Summary

A6NDN8

Homolog: P35545.
Function: Ubiquitin-like protein FUBI.

Statistics

Total GO Annotation: 153
Unique PROST Go: 101
Unique BLAST Go: 46

Total Homologs: 212
Unique PROST Homologs: 63
Unique BLAST Homologs: 140

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was P35545 (Ubiquitin-like protein FUBI) with a FATCAT P-Value: 0.0 and RMSD of 0.73 angstrom. The sequence alignment identity is 57.8%.
Structural alignment shown in left. Query protein A6NDN8 colored as red in alignment, homolog P35545 colored as blue. Query protein A6NDN8 is also shown in right top, homolog P35545 showed in right bottom. They are colored based on secondary structures. 

  A6NDN8 MRGRRRAWRGAWRGGGAADLSLLCPQVAYVRARELHTLEVTGLETVAQSKAHVASLEGLIPEDKVVLLAGSPLQNEATLGQCGVEALTTLEVVGRRLGVH 100
  P35545 ------------------------MQL-FVRAQELHTLEVTGQETVAQIKDHVASLEGIAPEDQVVLLAGSPLEDEATLGQCGVEALTTLEVAGRMLGG- 74

  A6NDN8 NV 102
  P35545 -- 74

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0031625 ubiquitin protein ligase binding
1. PB GO:0035096 larval midgut cell programmed cell death
1. PB GO:0005829 cytosol
1. PB GO:0031386 protein tag
1. PB GO:0005634 nucleus
1. PB GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
2. P GO:0097352 autophagosome maturation
2. P GO:0110039 positive regulation of nematode male tail tip morphogenesis
2. P GO:0060021 roof of mouth development
2. P GO:1901355 response to rapamycin
2. P GO:0005770 late endosome
2. P GO:0016236 macroautophagy
2. P GO:0008134 transcription factor binding
2. P GO:0106068 SUMO ligase complex
2. P GO:0044389 ubiquitin-like protein ligase binding
2. P GO:0044754 autolysosome
2. P GO:0044388 small protein activating enzyme binding
2. P GO:0000422 autophagy of mitochondrion
2. P GO:0046965 retinoid X receptor binding
2. P GO:0005874 microtubule
2. P GO:0071965 multicellular organismal locomotion
2. P GO:0070257 positive regulation of mucus secretion
2. P GO:0050821 protein stabilization
2. P GO:0006995 cellular response to nitrogen starvation
2. P GO:0071280 cellular response to copper ion
2. P GO:0051306 mitotic sister chromatid separation
2. P GO:0045892 negative regulation of transcription, DNA-templated
2. P GO:0042308 negative regulation of protein import into nucleus
2. P GO:0086004 regulation of cardiac muscle cell contraction
2. P GO:1901896 positive regulation of ATPase-coupled calcium transmembrane transporter activity
2. P GO:0070301 cellular response to hydrogen peroxide
2. P GO:0031965 nuclear membrane
2. P GO:0071276 cellular response to cadmium ion
2. P GO:0030578 PML body organization
2. P GO:0005543 phospholipid binding
2. P GO:1990592 protein K69-linked ufmylation
2. P GO:1902260 negative regulation of delayed rectifier potassium channel activity
2. P GO:0015459 potassium channel regulator activity
2. P GO:0012505 endomembrane system
2. P GO:0009267 cellular response to starvation
2. P GO:0000423 mitophagy
2. P GO:1990426 mitotic recombination-dependent replication fork processing
2. P GO:1901098 positive regulation of autophagosome maturation
2. P GO:0031647 regulation of protein stability
2. P GO:0032781 positive regulation of ATP-dependent activity
2. P GO:0008017 microtubule binding
2. P GO:0016604 nuclear body
2. P GO:0005930 axoneme
2. P GO:0008429 phosphatidylethanolamine binding
2. P GO:0043278 response to morphine
2. P GO:0031410 cytoplasmic vesicle
2. P GO:0120290 stalled replication fork localization to nuclear periphery
2. P GO:0060216 definitive hemopoiesis
2. P GO:0097001 ceramide binding
2. P GO:0030998 linear element
2. P GO:0000045 autophagosome assembly
2. P GO:0006891 intra-Golgi vesicle-mediated transport
2. P GO:0000149 SNARE binding
2. P GO:0010621 negative regulation of transcription by transcription factor localization
2. P GO:1905037 autophagosome organization
2. P GO:0043009 chordate embryonic development
2. P GO:0010040 response to iron(II) ion
2. P GO:0140220 pathogen-containing vacuole
2. P GO:0034613 cellular protein localization
2. P GO:0001778 plasma membrane repair
2. P GO:1900180 regulation of protein localization to nucleus
2. P GO:0051573 negative regulation of histone H3-K9 methylation
2. P GO:0005940 septin ring
2. P GO:0019789 SUMO transferase activity
2. P GO:0097165 nuclear stress granule
2. P GO:1903379 regulation of mitotic chromosome condensation
2. P GO:0070972 protein localization to endoplasmic reticulum
2. P GO:0000421 autophagosome membrane
2. P GO:0051117 ATPase binding
2. P GO:0016605 PML body
2. P GO:0010288 response to lead ion
2. P GO:0005776 autophagosome
2. P GO:0090204 protein localization to nuclear pore
2. P GO:0031334 positive regulation of protein-containing complex assembly
2. P GO:0001650 fibrillar center
2. P GO:0043231 intracellular membrane-bounded organelle
2. P GO:0043392 negative regulation of DNA binding
2. P GO:0071441 negative regulation of histone H3-K14 acetylation
2. P GO:0098792 xenophagy
2. P GO:0050811 GABA receptor binding
2. P GO:0031090 organelle membrane
2. P GO:0001741 XY body
2. P GO:0034502 protein localization to chromosome
2. P GO:0033235 positive regulation of protein sumoylation
2. P GO:0070194 synaptonemal complex disassembly
2. P GO:1990381 ubiquitin-specific protease binding
2. P GO:0045202 synapse
2. P GO:0016607 nuclear speck
2. P GO:1901799 negative regulation of proteasomal protein catabolic process
2. P GO:0034605 cellular response to heat
2. P GO:0034198 cellular response to amino acid starvation
2. P GO:0016925 protein sumoylation
2. P GO:0034274 Atg12-Atg5-Atg16 complex
2. P GO:0061723 glycophagy
2. P GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
2. P GO:0045759 negative regulation of action potential
2. P GO:0045944 positive regulation of transcription by RNA polymerase II
2. P GO:0051572 negative regulation of histone H3-K4 methylation
2. P GO:0050830 defense response to Gram-positive bacterium
2. P GO:0006914 autophagy
2. P GO:1903169 regulation of calcium ion transmembrane transport
2. P GO:0043433 negative regulation of DNA-binding transcription factor activity
3. B GO:0005737 cytoplasm
3. B GO:0008585 female gonad development
3. B GO:0033621 nuclear-transcribed mRNA catabolic process, meiosis-specific transcripts
3. B GO:0060613 fat pad development
3. B GO:0031398 positive regulation of protein ubiquitination
3. B GO:0043005 neuron projection
3. B GO:0008584 male gonad development
3. B GO:0022627 cytosolic small ribosomal subunit
3. B GO:0004857 enzyme inhibitor activity
3. B GO:0021888 hypothalamus gonadotrophin-releasing hormone neuron development
3. B GO:0002020 protease binding
3. B GO:0097009 energy homeostasis
3. B GO:0048812 neuron projection morphogenesis
3. B GO:0006511 ubiquitin-dependent protein catabolic process
3. B GO:0002109 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, LSU-rRNA,5S)
3. B GO:0010008 endosome membrane
3. B GO:1902255 positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator
3. B GO:0003735 structural constituent of ribosome
3. B GO:0047497 mitochondrion transport along microtubule
3. B GO:0043209 myelin sheath
3. B GO:0005840 ribosome
3. B GO:0003729 mRNA binding
3. B GO:0007141 male meiosis I
3. B GO:0022626 cytosolic ribosome
3. B GO:0016567 protein ubiquitination
3. B GO:0005783 endoplasmic reticulum
3. B GO:0030666 endocytic vesicle membrane
3. B GO:0061136 regulation of proteasomal protein catabolic process
3. B GO:0072520 seminiferous tubule development
3. B GO:0019941 modification-dependent protein catabolic process
3. B GO:0042254 ribosome biogenesis
3. B GO:0051881 regulation of mitochondrial membrane potential
3. B GO:0000055 ribosomal large subunit export from nucleus
3. B GO:0031982 vesicle
3. B GO:0006464 cellular protein modification process
3. B GO:0060612 adipose tissue development
3. B GO:1901214 regulation of neuron death
3. B GO:0005741 mitochondrial outer membrane
3. B GO:0022625 cytosolic large ribosomal subunit
3. B GO:0006412 translation
3. B GO:1902527 positive regulation of protein monoubiquitination
3. B GO:0007144 female meiosis I
3. B GO:0017085 response to insecticide
3. B GO:0009949 polarity specification of anterior/posterior axis
3. B GO:0002181 cytoplasmic translation
3. B GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q05474 Ubiquitin-like protein FUBI 6.66e-16 2.71e-03 4.18e-35
1. PB P35544 Ubiquitin-like protein FUBI 2.22e-16 6.24e-03 2.64e-34
1. PB A6NDN8 Putative ubiquitin-like protein FUBI-like protein ENSP00000310146 0 1.18e-139 4.86e-68
1. PB Q60435 Ubiquitin-like protein FUBI 8.88e-16 1.12e-03 1.08e-33
1. PB P35545 Ubiquitin-like protein FUBI 0.00e+00 2.93e-03 2.85e-34
1. PB P62865 Ubiquitin-like protein FUBI 2.22e-16 9.45e-03 1.25e-33
1. PB P0C2F1 Ubiquitin-like protein FUBI 1.11e-16 2.82e-03 5.09e-34
1. PB P62868 Ubiquitin-like protein FUBI 0.00e+00 2.93e-03 2.85e-34
1. PB P55812 Ubiquitin-like protein FUBI 4.55e-15 6.36e-03 1.25e-34
2. P Q6DI05 Small ubiquitin-related modifier 3 2.09e-09 4.43e-03 NA
2. P A6NCE7 Microtubule-associated proteins 1A/1B light chain 3 beta 2 2.85e-04 4.09e-02 NA
2. P Q9H492 Microtubule-associated proteins 1A/1B light chain 3A 2.34e-04 1.81e-02 NA
2. P A7WLH8 Small ubiquitin-related modifier 1 1.85e-07 1.66e-07 NA
2. P Q6DHL4 Small ubiquitin-related modifier 2 1.69e-10 2.94e-04 NA
2. P Q7SZ22 Small ubiquitin-related modifier 3 2.06e-09 3.10e-03 NA
2. P P55857 Small ubiquitin-related modifier 1 1.57e-07 5.94e-06 NA
2. P Q5EAX4 Small ubiquitin-related modifier 1-B 2.54e-08 8.49e-08 NA
2. P Q6XVN8 Microtubule-associated proteins 1A/1B light chain 3A 1.95e-04 1.81e-02 NA
2. P Q28H04 Small ubiquitin-related modifier 2 1.48e-08 1.83e-04 NA
2. P Q9MZD5 Small ubiquitin-related modifier 1 8.39e-08 6.60e-07 NA
2. P Q9FKC6 Putative small ubiquitin-related modifier 6 1.26e-07 6.38e-04 NA
2. P O13351 Ubiquitin-like protein pmt3/smt3 2.70e-08 8.42e-06 NA
2. P Q9HGL0 Uncharacterized ubiquitin-like protein C800.12c 2.40e-07 2.10e-03 NA
2. P Q9GZQ8 Microtubule-associated proteins 1A/1B light chain 3B 3.42e-04 3.10e-02 NA
2. P Q9FLP6 Small ubiquitin-related modifier 2 2.39e-09 2.34e-02 NA
2. P P60519 Gamma-aminobutyric acid receptor-associated protein-like 2 4.99e-05 3.12e-02 NA
2. P P61959 Small ubiquitin-related modifier 2 5.59e-08 5.54e-04 NA
2. P Q2EF74 Small ubiquitin-related modifier 1 4.06e-08 1.19e-07 NA
2. P P61955 Small ubiquitin-related modifier 2 7.24e-08 5.54e-04 NA
2. P P60522 Gamma-aminobutyric acid receptor-associated protein-like 2 4.84e-05 3.12e-02 NA
2. P P60521 Gamma-aminobutyric acid receptor-associated protein-like 2 4.98e-05 3.12e-02 NA
2. P Q2PFW2 Small ubiquitin-related modifier 2 4.10e-08 5.54e-04 NA
2. P Q9FKC5 Putative small ubiquitin-related modifier 4 1.24e-06 6.96e-06 NA
2. P P60520 Gamma-aminobutyric acid receptor-associated protein-like 2 5.13e-05 3.12e-02 NA
2. P Q9PT08 Small ubiquitin-related modifier 1 2.79e-09 1.22e-07 NA
2. P P63165 Small ubiquitin-related modifier 1 2.87e-07 1.66e-07 NA
2. P Q6EEV6 Small ubiquitin-related modifier 4 1.66e-08 2.73e-04 NA
2. P Q5ZHQ1 Small ubiquitin-related modifier 3 6.07e-10 7.13e-03 NA
2. P P63166 Small ubiquitin-related modifier 1 5.52e-07 1.66e-07 NA
2. P Q5I0H3 Small ubiquitin-related modifier 1 1.01e-07 1.66e-07 NA
2. P Q2RBS4 Autophagy-related protein 8D 4.17e-05 3.33e-02 NA
2. P P61956 Small ubiquitin-related modifier 2 5.24e-08 5.54e-04 NA
2. P Q5E9D1 Small ubiquitin-related modifier 1 6.15e-08 1.66e-07 NA
2. P Q86CR8 Autophagy-related protein 8 8.61e-05 3.52e-03 NA
2. P Q5R6J4 Small ubiquitin-related modifier 1 7.25e-07 1.66e-07 NA
2. P Q94DM8 Ubiquitin-fold modifier 1 1.40e-06 2.99e-02 NA
2. P O57686 Small ubiquitin-related modifier 1-A 6.67e-09 6.83e-07 NA
2. P P55509 Uncharacterized protein y4jI 7.45e-07 1.70e-06 NA
2. P P61957 Small ubiquitin-related modifier 2 4.99e-08 5.54e-04 NA
2. P Q5ZJM9 Small ubiquitin-related modifier 2 3.74e-08 5.54e-04 NA
2. P Q8VZI7 Small ubiquitin-related modifier 5 9.97e-08 2.29e-10 NA
2. P Q7SZR5 Small ubiquitin-related modifier 1 5.03e-08 4.63e-07 NA
2. P Q7ZTK7 Small ubiquitin-related modifier 2-A 1.40e-08 1.86e-04 NA
2. P O41515 Microtubule-associated proteins 1A/1B light chain 3B 1.95e-04 3.64e-02 NA
2. P P34661 Ubiquitin-fold modifier 1 3.64e-06 2.79e-04 NA
2. P Q6NV25 Small ubiquitin-related modifier 3-like 3.25e-09 1.83e-03 NA
2. P P55853 Small ubiquitin-related modifier 1.04e-12 1.62e-06 NA
2. P G2XKQ0 Small ubiquitin-related modifier 5 5.72e-08 2.74e-07 NA
2. P A7WLI0 Small ubiquitin-related modifier 4 3.79e-08 3.88e-05 NA
2. P Q8QGH2 Small ubiquitin-related modifier 1 1.15e-07 6.15e-07 NA
2. P Q6DEP7 Small ubiquitin-related modifier 1 2.79e-09 8.49e-08 NA
2. P Q9CQV6 Microtubule-associated proteins 1A/1B light chain 3B 2.79e-04 2.68e-02 NA
2. P Q2HJ23 Microtubule-associated proteins 1A/1B light chain 3A 1.99e-04 4.09e-02 NA
2. P Q12306 Ubiquitin-like protein SMT3 2.95e-07 1.58e-06 NA
2. P Q6LDZ8 Small ubiquitin-related modifier 2 5.36e-08 5.54e-04 NA
2. P Q91VR7 Microtubule-associated proteins 1A/1B light chain 3A 2.42e-04 1.81e-02 NA
2. P Q6DK72 Small ubiquitin-related modifier 3 2.69e-09 3.10e-03 NA
2. P Q9BY60 Gamma-aminobutyric acid receptor-associated protein-like 3 4.85e-05 8.61e-03 NA
2. P Q6GPW2 Small ubiquitin-related modifier 2-B 2.04e-08 2.13e-04 NA
2. P P61958 Small ubiquitin-related modifier 2 5.20e-08 5.54e-04 NA
2. P Q9VTU1 Autophagy protein 12-like 2.37e-04 1.88e-04 NA
2. P Q23536 Protein lgg-2 7.81e-04 3.21e-02 NA
3. B P0CG66 Polyubiquitin-C 2.17e-02 NA 0.014
3. B Q865C5 Ubiquitin 1.25e-13 NA 0.003
3. B P40909 Ubiquitin-60S ribosomal protein L40 3.11e-10 NA 0.004
3. B P0CH27 Ubiquitin-60S ribosomal protein L40 2.42e-03 NA 0.040
3. B P69201 Ubiquitin-60S ribosomal protein L40 1.17e-08 NA 0.027
3. B P84589 Ubiquitin (Fragment) 3.46e-11 NA 0.002
3. B P63053 Ubiquitin-60S ribosomal protein L40 3.21e-10 NA 0.002
3. B P33190 Ubiquitin-60S ribosomal protein L40 2.42e-10 NA 0.005
3. B P62983 Ubiquitin-40S ribosomal protein S27a 8.22e-09 NA 0.005
3. B Q1EC66 Polyubiquitin 3 7.80e-05 NA 0.008
3. B P69325 Polyubiquitin 7.08e-05 NA 0.008
3. B P59232 Ubiquitin-40S ribosomal protein S27a-2 6.33e-11 NA 0.003
3. B P69317 Ubiquitin 1.42e-11 NA 0.001
3. B P62981 Ubiquitin-40S ribosomal protein S27a 3.72e-08 NA 0.003
3. B P62979 Ubiquitin-40S ribosomal protein S27a 6.58e-08 NA 0.004
3. B P49636 Ubiquitin-60S ribosomal protein L40 5.30e-10 NA 0.001
3. B Q63429 Polyubiquitin-C 5.13e-02 NA 0.013
3. B P0CG62 Polyubiquitin-B 4.11e-04 NA 0.014
3. B Q8SWD4 Ubiquitin 9.93e-14 NA 0.007
3. B P0CG86 Ubiquitin-40S ribosomal protein S27a 5.57e-08 NA 0.002
3. B P49632 Ubiquitin-60S ribosomal protein L40 3.65e-10 NA 0.002
3. B P0C016 Ubiquitin-40S ribosomal protein S27a 5.01e-11 NA 0.011
3. B P23398 Polyubiquitin (Fragment) 9.97e-07 NA 0.013
3. B P27923 Ubiquitin-40S ribosomal protein S27a 1.30e-09 NA 0.003
3. B P0C275 Ubiquitin-60S ribosomal protein L40 2.97e-10 NA 0.002
3. B P0C030 Ubiquitin-NEDD8-like protein RUB1 6.03e-08 NA 0.005
3. B P0C032 Ubiquitin-like protein-NEDD8-like protein RUB3 3.42e-07 NA 0.001
3. B P79781 Ubiquitin-40S ribosomal protein S27a 5.67e-10 NA 0.005
3. B P0CG47 Polyubiquitin-B 5.42e-05 NA 0.014
3. B P0C8R3 Ubiquitin-40S ribosomal protein S27b 3.18e-09 NA 0.013
3. B P0CG50 Polyubiquitin-C 4.32e-02 NA 0.013
3. B P62976 Polyubiquitin 2.76e-02 NA 0.013
3. B P0C031 Ubiquitin-NEDD8-like protein RUB2 9.92e-06 NA 0.005
3. B P0CH08 Ubiquitin-60S ribosomal protein L40 3.75e-10 NA 0.004
3. B Q42202 Ubiquitin-60S ribosomal protein L40-2 2.82e-10 NA 0.001
3. B P0CG51 Polyubiquitin-B 1.13e-03 NA 0.014
3. B P0DJ25 Ubiquitin-60S ribosomal protein L40 2.00e-10 NA 0.005
3. B P0CG80 Polyubiquitin-I 7.11e-05 NA 0.005
3. B P14795 Ubiquitin-60S ribosomal protein L40 4.17e-10 NA 0.006
3. B P0CH33 Polyubiquitin 11 2.86e-04 NA 0.006
3. B P0CG82 Polyubiquitin 6.98e-04 NA 0.018
3. B P0CH11 Ubiquitin-60S ribosomal protein L40 4.23e-10 NA 0.001
3. B P69322 Polyubiquitin 2.95e-04 NA 0.008
3. B P69309 Polyubiquitin 7.11e-05 NA 0.008
3. B Q3E7T8 Polyubiquitin 14 1.12e-03 NA 0.008
3. B P62975 Ubiquitin 1.07e-13 NA 0.003
3. B P59669 Polyubiquitin 4.36e-03 NA 0.006
3. B P62984 Ubiquitin-60S ribosomal protein L40 2.44e-10 NA 0.002
3. B P63052 Ubiquitin-60S ribosomal protein L40 2.49e-10 NA 0.002
3. B P0CG81 Polyubiquitin-H 3.15e-04 NA 0.005
3. B P0C273 Ubiquitin-60S ribosomal protein L40 2.70e-10 NA 0.002
3. B P05759 Ubiquitin-40S ribosomal protein S31 7.06e-10 NA 0.017
3. B P19848 Ubiquitin 1.10e-13 NA 0.001
3. B P68203 Ubiquitin-40S ribosomal protein S27a 2.97e-10 NA 0.003
3. B P0CH06 Ubiquitin-60S ribosomal protein L40 3.37e-10 NA 0.004
3. B P69061 Ubiquitin-40S ribosomal protein S27a 7.05e-10 NA 0.008
3. B P59272 Ubiquitin-40S ribosomal protein S27a (Fragment) 5.25e-10 NA 0.002
3. B P59233 Ubiquitin-40S ribosomal protein S27a-3 6.31e-11 NA 0.003
3. B P68200 Ubiquitin-40S ribosomal protein S27a 5.75e-11 NA 0.004
3. B P0CG68 Polyubiquitin-C 2.75e-03 NA 0.014
3. B P69326 Ubiquitin 1.09e-13 NA 0.001
3. B P18101 Ubiquitin-60S ribosomal protein L40 1.21e-08 NA 0.002
3. B P0CG64 Polyubiquitin-C 1.35e-02 NA 0.014
3. B P63048 Ubiquitin-60S ribosomal protein L40 2.03e-08 NA 0.002
3. B P0CG77 Polyubiquitin-D 2.88e-04 NA 0.004
3. B P0CG55 Polyubiquitin-B 1.17e-03 NA 0.011
3. B P0CG49 Polyubiquitin-B 4.07e-04 NA 0.014
3. B P42740 Polyubiquitin 9.98e-04 NA 0.025
3. B P62986 Ubiquitin-60S ribosomal protein L40 2.45e-10 NA 0.002
3. B P62992 Ubiquitin-40S ribosomal protein S27a 7.77e-09 NA 0.004
3. B P0CG76 Polyubiquitin-A 3.20e-04 NA 0.005
3. B Q8H159 Polyubiquitin 10 2.57e-03 NA 0.008
3. B P0CH07 Ubiquitin-60S ribosomal protein L40 3.79e-10 NA 0.004
3. B Q39256 Polyubiquitin 8 2.28e-02 NA 0.001
3. B P0C276 Ubiquitin-60S ribosomal protein L40 2.73e-10 NA 0.002
3. B P0CG75 Polyubiquitin 7.60e-04 NA 0.018
3. B Q8MKD1 Polyubiquitin-B 1.24e-03 NA 0.014
3. B P42739 Polyubiquitin (Fragment) 2.85e-04 NA 0.007
3. B P21899 Ubiquitin-60S ribosomal protein L40 1.86e-08 NA 0.015
3. B P47905 Ubiquitin-40S ribosomal protein S27a 4.75e-11 NA 0.002
3. B P0CG61 Polyubiquitin-C 2.81e-02 NA 0.014
3. B Q3E7K8 Polyubiquitin 12 1.66e-04 NA 0.008
3. B P0CG79 Polyubiquitin-G 3.03e-04 NA 0.005
3. B P46575 Ubiquitin-60S ribosomal protein L40 2.36e-10 NA 0.009
3. B P0CG88 Polyubiquitin-J 5.49e-04 NA 0.005
3. B P0CG53 Polyubiquitin-B 1.70e-03 NA 0.015
3. B P14799 Ubiquitin-40S ribosomal protein S27a 8.46e-10 NA 0.025
3. B Q9ARZ9 Ubiquitin-40S ribosomal protein S27a-1 9.37e-09 NA 0.003
3. B P0CG85 Polyubiquitin 2.55e-03 NA 0.008
3. B P69313 Ubiquitin 1.39e-11 NA 0.001
3. B Q58G87 Polyubiquitin 3 3.21e-04 NA 0.008
3. B P0CG65 Polyubiquitin-B 5.02e-05 NA 0.014
3. B P0CG84 Polyubiquitin (Fragment) 1.02e-04 NA 0.008
3. B P0CG83 Polyubiquitin (Fragment) 6.26e-05 NA 0.005
3. B P49633 Ubiquitin-60S ribosomal protein L40 2.86e-10 NA 0.005
3. B P15357 Ubiquitin-40S ribosomal protein S27a 5.29e-11 NA 0.004
3. B P68197 Ubiquitin 3.46e-11 NA 0.003
3. B P0CH10 Ubiquitin-60S ribosomal protein L40 1.57e-08 NA 0.001
3. B P0CG70 Polyubiquitin 7.41e-05 NA 0.031
3. B P14794 Ubiquitin-60S ribosomal protein L40 1.73e-09 NA 0.001
3. B B9DHA6 Ubiquitin-60S ribosomal protein L40-1 2.88e-08 NA 0.001
3. B P68202 Ubiquitin-40S ribosomal protein S27a 1.03e-09 NA 0.003
3. B P62972 Polyubiquitin (Fragment) 6.14e-06 NA 0.010
3. B P0CG74 Polyubiquitin 6.67e-05 NA 0.016
3. B P0CH04 Polyubiquitin 2.10e-03 NA 0.008
3. B P0CG73 Polyubiquitin 2.40e-04 NA 0.009
3. B P0CH32 Polyubiquitin 4 7.18e-04 NA 0.008
3. B P62982 Ubiquitin-40S ribosomal protein S27a 5.95e-11 NA 0.005
3. B P0CG71 Polyubiquitin-A 6.65e-02 NA 0.008
3. B P0CG87 Ubiquitin-40S ribosomal protein S27a 6.48e-11 NA 0.002
3. B P51431 Ubiquitin-40S ribosomal protein S27a-2 4.64e-11 NA 0.002
3. B P0CG78 Polyubiquitin-F 1.06e-02 NA 0.005
3. B P0CH05 Polyubiquitin 1.08e-03 NA 0.008
3. B P14797 Ubiquitin-40S ribosomal protein S27a 1.43e-09 NA 0.001
3. B P68205 Ubiquitin-60S ribosomal protein L40 2.76e-10 NA 0.002
3. B P0CG60 Polyubiquitin-B 5.02e-05 NA 0.014
3. B P0CH34 Ubiquitin-60S ribosomal protein L40-1 2.62e-10 NA 0.001
3. B P0C224 Ubiquitin-60S ribosomal protein L40 2.06e-08 NA 0.007
3. B P69315 Polyubiquitin (Fragment) 2.80e-05 NA 0.008
3. B Q8RUC6 Ubiquitin-NEDD8-like protein RUB2 1.43e-06 NA 0.007
3. B P0CG72 Polyubiquitin 7.57e-04 NA 0.017
3. B P51423 Ubiquitin-60S ribosomal protein L40 3.72e-10 NA 0.001
3. B P0C073 Ubiquitin-NEDD8-like protein RUB1 7.55e-08 NA 0.005
3. B P62980 Ubiquitin-40S ribosomal protein S27a 7.46e-11 NA 0.003
3. B Q9SHE7 Ubiquitin-NEDD8-like protein RUB1 2.18e-05 NA 0.006
3. B P63050 Ubiquitin-60S ribosomal protein L40 2.13e-08 NA 0.002
3. B P0CG69 Polyubiquitin 9.27e-02 NA 0.014
3. B P59271 Ubiquitin-40S ribosomal protein S27a-1 1.45e-09 NA 0.003
3. B P0CG63 Polyubiquitin 7.40e-04 NA 0.018
3. B P0CG48 Polyubiquitin-C 1.85e-02 NA 0.014
3. B Q9FHQ6 Polyubiquitin 9 1.87e-03 NA 0.012
3. B P62987 Ubiquitin-60S ribosomal protein L40 2.52e-10 NA 0.002
3. B P29504 Ubiquitin-40S ribosomal protein S27a 1.22e-09 NA 0.003
3. B P69310 Ubiquitin 3.04e-11 NA 0.001
3. B P0CG67 Polyubiquitin-B 5.10e-05 NA 0.014
3. B P0CH28 Polyubiquitin-C 4.53e-02 NA 0.014
3. B P0CG54 Polyubiquitin-B 4.43e-04 NA 0.010
3. B P0CH09 Ubiquitin-60S ribosomal protein L40 2.59e-10 NA 0.004
3. B P0CH35 Ubiquitin-60S ribosomal protein L40-2 3.06e-10 NA 0.001
3. B P62978 Ubiquitin-40S ribosomal protein S27a 4.13e-08 NA 0.004