Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
A6NJ08
(Putative methyl-CpG-binding domain protein 3-like 5) with a FATCAT P-Value: 3.25e-13 and RMSD of 2.58 angstrom. The sequence alignment identity is 99.0%.
Structural alignment shown in left. Query protein A6NDZ8 colored as red in alignment, homolog A6NJ08 colored as blue.
Query protein A6NDZ8 is also shown in right top, homolog A6NJ08 showed in right bottom. They are colored based on secondary structures.
A6NDZ8 MGEPAFTSFPSPPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRPVTRIRSHPDNQVRRRKGDEHLEKPQQLCAYRRLQALQPCS 100 A6NJ08 MGEPAFTSFPSPPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRPVTRIRSHPDNQVRRRKGDEHLEKPQQLCAYRRLQALQPCS 100 A6NDZ8 SQGEGSSPLHLESVLSILAPGTAGESLDRAGAERVRIPLEPTPGRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQARRVKKARERLAKALQADRLAR 200 A6NJ08 SQGEGSSPLHLESVLSILAPGTAGESLDRAGAERVRIPLEPTPGRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQARRVKKARERLAKALQADRLAR 200 A6NDZ8 QAEMLTCR 208 A6NJ08 QAEMLTGG 208
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0000785 | chromatin |
| 1. PB | GO:0003682 | chromatin binding |
| 2. P | GO:0006302 | double-strand break repair |
| 2. P | GO:0000184 | nuclear-transcribed mRNA catabolic process, nonsense-mediated decay |
| 2. P | GO:0044877 | protein-containing complex binding |
| 2. P | GO:0000775 | chromosome, centromeric region |
| 2. P | GO:0007080 | mitotic metaphase plate congression |
| 2. P | GO:0005694 | chromosome |
| 2. P | GO:0071922 | regulation of cohesin loading |
| 2. P | GO:0007076 | mitotic chromosome condensation |
| 2. P | GO:0000932 | P-body |
| 2. P | GO:0000278 | mitotic cell cycle |
| 2. P | GO:0022625 | cytosolic large ribosomal subunit |
| 2. P | GO:0007064 | mitotic sister chromatid cohesion |
| 2. P | GO:0031536 | positive regulation of exit from mitosis |
| 3. B | GO:0019904 | protein domain specific binding |
| 3. B | GO:0007420 | brain development |
| 3. B | GO:0030177 | positive regulation of Wnt signaling pathway |
| 3. B | GO:0035197 | siRNA binding |
| 3. B | GO:0000122 | negative regulation of transcription by RNA polymerase II |
| 3. B | GO:0009888 | tissue development |
| 3. B | GO:0035563 | positive regulation of chromatin binding |
| 3. B | GO:0008327 | methyl-CpG binding |
| 3. B | GO:0007507 | heart development |
| 3. B | GO:0016573 | histone acetylation |
| 3. B | GO:0003729 | mRNA binding |
| 3. B | GO:0048568 | embryonic organ development |
| 3. B | GO:0016581 | NuRD complex |
| 3. B | GO:0001701 | in utero embryonic development |
| 3. B | GO:0003696 | satellite DNA binding |
| 3. B | GO:0042711 | maternal behavior |
| 3. B | GO:0032991 | protein-containing complex |
| 3. B | GO:0000792 | heterochromatin |
| 3. B | GO:0043044 | |
| 3. B | GO:0032355 | response to estradiol |
| 3. B | GO:0006346 | DNA methylation-dependent heterochromatin assembly |
| 3. B | GO:0000118 | histone deacetylase complex |
| 3. B | GO:0042127 | regulation of cell population proliferation |
| 3. B | GO:0071407 | cellular response to organic cyclic compound |
| 3. B | GO:0007568 | aging |
| 3. B | GO:0044030 | regulation of DNA methylation |
| 3. B | GO:0031667 | response to nutrient levels |
| 3. B | GO:0070742 | C2H2 zinc finger domain binding |
| 3. B | GO:0034622 | |
| 3. B | GO:0009612 | response to mechanical stimulus |
| 3. B | GO:0005654 | nucleoplasm |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | A6NE82 | Putative methyl-CpG-binding domain protein 3-like 3 | 1.13e-05 | 2.28e-94 | 6.07e-148 |
| 1. PB | Q8NHZ7 | Methyl-CpG-binding domain protein 3-like 2 | 6.42e-07 | 1.16e-75 | 5.91e-144 |
| 1. PB | A6NDZ8 | Putative methyl-CpG-binding domain protein 3-like 4 | 0 | 1.31e-138 | 5.87e-149 |
| 1. PB | A6NJ08 | Putative methyl-CpG-binding domain protein 3-like 5 | 3.25e-13 | 5.89e-80 | 5.33e-147 |
| 1. PB | A0A1B0GVZ6 | Methyl-CpG-binding domain protein 3-like 2B | 5.28e-09 | 2.34e-65 | 8.88e-143 |
| 2. P | P91128 | 60S ribosomal protein L13 | 6.13e-02 | 3.35e-02 | NA |
| 2. P | B5X392 | Proline-rich nuclear receptor coactivator 2 | 2.38e-01 | 2.52e-03 | NA |
| 2. P | Q96FF9 | Sororin | 2.79e-01 | 3.90e-02 | NA |
| 3. B | Q9UBB5 | Methyl-CpG-binding domain protein 2 | 3.02e-01 | NA | 4.03e-16 |
| 3. B | O95983 | Methyl-CpG-binding domain protein 3 | 8.42e-02 | NA | 1.26e-16 |
| 3. B | Q8WWY6 | Methyl-CpG-binding domain protein 3-like 1 | 1.58e-02 | NA | 6.72e-31 |
| 3. B | Q9D9H3 | Methyl-CpG-binding domain protein 3-like 1 | 8.80e-03 | NA | 4.29e-23 |
| 3. B | Q9Z2D8 | Methyl-CpG-binding domain protein 3 | 9.59e-02 | NA | 8.06e-17 |
| 3. B | Q9Z2E1 | Methyl-CpG-binding domain protein 2 | 2.76e-01 | NA | 9.94e-16 |