NA | 0.005 |
| 3. B | P14795 | Ubiquitin-60S ribosomal protein L40 | 4.17e-10 | NA | 0.006 |
| 3. B | P0CH33 | Polyubiquitin 11 | 2.86e-04 | NA | 0.006 |
| 3. B | P0CG82 | Polyubiquitin | 6.98e-04 | NA | 0.018 |
| 3. B | P0CH11 | Ubiquitin-60S ribosomal protein L40 | 4.23e-10 | NA | 0.001 |
| 3. B | P69322 | Polyubiquitin | 2.95e-04 | NA | 0.008 |
| 3. B | P69309 | Polyubiquitin | 7.11e-05 | NA | 0.008 |
| 3. B | Q3E7T8 | Polyubiquitin 14 | 1.12e-03 | NA | 0.008 |
| 3. B | P62975 | Ubiquitin | 1.07e-13 | NA | 0.003 |
| 3. B | P59669 | Polyubiquitin | 4.36e-03 | NA | 0.006 |
| 3. B | P62984 | Ubiquitin-60S ribosomal protein L40 | 2.44e-10 | NA | 0.002 |
| 3. B | P63052 | Ubiquitin-60S ribosomal protein L40 | 2.49e-10 | NA | 0.002 |
| 3. B | P0CG81 | Polyubiquitin-H | 3.15e-04 | NA | 0.005 |
| 3. B | P0C273 | Ubiquitin-60S ribosomal protein L40 | 2.70e-10 | NA | 0.002 |
| 3. B | P05759 | Ubiquitin-40S ribosomal protein S31 | 7.06e-10 | NA | 0.017 |
| 3. B | P19848 | Ubiquitin | 1.10e-13 | NA | 0.001 |
| 3. B | P68203 | Ubiquitin-40S ribosomal protein S27a | 2.97e-10 | NA | 0.003 |
| 3. B | P0CH06 | Ubiquitin-60S ribosomal protein L40 | 3.37e-10 | NA | 0.004 |
| 3. B | P69061 | Ubiquitin-40S ribosomal protein S27a | 7.05e-10 | NA | 0.008 |
| 3. B | P59272 | Ubiquitin-40S ribosomal protein S27a (Fragment) | 5.25e-10 | NA | 0.002 |
| 3. B | P59233 | Ubiquitin-40S ribosomal protein S27a-3 | 6.31e-11 | NA | 0.003 |
| 3. B | P68200 | Ubiquitin-40S ribosomal protein S27a | 5.75e-11 | NA | 0.004 |
| 3. B | P0CG68 | Polyubiquitin-C | 2.75e-03 | NA | 0.014 |
| 3. B | P69326 | Ubiquitin | 1.09e-13 | NA | 0.001 |
| 3. B | P18101 | Ubiquitin-60S ribosomal protein L40 | 1.21e-08 | NA | 0.002 |
| 3. B | P0CG64 | Polyubiquitin-C | 1.35e-02 | NA | 0.014 |
| 3. B | P63048 | Ubiquitin-60S ribosomal protein L40 | 2.03e-08 | NA | 0.002 |
| 3. B | P0CG77 | Polyubiquitin-D | 2.88e-04 | NA | 0.004 |
| 3. B | P0CG55 | Polyubiquitin-B | 1.17e-03 | NA | 0.011 |
| 3. B | P0CG49 | Polyubiquitin-B | 4.07e-04 | NA | 0.014 |
| 3. B | P42740 | Polyubiquitin | 9.98e-04 | NA | 0.025 |
| 3. B | P62986 | Ubiquitin-60S ribosomal protein L40 | 2.45e-10 | NA | 0.002 |
| 3. B | P62992 | Ubiquitin-40S ribosomal protein S27a | 7.77e-09 | NA | 0.004 |
| 3. B | P0CG76 | Polyubiquitin-A | 3.20e-04 | NA | 0.005 |
| 3. B | Q8H159 | Polyubiquitin 10 | 2.57e-03 | NA | 0.008 |
| 3. B | P0CH07 | Ubiquitin-60S ribosomal protein L40 | 3.79e-10 | NA | 0.004 |
| 3. B | Q39256 | Polyubiquitin 8 | 2.28e-02 | NA | 0.001 |
| 3. B | P0C276 | Ubiquitin-60S ribosomal protein L40 | 2.73e-10 | NA | 0.002 |
| 3. B | P0CG75 | Polyubiquitin | 7.60e-04 | NA | 0.018 |
| 3. B | Q8MKD1 | Polyubiquitin-B | 1.24e-03 | NA | 0.014 |
| 3. B | P42739 | Polyubiquitin (Fragment) | 2.85e-04 | NA | 0.007 |
| 3. B | P21899 | Ubiquitin-60S ribosomal protein L40 | 1.86e-08 | NA | 0.015 |
| 3. B | P47905 | Ubiquitin-40S ribosomal protein S27a | 4.75e-11 | NA | 0.002 |
| 3. B | P0CG61 | Polyubiquitin-C | 2.81e-02 | NA | 0.014 |
| 3. B | Q3E7K8 | Polyubiquitin 12 | 1.66e-04 | NA | 0.008 |
| 3. B | P0CG79 | Polyubiquitin-G | 3.03e-04 | NA | 0.005 |
| 3. B | P46575 | Ubiquitin-60S ribosomal protein L40 | 2.36e-10 | NA | 0.009 |
| 3. B | P0CG88 | Polyubiquitin-J | 5.49e-04 | NA | 0.005 |
| 3. B | P0CG53 | Polyubiquitin-B | 1.70e-03 | NA | 0.015 |
| 3. B | P14799 | Ubiquitin-40S ribosomal protein S27a | 8.46e-10 | NA | 0.025 |
| 3. B | Q9ARZ9 | Ubiquitin-40S ribosomal protein S27a-1 | 9.37e-09 | NA | 0.003 |
| 3. B | P0CG85 | Polyubiquitin | 2.55e-03 | NA | 0.008 |
| 3. B | P69313 | Ubiquitin | 1.39e-11 | NA | 0.001 |
| 3. B | Q58G87 | Polyubiquitin 3 | 3.21e-04 | NA | 0.008 |
| 3. B | P0CG65 | Polyubiquitin-B | 5.02e-05 | NA | 0.014 |
| 3. B | P0CG84 | Polyubiquitin (Fragment) | 1.02e-04 | NA | 0.008 |
| 3. B | P0CG83 | Polyubiquitin (Fragment) | 6.26e-05 | NA | 0.005 |
| 3. B | P49633 | Ubiquitin-60S ribosomal protein L40 | 2.86e-10 | NA | 0.005 |
| 3. B | P15357 | Ubiquitin-40S ribosomal protein S27a | 5.29e-11 | NA | 0.004 |
| 3. B | P68197 | Ubiquitin | 3.46e-11 | NA | 0.003 |
| 3. B | P0CH10 | Ubiquitin-60S ribosomal protein L40 | 1.57e-08 | NA | 0.001 |
| 3. B | P0CG70 | Polyubiquitin | 7.41e-05 | NA | 0.031 |
| 3. B | P14794 | Ubiquitin-60S ribosomal protein L40 | 1.73e-09 | NA | 0.001 |
| 3. B | B9DHA6 | Ubiquitin-60S ribosomal protein L40-1 | 2.88e-08 | NA | 0.001 |
| 3. B | P68202 | Ubiquitin-40S ribosomal protein S27a | 1.03e-09 | NA | 0.003 |
| 3. B | P62972 | Polyubiquitin (Fragment) | 6.14e-06 | NA | 0.010 |
| 3. B | P0CG74 | Polyubiquitin | 6.67e-05 | NA | 0.016 |
| 3. B | P0CH04 | Polyubiquitin | 2.10e-03 | NA | 0.008 |
| 3. B | P0CG73 | Polyubiquitin | 2.40e-04 | NA | 0.009 |
| 3. B | P0CH32 | Polyubiquitin 4 | 7.18e-04 | NA | 0.008 |
| 3. B | P62982 | Ubiquitin-40S ribosomal protein S27a | 5.95e-11 | NA | 0.005 |
| 3. B | P0CG71 | Polyubiquitin-A | 6.65e-02 | NA | 0.008 |
| 3. B | P0CG87 | Ubiquitin-40S ribosomal protein S27a | 6.48e-11 | NA | 0.002 |
| 3. B | P51431 | Ubiquitin-40S ribosomal protein S27a-2 | 4.64e-11 | NA | 0.002 |
| 3. B | P0CG78 | Polyubiquitin-F | 1.06e-02 | NA | 0.005 |
| 3. B | P0CH05 | Polyubiquitin | 1.08e-03 | NA | 0.008 |
| 3. B | P14797 | Ubiquitin-40S ribosomal protein S27a | 1.43e-09 | NA | 0.001 |
| 3. B | P68205 | Ubiquitin-60S ribosomal protein L40 | 2.76e-10 | NA | 0.002 |
| 3. B | P0CG60 | Polyubiquitin-B | 5.02e-05 | NA | 0.014 |
| 3. B | P0CH34 | Ubiquitin-60S ribosomal protein L40-1 | 2.62e-10 | NA | 0.001 |
| 3. B | P0C224 | Ubiquitin-60S ribosomal protein L40 | 2.06e-08 | NA | 0.007 |
| 3. B | P69315 | Polyubiquitin (Fragment) | 2.80e-05 | NA | 0.008 |
| 3. B | Q8RUC6 | Ubiquitin-NEDD8-like protein RUB2 | 1.43e-06 | NA | 0.007 |
| 3. B | P0CG72 | Polyubiquitin | 7.57e-04 | NA | 0.017 |
| 3. B | P51423 | Ubiquitin-60S ribosomal protein L40 | 3.72e-10 | NA | 0.001 |
| 3. B | P0C073 | Ubiquitin-NEDD8-like protein RUB1 | 7.55e-08 | NA | 0.005 |
| 3. B | P62980 | Ubiquitin-40S ribosomal protein S27a | 7.46e-11 | NA | 0.003 |
| 3. B | Q9SHE7 | Ubiquitin-NEDD8-like protein RUB1 | 2.18e-05 | NA | 0.006 |
| 3. B | P63050 | Ubiquitin-60S ribosomal protein L40 | 2.13e-08 | NA | 0.002 |
| 3. B | P0CG69 | Polyubiquitin | 9.27e-02 | NA | 0.014 |
| 3. B | P59271 | Ubiquitin-40S ribosomal protein S27a-1 | 1.45e-09 | NA | 0.003 |
| 3. B | P0CG63 | Polyubiquitin | 7.40e-04 | NA | 0.018 |
| 3. B | P0CG48 | Polyubiquitin-C | 1.85e-02 | NA | 0.014 |
| 3. B | Q9FHQ6 | Polyubiquitin 9 | 1.87e-03 | NA | 0.012 |
| 3. B | P62987 | Ubiquitin-60S ribosomal protein L40 | 2.52e-10 | NA | 0.002 |
| 3. B | P29504 | Ubiquitin-40S ribosomal protein S27a | 1.22e-09 | NA | 0.003 |
| 3. B | P69310 | Ubiquitin | 3.04e-11 | NA | 0.001 |
| 3. B | P0CG67 | Polyubiquitin-B | 5.10e-05 | NA | 0.014 |
| 3. B | P0CH28 | Polyubiquitin-C | 4.53e-02 | NA | 0.014 |
| 3. B | P0CG54 | Polyubiquitin-B | 4.43e-04 | NA | 0.010 |
| 3. B | P0CH09 | Ubiquitin-60S ribosomal protein L40 | 2.59e-10 | NA | 0.004 |
| 3. B | P0CH35 | Ubiquitin-60S ribosomal protein L40-2 | 3.06e-10 | NA | 0.001 |
| 3. B | P62978 | Ubiquitin-40S ribosomal protein S27a | 4.13e-08 | NA | 0.004 |