Summary

A6NE52

Homolog: Q5F201.
Function: Cilia- and flagella-associated protein 52.

Statistics

Total GO Annotation: 384
Unique PROST Go: 21
Unique BLAST Go: 351

Total Homologs: 429
Unique PROST Homologs: 14
Unique BLAST Homologs: 414

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q5F201 (Cilia- and flagella-associated protein 52) with a FATCAT P-Value: 2.54e-08 and RMSD of 2.93 angstrom. The sequence alignment identity is 11.4%.
Structural alignment shown in left. Query protein A6NE52 colored as red in alignment, homolog Q5F201 colored as blue. Query protein A6NE52 is also shown in right top, homolog Q5F201 showed in right bottom. They are colored based on secondary structures. 

  A6NE52 MEAEVWEAEGYNLVLDSDLYDADGYDVPDPGLLTEKNELTFTEPSQVLPFLTSSQQWQSLTPRARARRLWLLLRTSLHEVVEKEKRAELRAARLTHGLEP 100
  Q5F201 -------------------------------------------------------------------------------------------------MEE 3

  A6NE52 --LRRLEVAA-GLRSVAQDPVG--GRFVVLDGAGRLHLHKEDGWAQETLLAPVRLTGLVTVLGPLGAVG----RFV-GWGPAGLAILRPNLSLLWLSEQG 190
  Q5F201 QVLPELDVAELELQAV----IGFNGH--VPNG---LKCH-PD---QEHLIYPL---G-CTVL--IQAINTNEQNFLHGHG--------NNVSCVTISKEG 76

  A6NE52 VGRAPGWAPTCCLPVPDLRLLLVAEMNSSLALWQFRSGGRRLVLRGSALHPPPSPTGRLMRLAVAPVPPHHV-LRCFAA--YGSAVLTFDLHAWTLVDVR 287
  Q5F201 DYIASG------------QVTFMG-FKADIILWDFKK--RELIARLS-LH-----KGKIEALAFS---PNDLYLVSLGGPDDGSVVV------WSI--AK 144

  A6NE52 RD---------LHKTTISDLAY--CEEVEAMVTASRDSTVKVWEAD------W-------QI-RMV------------FVG-HTGPVTAMTVLPNTTLVL 349
  Q5F201 RDAICGSPAAGLNVGNATSVVFSRCRD-EMFVTAG-NGTIRVWELDLPNRKIWPTECQTGQMKRIVLSTGMADDDSFFYLGTTTGDILKMN--PKTKL-L 239

  A6NE52 SASQD-GTLRTWDLQAAAQVGEVALGFWGQDKLSR--RVGRLLAPVRPGWPVLSLCAS-SMQLWRVRELYSPL--AQLPAKVLHVQVAPALPAPAHQ-SL 442
  Q5F201 A---DTGPVK--D--------KFSLGV---SAL-RCLKMGGLL--VGSGAGLLIFCKSPS---------YKPIKKVQLQGGITSI----TLRGEGHQFFV 307

  A6NE52 PT------RLVCACADGSVYLLSAATGRI--VSSLLLEPEDCAAAVAYCLPREA-LWLLTRAGHLVRANAARCPMSVLHRVCPPPPPAPQPCCLHLYSHL 533
  Q5F201 GTEESHIYRV--NFTDFKETLI--ATCHFEAVQDIVF-PFGTAELFATCAKKDIRVW------HTM---SKR---ELL-RI-----TVPNMTC-H----- 378

  A6NE52 TDLEGAFSSWEIVRQHWGELRCSSVACAWKN-KNR-YLPVVGHTDGTLSVLEWLSSKTVFQTEAHSPGPVVAIAST--WNSIVSSGGDLTVKMWRV---F 626
  Q5F201 ----GI----DFMRD--G----KSIISAWDDGKIRAFAPESGR-------LMY----TI-NS-AHRIG-VTAIATTSDCKRIISGGGEGEVRVWQVGCQT 450

  A6NE52 PYAEESLSLLR-TFSCCYPAVAL------CALGRRVTAGFEDPDSATYG-LVQFGLGDSPRLDHRPQDDPTDHI---TGL--CCC--P-TLKLYACSSLD 710
  Q5F201 QKLEEALKEHKSSVSC----IRVKKNNEEC-----VTA-------STDGTCI---IWDLVRL-RRNQ-----MILANT-LFQCVCYHPEEFQIIT-SGTD 523

  A6NE52 CTVRIW-TAENRLLRLLQLNGAPQALAFCSNSG-DLVLALGSRLCLVSHRLYLPTSYLVKKMCRKAPDVVDDPPLPLMSQESLTSAQLQRLTNLHGAASL 808
  Q5F201 RKIAYWEVFDGSVIR--ELEG---SLSGSIN-GMDITQE-GGHFVTGGH------DHLVK--------VWD-------YNEG-------EVTHV-G---V 584

  A6NE52 SEALSLIHRR-RATSQHLVPKEDLDAIVARDRDLQQLRLGLVVPAAQPPPSWQQRQEGFDNYLRLIYGSGLLGMQSGRGSQQWSAGTLRVERETRDVCAV 907
  Q5F201 GHSGNIMAMRISPGNQYIV---SVSA----DGAI--LR--WKYPFAS----------------------------------------------------- 620

  A6NE52 PQAAHCLARAEVSTAAQTVPTALSPQDLGALGQHFSQSPRVTVPIPPTHRRVHSKASQLLARSSLSHYLGISLDLQLQLEQLRGRTTMALDLPSSHLQCR 1007
  Q5F201 ---------------------------------------------------------------------------------------------------- 620

  A6NE52 IPLLPKRWDKEPLSSLRGFFPATVQPHKHCLRPICFPGYVPNSAVLQQMWLNAEPGASQDALWLWRPRPSQTQWQRKLLQWMGEKPGEEGEEDKKEEEEE 1107
  Q5F201 ---------------------------------------------------------------------------------------------------- 620

  A6NE52 KEDEELDWALASLSPHSNQQLDSWELEDQSAVDWTQEPRRRSCKVARTHPHPWHRHGSLLLDEHYGHLPKFLHFFIYQTWFKKLFPIFSLQAYPEAGTIE 1207
  Q5F201 ---------------------------------------------------------------------------------------------------- 620

  A6NE52 GLASLLVALLEKTTWVDRVHILQVLLRLLPNMSSDLQGQLQGLLVHLLNLDQPPSLQDQTQKKFVILALQLLLACSLESRDVVLELMSYFLYSPVHCRPE 1307
  Q5F201 ---------------------------------------------------------------------------------------------------- 620

  A6NE52 LKKLLHGLGLQDPEGFLFKEMMTWVQGPDLDSKAGLRTCCHQKLEDMIQELQETPSQTSVVSGAPTRASVIPSGTSWSASGIFGRLSQVSEVPLMVVSPA 1407
  Q5F201 ---------------------------------------------------------------------------------------------------- 620

  A6NE52 EPHSLAPELQAQRMLAPKRSWGTPQLRLRVLSETLKSFCLEPEARLHPAGPAQLPGEPPPLEETDWSHSQLLDLGPIDALNFFCEQLRAQQRSSLQEKAA 1507
  Q5F201 ---------------------------------------------------------------------------------------------------- 620

  A6NE52 HPHPPEPYTVAPVPDMVVPPPREHWYHPILRLQEAKPQRSARSAMRLRGPMRSRLCAGRTLDGPIRTLKLPLPRVEPQPFPLDWPMPPRPLPPRLLQPAL 1607
  Q5F201 ---------------------------------------------------------------------------------------------------- 620

  A6NE52 QRYFLPADADPDTYS 1622
  Q5F201 --------------- 620

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0005930 axoneme
1. PB GO:0007099 centriole replication
1. PB GO:0043130 ubiquitin binding
1. PB GO:0005813 centrosome
1. PB GO:0000922 spindle pole
1. PB GO:0090660 cerebrospinal fluid circulation
1. PB GO:0097431 mitotic spindle pole
1. PB GO:0097729 9+2 motile cilium
1. PB GO:0060271 cilium assembly
1. PB GO:0021987 cerebral cortex development
1. PB GO:0005814 centriole
1. PB GO:0031514 motile cilium
2. P GO:1900425 negative regulation of defense response to bacterium
2. P GO:0035082 axoneme assembly
2. P GO:0120197 mucociliary clearance
2. P GO:0007420 brain development
2. P GO:0032717 negative regulation of interleukin-8 production
2. P GO:0097150 neuronal stem cell population maintenance
2. P GO:0003351 epithelial cilium movement involved in extracellular fluid movement
2. P GO:0046330 positive regulation of JNK cascade
2. P GO:0034451 centriolar satellite
2. P GO:1903003 positive regulation of protein deubiquitination
2. P GO:0030317 flagellated sperm motility
2. P GO:0008233 peptidase activity
2. P GO:0060285 cilium-dependent cell motility
2. P GO:0007288 sperm axoneme assembly
2. P GO:0003356 regulation of cilium beat frequency
2. P GO:0044458 motile cilium assembly
2. P GO:0000226 microtubule cytoskeleton organization
2. P GO:0022008 neurogenesis
2. P GO:0007052 mitotic spindle organization
2. P GO:0005856 cytoskeleton
2. P GO:0043124 negative regulation of I-kappaB kinase/NF-kappaB signaling
3. B GO:0021540 corpus callosum morphogenesis
3. B GO:0031932 TORC2 complex
3. B GO:1902510 regulation of apoptotic DNA fragmentation
3. B GO:0048364 root development
3. B GO:0019226 transmission of nerve impulse
3. B GO:0034450 ubiquitin-ubiquitin ligase activity
3. B GO:0045571 negative regulation of imaginal disc growth
3. B GO:0000244 spliceosomal tri-snRNP complex assembly
3. B GO:0008610 lipid biosynthetic process
3. B GO:0005874 microtubule
3. B GO:0045862 positive regulation of proteolysis
3. B GO:0008283 cell population proliferation
3. B GO:0035327
3. B GO:0005080 protein kinase C binding
3. B GO:0042800 histone methyltransferase activity (H3-K4 specific)
3. B GO:0047496 vesicle transport along microtubule
3. B GO:2000543 positive regulation of gastrulation
3. B GO:0003743 translation initiation factor activity
3. B GO:0006884 cell volume homeostasis
3. B GO:0051013 microtubule severing
3. B GO:0031965 nuclear membrane
3. B GO:0016567 protein ubiquitination
3. B GO:0043162 ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
3. B GO:0046469 platelet activating factor metabolic process
3. B GO:0071380 cellular response to prostaglandin E stimulus
3. B GO:0006693 prostaglandin metabolic process
3. B GO:0044877 protein-containing complex binding
3. B GO:0030426 growth cone
3. B GO:0007191 adenylate cyclase-activating dopamine receptor signaling pathway
3. B GO:0005576 extracellular region
3. B GO:0019903 protein phosphatase binding
3. B GO:0048359 mucilage metabolic process involved in seed coat development
3. B GO:0120095 vacuole-isolation membrane contact site
3. B GO:0003431 growth plate cartilage chondrocyte development
3. B GO:0000972 transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery
3. B GO:0051343 positive regulation of cyclic-nucleotide phosphodiesterase activity
3. B GO:0008017 microtubule binding
3. B GO:0008344 adult locomotory behavior
3. B GO:0009553 embryo sac development
3. B GO:0004842 ubiquitin-protein transferase activity
3. B GO:1903467 negative regulation of mitotic DNA replication initiation
3. B GO:1900045 negative regulation of protein K63-linked ubiquitination
3. B GO:0007405 neuroblast proliferation
3. B GO:1990757 ubiquitin ligase activator activity
3. B GO:0032420 stereocilium
3. B GO:0032956 regulation of actin cytoskeleton organization
3. B GO:0043022 ribosome binding
3. B GO:0030914
3. B GO:0050885 neuromuscular process controlling balance
3. B GO:0045722 positive regulation of gluconeogenesis
3. B GO:0006413 translational initiation
3. B GO:1904668 positive regulation of ubiquitin protein ligase activity
3. B GO:0043224 nuclear SCF ubiquitin ligase complex
3. B GO:0110136 protein-RNA complex remodeling
3. B GO:0051301 cell division
3. B GO:0008247 1-alkyl-2-acetylglycerophosphocholine esterase complex
3. B GO:0005524 ATP binding
3. B GO:0070062 extracellular exosome
3. B GO:0048571 long-day photoperiodism
3. B GO:0034511 U3 snoRNA binding
3. B GO:0016282 eukaryotic 43S preinitiation complex
3. B GO:0071217 cellular response to external biotic stimulus
3. B GO:0003735 structural constituent of ribosome
3. B GO:0019005 SCF ubiquitin ligase complex
3. B GO:0001650 fibrillar center
3. B GO:0017053 transcription repressor complex
3. B GO:0043025 neuronal cell body
3. B GO:2000114 regulation of establishment of cell polarity
3. B GO:2001162 positive regulation of histone H3-K79 methylation
3. B GO:0070840 dynein complex binding
3. B GO:0005198 structural molecule activity
3. B GO:0010072 primary shoot apical meristem specification
3. B GO:0005886 plasma membrane
3. B GO:0045879 negative regulation of smoothened signaling pathway
3. B GO:0061739 protein lipidation involved in autophagosome assembly
3. B GO:0031931 TORC1 complex
3. B GO:0051649 establishment of localization in cell
3. B GO:0004381 fucosylgalactoside 3-alpha-galactosyltransferase activity
3. B GO:0039689 negative stranded viral RNA replication
3. B GO:0090181 regulation of cholesterol metabolic process
3. B GO:0051571 positive regulation of histone H3-K4 methylation
3. B GO:0005671 obsolete Ada2/Gcn5/Ada3 transcription activator complex
3. B GO:0033598 mammary gland epithelial cell proliferation
3. B GO:0005730 nucleolus
3. B GO:0008656 cysteine-type endopeptidase activator activity involved in apoptotic process
3. B GO:0006412 translation
3. B GO:0050765 negative regulation of phagocytosis
3. B GO:0035097 histone methyltransferase complex
3. B GO:0050909 sensory perception of taste
3. B GO:0043547 positive regulation of GTPase activity
3. B GO:0042753 positive regulation of circadian rhythm
3. B GO:0044665 MLL1/2 complex
3. B GO:0006367 transcription initiation from RNA polymerase II promoter
3. B GO:0016005 phospholipase A2 activator activity
3. B GO:0043274 phospholipase binding
3. B GO:0061003 positive regulation of dendritic spine morphogenesis
3. B GO:0006886 intracellular protein transport
3. B GO:0048711 positive regulation of astrocyte differentiation
3. B GO:0017145 stem cell division
3. B GO:0051130 positive regulation of cellular component organization
3. B GO:0000349 generation of catalytic spliceosome for first transesterification step
3. B GO:0005819 spindle
3. B GO:0036158 outer dynein arm assembly
3. B GO:0001667 ameboidal-type cell migration
3. B GO:0048511 rhythmic process
3. B GO:0005078 MAP-kinase scaffold activity
3. B GO:0071215 cellular response to abscisic acid stimulus
3. B GO:0051661 maintenance of centrosome location
3. B GO:0031037 myosin II filament disassembly
3. B GO:0000209 protein polyubiquitination
3. B GO:0005834 heterotrimeric G-protein complex
3. B GO:0042273 ribosomal large subunit biogenesis
3. B GO:0072432 response to G1 DNA damage checkpoint signaling
3. B GO:0048367 shoot system development
3. B GO:0030425 dendrite
3. B GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
3. B GO:0030496 midbody
3. B GO:0006303 double-strand break repair via nonhomologous end joining
3. B GO:0009968 negative regulation of signal transduction
3. B GO:0000375 RNA splicing, via transesterification reactions
3. B GO:0005634 nucleus
3. B GO:0000123 histone acetyltransferase complex
3. B GO:0036064 ciliary basal body
3. B GO:0031682 G-protein gamma-subunit binding
3. B GO:0030515 snoRNA binding
3. B GO:0001891 phagocytic cup
3. B GO:0051660 establishment of centrosome localization
3. B GO:0031592 centrosomal corona
3. B GO:0035064 methylated histone binding
3. B GO:0045014 carbon catabolite repression of transcription by glucose
3. B GO:0030335 positive regulation of cell migration
3. B GO:0005681 spliceosomal complex
3. B GO:0034504 protein localization to nucleus
3. B GO:0003677 DNA binding
3. B GO:0048471 perinuclear region of cytoplasm
3. B GO:0051012 microtubule sliding
3. B GO:0034388 Pwp2p-containing subcomplex of 90S preribosome
3. B GO:0030971 receptor tyrosine kinase binding
3. B GO:0001764 neuron migration
3. B GO:1902074 response to salt
3. B GO:0043473 pigmentation
3. B GO:0090724 central region of growth cone
3. B GO:0030157 pancreatic juice secretion
3. B GO:0016905 myosin heavy chain kinase activity
3. B GO:0030507 spectrin binding
3. B GO:0000398 mRNA splicing, via spliceosome
3. B GO:1900091 regulation of raffinose biosynthetic process
3. B GO:0030178 negative regulation of Wnt signaling pathway
3. B GO:0071339 MLL1 complex
3. B GO:0000235 astral microtubule
3. B GO:0007079 mitotic chromosome movement towards spindle pole
3. B GO:0032350 regulation of hormone metabolic process
3. B GO:2000574 obsolete regulation of microtubule motor activity
3. B GO:0034452 dynactin binding
3. B GO:0051512 positive regulation of unidimensional cell growth
3. B GO:0106004 tRNA (guanine-N7)-methylation
3. B GO:0098792 xenophagy
3. B GO:0005525 GTP binding
3. B GO:0038026 reelin-mediated signaling pathway
3. B GO:1904115 axon cytoplasm
3. B GO:0045931 positive regulation of mitotic cell cycle
3. B GO:0010992 ubiquitin recycling
3. B GO:0071007 U2-type catalytic step 2 spliceosome
3. B GO:1900087 positive regulation of G1/S transition of mitotic cell cycle
3. B GO:0007368 determination of left/right symmetry
3. B GO:0000028 ribosomal small subunit assembly
3. B GO:0008352 katanin complex
3. B GO:0040019 positive regulation of embryonic development
3. B GO:0051726 regulation of cell cycle
3. B GO:0016607 nuclear speck
3. B GO:0047391 alkylglycerophosphoethanolamine phosphodiesterase activity
3. B GO:0000974 Prp19 complex
3. B GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B GO:0010476 gibberellin mediated signaling pathway
3. B GO:0010906 regulation of glucose metabolic process
3. B GO:0071407 cellular response to organic cyclic compound
3. B GO:0000776 kinetochore
3. B GO:0000077 DNA damage checkpoint signaling
3. B GO:0005662 DNA replication factor A complex
3. B GO:0008013 beta-catenin binding
3. B GO:0005635 nuclear envelope
3. B GO:2000024 regulation of leaf development
3. B GO:0071333 cellular response to glucose stimulus
3. B GO:0043982 histone H4-K8 acetylation
3. B GO:0021819 layer formation in cerebral cortex
3. B GO:0035591 signaling adaptor activity
3. B GO:0021766 hippocampus development
3. B GO:0008090 retrograde axonal transport
3. B GO:0007369 gastrulation
3. B GO:0051434 BH3 domain binding
3. B GO:0005881 cytoplasmic microtubule
3. B GO:0051081 nuclear membrane disassembly
3. B GO:0001934 positive regulation of protein phosphorylation
3. B GO:0005643 nuclear pore
3. B GO:0000245 spliceosomal complex assembly
3. B GO:0051898 negative regulation of protein kinase B signaling
3. B GO:0070545 PeBoW complex
3. B GO:0006406 mRNA export from nucleus
3. B GO:0007399 nervous system development
3. B GO:0071870 cellular response to catecholamine stimulus
3. B GO:0000132 establishment of mitotic spindle orientation
3. B GO:0033290 eukaryotic 48S preinitiation complex
3. B GO:0043966 histone H3 acetylation
3. B GO:1903861 positive regulation of dendrite extension
3. B GO:0001675 acrosome assembly
3. B GO:0032091 negative regulation of protein binding
3. B GO:0000502 proteasome complex
3. B GO:0010336 gibberellic acid homeostasis
3. B GO:0016251 RNA polymerase II general transcription initiation factor activity
3. B GO:0044666 MLL3/4 complex
3. B GO:0042998 positive regulation of Golgi to plasma membrane protein transport
3. B GO:0055087 Ski complex
3. B GO:0031117 positive regulation of microtubule depolymerization
3. B GO:0010272 response to silver ion
3. B GO:0005929 cilium
3. B GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
3. B GO:0034396 negative regulation of transcription from RNA polymerase II promoter in response to iron
3. B GO:0005246 calcium channel regulator activity
3. B GO:0006891 intra-Golgi vesicle-mediated transport
3. B GO:0007165 signal transduction
3. B GO:0005669 transcription factor TFIID complex
3. B GO:0007097 nuclear migration
3. B GO:0033276 transcription factor TFTC complex
3. B GO:0007019 microtubule depolymerization
3. B GO:2001224 positive regulation of neuron migration
3. B GO:0001895 retina homeostasis
3. B GO:0007281 germ cell development
3. B GO:0005815 microtubule organizing center
3. B GO:0043622 cortical microtubule organization
3. B GO:1904672 regulation of somatic stem cell population maintenance
3. B GO:0070534 protein K63-linked ubiquitination
3. B GO:2001244 positive regulation of intrinsic apoptotic signaling pathway
3. B GO:0061630 ubiquitin protein ligase activity
3. B GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
3. B GO:0005847 mRNA cleavage and polyadenylation specificity factor complex
3. B GO:0032040 small-subunit processome
3. B GO:0043981 histone H4-K5 acetylation
3. B GO:0043005 neuron projection
3. B GO:0045505 dynein intermediate chain binding
3. B GO:0006405 RNA export from nucleus
3. B GO:0030308 negative regulation of cell growth
3. B GO:0048854 brain morphogenesis
3. B GO:0031023 microtubule organizing center organization
3. B GO:0060041 retina development in camera-type eye
3. B GO:0032880 regulation of protein localization
3. B GO:0001403 invasive growth in response to glucose limitation
3. B GO:1903423 positive regulation of synaptic vesicle recycling
3. B GO:0043527 tRNA methyltransferase complex
3. B GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B GO:0010073 meristem maintenance
3. B GO:0001732 formation of cytoplasmic translation initiation complex
3. B GO:0031252 cell leading edge
3. B GO:0042622 photoreceptor outer segment membrane
3. B GO:0030030 cell projection organization
3. B GO:1900088 regulation of inositol biosynthetic process
3. B GO:0071013 catalytic step 2 spliceosome
3. B GO:0060590 ATPase regulator activity
3. B GO:0009845 seed germination
3. B GO:0009560 embryo sac egg cell differentiation
3. B GO:0002183 cytoplasmic translational initiation
3. B GO:0060236 regulation of mitotic spindle organization
3. B GO:0048188 Set1C/COMPASS complex
3. B GO:0044297 cell body
3. B GO:0008635 activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c
3. B GO:0071006 U2-type catalytic step 1 spliceosome
3. B GO:1902183 regulation of shoot apical meristem development
3. B GO:0051219 phosphoprotein binding
3. B GO:0048026 positive regulation of mRNA splicing, via spliceosome
3. B GO:0046898 response to cycloheximide
3. B GO:0043984 histone H4-K16 acetylation
3. B GO:0051010 microtubule plus-end binding
3. B GO:0043021 ribonucleoprotein complex binding
3. B GO:0021895 cerebral cortex neuron differentiation
3. B GO:0016236 macroautophagy
3. B GO:0051020 GTPase binding
3. B GO:0051901 positive regulation of mitochondrial depolarization
3. B GO:0032430 positive regulation of phospholipase A2 activity
3. B GO:1903341 regulation of meiotic DNA double-strand break formation
3. B GO:0030126 COPI vesicle coat
3. B GO:0036035 osteoclast development
3. B GO:0009967 positive regulation of signal transduction
3. B GO:0071541 eukaryotic translation initiation factor 3 complex, eIF3m
3. B GO:0006378 mRNA polyadenylation
3. B GO:0000437 carbon catabolite repression of transcription from RNA polymerase II promoter
3. B GO:0060117 auditory receptor cell development
3. B GO:0007026 negative regulation of microtubule depolymerization
3. B GO:0051568 histone H3-K4 methylation
3. B GO:0009944 polarity specification of adaxial/abaxial axis
3. B GO:0048920 posterior lateral line neuromast primordium migration
3. B GO:0033137 negative regulation of peptidyl-serine phosphorylation
3. B GO:0005092 GDP-dissociation inhibitor activity
3. B GO:1990630 IRE1-RACK1-PP2A complex
3. B GO:0048358 mucilage pectin biosynthetic process
3. B GO:0007611 learning or memory
3. B GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B GO:0045309 protein phosphorylated amino acid binding
3. B GO:0010393 galacturonan metabolic process
3. B GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
3. B GO:0046329 negative regulation of JNK cascade
3. B GO:0080008 Cul4-RING E3 ubiquitin ligase complex
3. B GO:0043122 regulation of I-kappaB kinase/NF-kappaB signaling
3. B GO:0061966 establishment of left/right asymmetry
3. B GO:0043204 perikaryon
3. B GO:0071363 cellular response to growth factor stimulus
3. B GO:1903138 negative regulation of cell wall integrity MAPK cascade
3. B GO:0042393 histone binding
3. B GO:0030332 cyclin binding
3. B GO:0060444 branching involved in mammary gland duct morphogenesis
3. B GO:0034613 cellular protein localization
3. B GO:0090176 microtubule cytoskeleton organization involved in establishment of planar polarity
3. B GO:0016593 Cdc73/Paf1 complex
3. B GO:0005852 eukaryotic translation initiation factor 3 complex
3. B GO:1903725 regulation of phospholipid metabolic process
3. B GO:0045598 regulation of fat cell differentiation
3. B GO:1902066 regulation of cell wall pectin metabolic process
3. B GO:0080001 mucilage extrusion from seed coat
3. B GO:0006919 activation of cysteine-type endopeptidase activity involved in apoptotic process
3. B GO:0043087 regulation of GTPase activity
3. B GO:0001961 positive regulation of cytokine-mediated signaling pathway
3. B GO:1902624 positive regulation of neutrophil migration
3. B GO:0031334 positive regulation of protein-containing complex assembly
3. B GO:0060290 transdifferentiation
3. B GO:0080182 histone H3-K4 trimethylation
3. B GO:0010659 cardiac muscle cell apoptotic process
3. B GO:0051302 regulation of cell division
3. B GO:0005875 microtubule associated complex
3. B GO:0051276 chromosome organization
3. B GO:0031929 TOR signaling
3. B GO:0043293 apoptosome
3. B GO:0007186 G protein-coupled receptor signaling pathway
3. B GO:0005829 cytosol
3. B GO:0046872 metal ion binding
3. B GO:0031276 obsolete negative regulation of lateral pseudopodium assembly
3. B GO:0070507 regulation of microtubule cytoskeleton organization
3. B GO:0090207 regulation of triglyceride metabolic process
3. B GO:0045202 synapse
3. B GO:0090102 cochlea development
3. B GO:0000139 Golgi membrane
3. B GO:0042249 establishment of planar polarity of embryonic epithelium
3. B GO:0042169 SH2 domain binding
3. B GO:1903208 negative regulation of hydrogen peroxide-induced neuron death
3. B GO:0030292 protein tyrosine kinase inhibitor activity
3. B GO:0051572 negative regulation of histone H3-K4 methylation
3. B GO:0072344 rescue of stalled ribosome
3. B GO:0005938 cell cortex
3. B GO:1901796 regulation of signal transduction by p53 class mediator
3. B GO:0045773 positive regulation of axon extension
3. B GO:0000433 carbon catabolite repression of transcription from RNA polymerase II promoter by glucose
3. B GO:0046982 protein heterodimerization activity
3. B GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A6NE52 WD repeat-containing protein 97 0 4.41e-175 0.0
2. P Q8HXL3 WD repeat-containing protein 62 2.05e-05 2.43e-04 NA
2. P E9Q5M6 Cilia- and flagella-associated protein 44 1.58e-02 7.88e-04 NA
2. P Q57WH1 Cilia- and flagella-associated protein 44 1.20e-02 1.37e-03 NA
2. P Q8NDM7 Cilia- and flagella-associated protein 43 1.66e-04 3.31e-06 NA
2. P Q580P9 Cilia- and flagella-associated protein 43 1.73e-04 1.21e-04 NA
2. P Q3U3T8 WD repeat-containing protein 62 7.77e-03 1.04e-04 NA
2. P E9Q7R9 Cilia- and flagella-associated protein 43 1.43e-04 6.44e-03 NA
2. P O60336 Mitogen-activated protein kinase-binding protein 1 1.43e-04 2.52e-02 NA
2. P O43379 WD repeat-containing protein 62 4.88e-03 7.97e-03 NA
2. P Q6DFF9 Mitogen-activated protein kinase-binding protein 1 2.57e-04 1.36e-03 NA
2. P Q99247 DUB-associated factor 1 5.52e-02 1.31e-02 NA
2. P Q6NS57 Mitogen-activated protein kinase-binding protein 1 4.34e-05 3.72e-02 NA
2. P A0A1L8GXY4 Cilia- and flagella-associated protein 43 1.34e-03 4.12e-06 NA
2. P Q96MT7 Cilia- and flagella-associated protein 44 1.84e-02 2.65e-05 NA
3. B Q9D994 WD repeat-containing protein 38 2.72e-03 NA 0.011
3. B Q5BE22 Pre-mRNA-splicing factor prp46 4.65e-03 NA 0.001
3. B Q7ZW33 U3 small nucleolar RNA-associated protein 15 homolog 4.47e-03 NA 0.013
3. B Q756D0 Ribosome biogenesis protein YTM1 3.61e-03 NA 0.024
3. B D1ZEM6 Nuclear distribution protein PAC1-2 3.93e-03 NA 0.002
3. B Q8YRI1 Uncharacterized WD repeat-containing protein alr3466 9.96e-05 NA 3.58e-04
3. B Q5BK30 Dynein assembly factor with WDR repeat domains 1 1.96e-04 NA 7.60e-04
3. B G4MQX3 MST50-interacting protein 11 3.66e-05 NA 0.002
3. B Q9I9H8 Apoptotic protease-activating factor 1 6.45e-06 NA 0.039
3. B B4JWA1 Lissencephaly-1 homolog 3.96e-04 NA 0.011
3. B B0BNA7 Eukaryotic translation initiation factor 3 subunit I 2.80e-04 NA 0.001
3. B D5GBI7 Nuclear distribution protein PAC1 2.37e-04 NA 4.50e-04
3. B P38129 Transcription initiation factor TFIID subunit 5 2.91e-02 NA 0.009
3. B P23232 Guanine nucleotide-binding protein subunit beta 3.41e-03 NA 0.034
3. B C6HTE8 Nuclear distribution protein PAC1 2.13e-04 NA 7.83e-05
3. B Q8N1V2 Cilia- and flagella-associated protein 52 6.95e-08 NA 0.012
3. B P0CS49 Pre-mRNA-splicing factor PRP46 6.75e-03 NA 0.024
3. B Q7S7L4 Nuclear distribution protein nudF-1 8.66e-03 NA 0.002
3. B B0XTS1 Probable E3 ubiquitin ligase complex SCF subunit sconB 5.11e-02 NA 0.020
3. B P61964 WD repeat-containing protein 5 1.20e-03 NA 1.42e-04
3. B Q75AV4 Polyadenylation factor subunit 2 3.08e-04 NA 0.049
3. B O14170 WD repeat-containing protein pop2 3.83e-03 NA 0.011
3. B O74855 Ribosome assembly protein 4 1.89e-03 NA 0.012
3. B Q8CGF6 WD repeat-containing protein 47 1.81e-01 NA 0.029
3. B Q6ZQQ6 WD repeat-containing protein 87 NA NA 0.010
3. B P74442 Uncharacterized WD repeat-containing protein slr0143 2.52e-06 NA 3.07e-05
3. B Q5A7Q3 Pre-mRNA-splicing factor PRP46 1.46e-03 NA 6.54e-04
3. B P0CS42 Nuclear distribution protein PAC1 2.40e-04 NA 0.004
3. B Q2GTM8 Eukaryotic translation initiation factor 3 subunit I 1.15e-02 NA 0.002
3. B A6RUL1 Eukaryotic translation initiation factor 3 subunit I 1.20e-04 NA 0.011
3. B Q95JL5 Cilia- and flagella-associated protein 52 1.00e-05 NA 0.010
3. B Q9C827 Coatomer subunit beta'-2 7.67e-06 NA 2.09e-04
3. B P90648 Myosin heavy chain kinase B 3.17e-02 NA 0.014
3. B Q5F201 Cilia- and flagella-associated protein 52 2.54e-08 NA 0.003
3. B Q6TMK6 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 NA NA 0.018
3. B G0SC29 Ribosome assembly protein 4 1.34e-03 NA 0.047
3. B Q7RXH4 Eukaryotic translation initiation factor 3 subunit I 1.13e-02 NA 0.004
3. B Q5ZK69 Proteasomal ATPase-associated factor 1 6.99e-04 NA 5.64e-04
3. B Q54ZP5 WD repeat-containing protein 48 homolog 9.88e-02 NA 0.039
3. B Q75BY3 Pre-mRNA-splicing factor PRP46 1.78e-04 NA 4.19e-07
3. B Q05946 U3 small nucleolar RNA-associated protein 13 3.95e-06 NA 0.002
3. B Q4R7Y4 Guanine nucleotide-binding protein subunit beta-2-like 1 5.85e-05 NA 0.021
3. B A4R3M4 Nuclear distribution protein PAC1 2.02e-04 NA 5.74e-05
3. B Q66J51 Eukaryotic translation initiation factor 3 subunit I 2.72e-04 NA 0.002
3. B Q91WQ5 TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L 1.06e-02 NA 0.001
3. B Q6P2Y2 Dynein assembly factor with WDR repeat domains 1 7.66e-04 NA 0.001
3. B Q803D2 Lissencephaly-1 homolog B 7.98e-04 NA 0.005
3. B Q9UNX4 WD repeat-containing protein 3 2.01e-05 NA 3.32e-04
3. B C5FP68 Probable E3 ubiquitin ligase complex SCF subunit sconB 2.18e-02 NA 0.003
3. B Q7T0P4 POC1 centriolar protein homolog A 2.36e-03 NA 0.003
3. B A7THX0 Mitochondrial division protein 1 2.48e-02 NA 0.037
3. B C0NRC6 Nuclear distribution protein PAC1 3.27e-04 NA 7.83e-05
3. B Q9AUR8 Coatomer subunit alpha-1 1.35e-03 NA 7.13e-04
3. B A6H603 NACHT domain- and WD repeat-containing protein 1 4.92e-04 NA 4.59e-04
3. B Q9C1X1 Periodic tryptophan protein 2 homolog 3.07e-05 NA 0.001
3. B Q8MYE8 Probable proteasomal ATPase-associated factor 1 1.46e-03 NA 0.016
3. B Q8JZX3 POC1 centriolar protein homolog A 5.17e-03 NA 1.31e-04
3. B Q6ED65 Echinoderm microtubule-associated protein-like 5 1.13e-03 NA 0.003
3. B C5MJE8 Nuclear distribution protein PAC1 1.70e-04 NA 0.003
3. B P41318 Target of rapamycin complex subunit LST8 2.48e-04 NA 7.36e-05
3. B Q12024 Ribosome biogenesis protein YTM1 3.77e-03 NA 0.001
3. B Q149M9 NACHT domain- and WD repeat-containing protein 1 4.50e-04 NA 2.08e-04
3. B O24076 Guanine nucleotide-binding protein subunit beta-like protein 3.41e-04 NA 4.78e-04
3. B Q8NBT0 POC1 centriolar protein homolog A 6.39e-03 NA 7.41e-04
3. B P49695 Probable serine/threonine-protein kinase PkwA 4.42e-02 NA 1.10e-04
3. B A8X8C6 WD repeat-containing protein tag-125 1.59e-03 NA 1.39e-04
3. B Q6NZH4 Lissencephaly-1 homolog 2.59e-05 NA 0.001
3. B Q9NWT1 p21-activated protein kinase-interacting protein 1 3.37e-03 NA 4.86e-04
3. B C7Z6H2 Nuclear distribution protein PAC1 2.75e-04 NA 0.001
3. B Q61FW2 F-box/WD repeat-containing protein sel-10 1.00e-03 NA 9.12e-05
3. B B0LSW3 Platelet-activating factor acetylhydrolase IB subunit beta 3.25e-03 NA 0.001
3. B P49846 Transcription initiation factor TFIID subunit 5 1.79e-02 NA 0.004
3. B P39014 F-box protein MET30 3.33e-02 NA 0.003
3. B O74319 Transcription initiation factor TFIID subunit taf73 2.61e-02 NA 0.009
3. B P41811 Coatomer subunit beta' 8.37e-06 NA 0.024
3. B Q3ULA2 F-box/WD repeat-containing protein 1A 6.48e-02 NA 0.005
3. B A2QP30 Nuclear distribution protein nudF 2.65e-03 NA 0.003
3. B P0CS48 Pre-mRNA-splicing factor PRP46 8.39e-03 NA 0.025
3. B Q8YV57 Uncharacterized WD repeat-containing protein all2124 9.35e-06 NA 2.59e-07
3. B Q4I7X1 Polyadenylation factor subunit 2 1.99e-02 NA 0.009
3. B Q8HXX0 Platelet-activating factor acetylhydrolase IB subunit alpha 3.53e-03 NA 0.002
3. B Q39190 Protein pleiotropic regulator PRL2 3.66e-03 NA 0.006
3. B Q4R8E7 Dynein assembly factor with WDR repeat domains 1 1.89e-04 NA 0.007
3. B P61965 WD repeat-containing protein 5 1.20e-03 NA 1.42e-04
3. B Q6CI08 Eukaryotic translation initiation factor 3 subunit I 5.88e-04 NA 0.025
3. B Q8I0F4 Lissencephaly-1 homolog 9.12e-04 NA 3.12e-06
3. B Q498M4 WD repeat-containing protein 5 1.22e-03 NA 1.42e-04
3. B B0XM00 Nuclear distribution protein nudF 3.03e-04 NA 0.004
3. B Q8C570 mRNA export factor 4.37e-03 NA 0.021
3. B P29829 Guanine nucleotide-binding protein subunit beta-2 9.68e-04 NA 0.016
3. B Q9BRP4 Proteasomal ATPase-associated factor 1 5.01e-04 NA 0.007
3. B P25635 Periodic tryptophan protein 2 3.99e-04 NA 4.18e-04
3. B P43033 Platelet-activating factor acetylhydrolase IB subunit beta 2.89e-05 NA 0.001
3. B P63244 Receptor of activated protein C kinase 1 5.66e-05 NA 0.021
3. B Q8C0J2 Autophagy-related protein 16-1 6.84e-03 NA 0.006
3. B Q5RF99 mRNA export factor 4.77e-03 NA 0.032
3. B Q9VZF4 F-box/WD repeat-containing protein 7 2.44e-02 NA 0.011
3. B Q00808 Vegetative incompatibility protein HET-E-1 2.53e-04 NA 0.021
3. B Q0U1B1 Nuclear distribution protein PAC1 2.28e-04 NA 1.90e-04
3. B P63246 Receptor of activated protein C kinase 1 5.74e-05 NA 0.021
3. B Q17963 WD repeat-containing protein wdr-5.1 8.66e-04 NA 0.004
3. B C0S902 Nuclear distribution protein PAC1 5.15e-03 NA 5.10e-04
3. B Q8N136 Dynein assembly factor with WDR repeat domains 1 2.00e-04 NA 0.002
3. B B2VWG7 Nuclear distribution protein PAC1 4.83e-05 NA 7.58e-04
3. B P78406 mRNA export factor 4.68e-03 NA 0.032
3. B Q7ZVF0 POC1 centriolar protein homolog A 6.83e-03 NA 0.004
3. B Q90ZL4 Lissencephaly-1 homolog 9.02e-04 NA 0.001
3. B P20484 Protein MAK11 2.75e-03 NA 0.027
3. B Q6BVZ3 Polyadenylation factor subunit 2 1.44e-02 NA 0.001
3. B A5GFN6 mRNA export factor 4.37e-03 NA 0.018
3. B P63245 Receptor of activated protein C kinase 1 5.78e-05 NA 0.021
3. B B6QC56 Nuclear distribution protein nudF 1 2.55e-04 NA 3.10e-05
3. B P79959 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 1.12e-03 NA 0.021
3. B Q8YTC2 Uncharacterized WD repeat-containing protein alr2800 3.42e-06 NA 7.98e-06
3. B Q9C270 Periodic tryptophan protein 2 homolog 8.65e-05 NA 0.002
3. B Q2UQ34 Eukaryotic translation initiation factor 3 subunit I 9.57e-05 NA 0.033
3. B Q4WLM7 Nuclear distribution protein nudF 3.77e-05 NA 0.004
3. B C4YPI7 Nuclear distribution protein PAC1 2.47e-04 NA 0.014
3. B Q4V7Y7 Katanin p80 WD40 repeat-containing subunit B1 2.98e-04 NA 0.002
3. B P87060 WD repeat-containing protein pop1 1.77e-02 NA 0.004
3. B A8XZJ9 Lissencephaly-1 homolog 3.44e-03 NA 6.44e-04
3. B A5DGL8 Eukaryotic translation initiation factor 3 subunit I 2.30e-03 NA 0.021
3. B P0CS43 Nuclear distribution protein PAC1 2.37e-04 NA 0.004
3. B B6GZD3 Nuclear distribution protein nudF 2 3.36e-05 NA 3.93e-04
3. B Q7LKZ7 Beige protein homolog 1 5.36e-01 NA 0.027
3. B Q3SWS8 mRNA export factor 4.37e-03 NA 0.021
3. B Q55E54 Coronin-B 1.81e-04 NA 0.038
3. B Q5GIS3 Guanine nucleotide-binding protein subunit beta 3.32e-03 NA 0.001
3. B D3BUN1 Lissencephaly-1 homolog 3.12e-05 NA 0.005
3. B P54319 Phospholipase A-2-activating protein 3.08e-03 NA 0.007
3. B Q9CAA0 Coatomer subunit beta'-1 1.57e-05 NA 3.03e-05
3. B Q6GMD2 WD repeat-containing protein 61 8.15e-06 NA 0.009
3. B P78706 Transcriptional repressor rco-1 1.43e-02 NA 0.023
3. B Q94A40 Coatomer subunit alpha-1 6.98e-04 NA 8.73e-04
3. B Q9HAV0 Guanine nucleotide-binding protein subunit beta-4 8.45e-04 NA 0.007
3. B Q8K450 Sperm-associated antigen 16 protein 4.77e-03 NA 2.43e-05
3. B Q4ICM0 Nuclear distribution protein PAC1 2.87e-04 NA 0.002
3. B Q0J3D9 Coatomer subunit alpha-3 5.75e-04 NA 6.18e-04
3. B Q0D0X6 Nuclear distribution protein nudF 3.47e-04 NA 2.68e-04
3. B Q6DH44 WD repeat domain-containing protein 83 6.28e-05 NA 0.009
3. B B2AEZ5 Nuclear distribution protein PAC1-1 3.64e-04 NA 2.45e-04
3. B Q7ZWF0 mRNA export factor 4.08e-03 NA 0.016
3. B Q21215 Guanine nucleotide-binding protein subunit beta-2-like 1 2.92e-04 NA 0.004
3. B P54313 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 1.07e-03 NA 0.002
3. B Q9EPV5 Apoptotic protease-activating factor 1 1.08e-05 NA 0.001
3. B P62873 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 1.10e-03 NA 0.018
3. B A7EKM8 Nuclear distribution protein PAC1 7.51e-03 NA 0.002
3. B Q4V7Z1 POC1 centriolar protein homolog B 3.64e-03 NA 0.005
3. B Q6FJZ9 Pre-mRNA-splicing factor PRP46 1.18e-03 NA 2.01e-07
3. B Q9PTR5 Lissencephaly-1 homolog 4.43e-04 NA 0.002
3. B Q5ZKU8 p21-activated protein kinase-interacting protein 1-like 5.04e-03 NA 0.014
3. B Q6NLV4 Flowering time control protein FY 7.00e-02 NA 4.38e-04
3. B Q15542 Transcription initiation factor TFIID subunit 5 2.26e-02 NA 5.74e-04
3. B B6HP56 Nuclear distribution protein nudF 1 2.83e-04 NA 0.002
3. B Q01369 Guanine nucleotide-binding protein subunit beta-like protein 5.45e-05 NA 5.84e-04
3. B O24456 Receptor for activated C kinase 1A 3.73e-04 NA 6.41e-05
3. B P46800 Guanine nucleotide-binding protein subunit beta-like protein 2.28e-04 NA 0.004
3. B O35353 Guanine nucleotide-binding protein subunit beta-4 1.13e-03 NA 0.031
3. B Q5IH81 Eukaryotic translation initiation factor 3 subunit I 3.16e-04 NA 0.001
3. B P62883 Guanine nucleotide-binding protein subunit beta-like protein 3.06e-04 NA 7.38e-05
3. B Q6CKE8 Pre-mRNA-splicing factor PRP46 5.97e-04 NA 1.42e-05
3. B Q6H8D5 Coatomer subunit beta'-2 3.29e-05 NA 5.70e-04
3. B Q6H8D6 Putative coatomer subunit beta'-3 2.34e-05 NA 3.58e-04
3. B Q6FKK3 Ribosome biogenesis protein YTM1 1.82e-03 NA 0.021
3. B O88879 Apoptotic protease-activating factor 1 9.85e-06 NA 0.001
3. B Q12417 Pre-mRNA-splicing factor PRP46 2.80e-04 NA 3.45e-06
3. B Q28I85 POC1 centriolar protein homolog A 2.90e-03 NA 0.008
3. B Q96WV5 Putative coatomer subunit alpha 1.95e-04 NA 0.033
3. B Q9AUR7 Coatomer subunit alpha-2 1.13e-03 NA 5.31e-04
3. B Q5I0B9 Autophagy-related protein 16 3.79e-03 NA 0.005
3. B P25382 Ribosome assembly protein 4 1.51e-03 NA 0.015
3. B P49026 Guanine nucleotide-binding protein subunit beta-like protein 3.17e-04 NA 7.98e-04
3. B Q5BLX8 WD repeat domain-containing protein 83 4.99e-04 NA 0.048
3. B P62871 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 1.10e-03 NA 0.018
3. B Q3Y8L7 Dynein assembly factor with WDR repeat domains 1 2.08e-04 NA 0.006
3. B Q8BG40 Katanin p80 WD40 repeat-containing subunit B1 1.16e-02 NA 3.70e-05
3. B Q42384 Protein pleiotropic regulatory locus 1 5.70e-03 NA 0.002
3. B Q7RY68 Polyadenylation factor subunit 2 5.84e-02 NA 8.91e-05
3. B Q68FJ6 p21-activated protein kinase-interacting protein 1-like 1.91e-03 NA 0.001
3. B Q9SY00 COMPASS-like H3K4 histone methylase component WDR5B 4.09e-04 NA 2.59e-05
3. B Q9UMS4 Pre-mRNA-processing factor 19 4.53e-03 NA 0.016
3. B B0XYC8 Eukaryotic translation initiation factor 3 subunit I 1.08e-04 NA 0.023
3. B B9WD30 Nuclear distribution protein PAC1 2.66e-04 NA 0.010
3. B Q27GK7 Topless-related protein 4 4.62e-04 NA 0.002
3. B P63004 Platelet-activating factor acetylhydrolase IB subunit alpha 1.72e-03 NA 0.001
3. B D4DG66 Nuclear distribution protein PAC1 2.85e-04 NA 8.63e-04
3. B Q9QZD9 Eukaryotic translation initiation factor 3 subunit I 2.85e-04 NA 0.001
3. B Q55FR9 Coatomer subunit alpha 1.39e-03 NA 0.005
3. B O42248 Guanine nucleotide-binding protein subunit beta-2-like 1 5.62e-05 NA 0.016
3. B Q0CXH9 Eukaryotic translation initiation factor 3 subunit I 1.00e-04 NA 0.030
3. B Q2GT28 Nuclear distribution protein PAC1-2 4.82e-05 NA 4.96e-04
3. B O74184 Target of rapamycin complex subunit wat1 4.49e-04 NA 0.006
3. B A7EF03 Eukaryotic translation initiation factor 3 subunit I 1.21e-04 NA 0.008
3. B A2CEH0 POC1 centriolar protein homolog B 8.03e-03 NA 0.002
3. B Q5XGI5 WD repeat domain-containing protein 83 5.45e-04 NA 0.002
3. B P38011 Guanine nucleotide-binding protein subunit beta-like protein 6.55e-05 NA 3.71e-04
3. B Q2KIG2 WD repeat-containing protein 5 1.82e-04 NA 1.30e-04
3. B A1C7E4 Probable E3 ubiquitin ligase complex SCF subunit sconB 3.98e-02 NA 8.68e-04
3. B Q8NI36 WD repeat-containing protein 36 1.49e-04 NA 0.004
3. B Q09990 F-box/WD repeat-containing protein lin-23 4.69e-02 NA 0.001
3. B P69104 Guanine nucleotide-binding protein subunit beta-like protein 3.25e-04 NA 1.01e-04
3. B P53622 Coatomer subunit alpha 1.11e-04 NA 4.17e-05
3. B Q5A7Q6 Nuclear distribution protein PAC1 4.56e-04 NA 0.014
3. B Q9LV28 Receptor for activated C kinase 1C 3.20e-04 NA 7.68e-05
3. B P62880 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 1.09e-03 NA 0.002
3. B O43017 Set1 complex component swd3 4.21e-03 NA 0.008
3. B Q9LRZ0 Topless-related protein 2 1.08e-04 NA 0.007
3. B Q9BRX9 WD repeat domain-containing protein 83 6.03e-04 NA 0.035
3. B Q08E38 Pre-mRNA-processing factor 19 4.89e-03 NA 0.016
3. B Q8L4M1 THO complex subunit 6 3.30e-04 NA 8.92e-04
3. B B5X3C4 Lissencephaly-1 homolog B 2.29e-05 NA 0.006
3. B P63247 Receptor of activated protein C kinase 1 5.65e-05 NA 0.021
3. B B6Q4Z5 Probable E3 ubiquitin ligase complex SCF subunit sconB 2.44e-02 NA 0.038
3. B P0CS45 Mitochondrial division protein 1 1.24e-01 NA 0.003
3. B Q9D7H2 WD repeat-containing protein 5B 6.86e-04 NA 0.035
3. B Q54RP0 UDP-galactose:fucoside alpha-3-galactosyltransferase 2.98e-02 NA 1.06e-07
3. B Q4X0A9 Probable E3 ubiquitin ligase complex SCF subunit sconB 2.04e-02 NA 0.020
3. B C5FWH1 Nuclear distribution protein PAC1 4.16e-05 NA 2.41e-05
3. B Q99KP6 Pre-mRNA-processing factor 19 5.04e-03 NA 0.017
3. B Q5FVB6 tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4 1.20e-02 NA 6.20e-04
3. B O75529 TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L 2.35e-02 NA 0.001
3. B Q27954 Coatomer subunit alpha 5.68e-04 NA 0.008
3. B Q9Y297 F-box/WD repeat-containing protein 1A 1.12e-02 NA 0.010
3. B O43818 U3 small nucleolar RNA-interacting protein 2 6.58e-04 NA 4.42e-05
3. B P54311 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 1.08e-03 NA 0.018
3. B Q5R5W8 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 1.12e-03 NA 0.018
3. B Q5IS43 Platelet-activating factor acetylhydrolase IB subunit alpha 2.26e-05 NA 0.001
3. B B8M0Q1 Nuclear distribution protein nudF 2.69e-04 NA 6.08e-05
3. B Q25189 Guanine nucleotide-binding protein subunit beta-like protein 3.96e-05 NA 0.023
3. B Q6GM65 Phospholipase A-2-activating protein 7.03e-03 NA 0.007
3. B A2QCU8 Probable E3 ubiquitin ligase complex SCF subunit sconB 2.73e-02 NA 0.011
3. B Q9C4Z6 Receptor for activated C kinase 1B 3.13e-04 NA 1.73e-04
3. B Q6L4F8 Guanine nucleotide-binding protein subunit beta-like protein B 3.54e-04 NA 2.18e-05
3. B C3XVT5 Lissencephaly-1 homolog 2.75e-04 NA 0.006
3. B Q54D08 Protein LST8 homolog 2.21e-04 NA 5.59e-04
3. B Q6TNS2 p21-activated protein kinase-interacting protein 1-like 2.51e-03 NA 0.002
3. B C1GB49 Nuclear distribution protein PAC1 3.41e-03 NA 4.92e-04
3. B P0DPA1 WD repeat-containing protein DDB_G0349043 8.44e-03 NA 0.004
3. B Q9V3J8 Protein will die slowly 2.33e-04 NA 4.08e-04
3. B Q10NY2 Protein TPR3 3.50e-04 NA 0.010
3. B Q9SJT9 Coatomer subunit alpha-2 4.78e-03 NA 0.001
3. B C5PFX0 Nuclear distribution protein PAC1 3.43e-03 NA 2.00e-04
3. B Q2KID6 Pleiotropic regulator 1 5.44e-03 NA 6.53e-04
3. B A1CJY4 Eukaryotic translation initiation factor 3 subunit I 1.11e-04 NA 0.005
3. B B8M7Q5 Probable E3 ubiquitin ligase complex SCF subunit sconB 1.62e-01 NA 0.015
3. B P38123 COMPASS component SWD3 3.27e-04 NA 4.25e-05
3. B P53196 26S proteasome regulatory subunit RPN14 1.06e-03 NA 2.48e-04
3. B Q9BVA0 Katanin p80 WD40 repeat-containing subunit B1 5.82e-04 NA 3.36e-05
3. B Q9DCE5 p21-activated protein kinase-interacting protein 1 3.47e-03 NA 0.007
3. B Q8BHD1 POC1 centriolar protein homolog B 3.55e-03 NA 2.69e-04
3. B O13282 Transcription initiation factor TFIID subunit 5 2.66e-02 NA 6.80e-04
3. B Q6FLI3 CCR4-associated factor 4 homolog 9.82e-03 NA 1.93e-06
3. B C5GVJ9 Nuclear distribution protein PAC1 6.13e-03 NA 4.26e-04
3. B Q13347 Eukaryotic translation initiation factor 3 subunit I 2.88e-04 NA 0.001
3. B O43660 Pleiotropic regulator 1 5.75e-03 NA 6.71e-04
3. B Q4WX90 Eukaryotic translation initiation factor 3 subunit I 1.06e-04 NA 0.023
3. B O48847 Transcriptional corepressor LEUNIG_HOMOLOG 1.67e-02 NA 0.006
3. B F4IIK6 Non-functional target of rapamycin complex subunit LST8-2 2.89e-04 NA 8.32e-05
3. B B3S4I5 Lissencephaly-1 homolog 1.25e-03 NA 3.61e-06
3. B Q5E9A4 mRNA export factor 4.27e-03 NA 0.024
3. B Q4P9P9 Nuclear distribution protein PAC1 8.08e-03 NA 4.15e-05
3. B P79083 Eukaryotic translation initiation factor 3 subunit I 3.14e-04 NA 0.001
3. B B4LQ21 Lissencephaly-1 homolog 3.66e-03 NA 0.026
3. B P79147 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 3.97e-03 NA 6.62e-04
3. B O94365 U3 small nucleolar RNA-associated protein 15 2.22e-03 NA 0.027
3. B C4JPW9 Nuclear distribution protein PAC1-2 2.25e-04 NA 3.79e-05
3. B Q0P593 Dynein assembly factor with WDR repeat domains 1 4.68e-05 NA 0.001
3. B Q8VYZ5 Periodic tryptophan protein 2 6.32e-07 NA 6.35e-04
3. B Q8NA23 WD repeat-containing protein 31 1.27e-03 NA 0.022
3. B P62884 Guanine nucleotide-binding protein subunit beta-like protein 3.11e-04 NA 7.38e-05
3. B Q5RFQ3 Periodic tryptophan protein 2 homolog 1.25e-05 NA 0.002
3. B A8NEG8 Nuclear distribution protein PAC1 3.41e-05 NA 3.20e-07
3. B Q6S7B0 Transcription initiation factor TFIID subunit 5 1.35e-02 NA 0.029
3. B Q10122 Suppressor of organelle fusion 2 1.07e-01 NA 0.025
3. B Q5ZMA2 Pre-mRNA-processing factor 19 3.83e-03 NA 0.042
3. B Q7ZY78 tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4 4.95e-02 NA 0.006
3. B Q9UUG8 Transcriptional repressor tup12 6.23e-03 NA 0.004
3. B C4Q0P6 Lissencephaly-1 homolog 9.68e-04 NA 2.23e-06
3. B A0JP70 WD repeat-containing protein 90 3.75e-03 NA 0.006
3. B Q2UGU1 Nuclear distribution protein nudF 3.65e-03 NA 1.78e-05
3. B Q25306 Guanine nucleotide-binding protein subunit beta-like protein 3.11e-04 NA 5.46e-05
3. B P53621 Coatomer subunit alpha 5.63e-04 NA 0.010
3. B Q8BQM8 Echinoderm microtubule-associated protein-like 5 1.21e-03 NA 0.003
3. B Q4R6D2 mRNA export factor 4.29e-03 NA 0.028
3. B Q6P5M2 WD repeat-containing protein 61 8.10e-06 NA 0.020
3. B O22212 U4/U6 small nuclear ribonucleoprotein PRP4-like protein 1.31e-02 NA 0.005
3. B A1CF18 Nuclear distribution protein nudF 2 2.90e-04 NA 3.50e-05
3. B Q9VU65 POC1 centriolar protein homolog 1.73e-04 NA 5.11e-04
3. B Q68EI0 WD repeat-containing protein 18 3.03e-02 NA 0.012
3. B Q91854 Beta-TrCP 9.58e-03 NA 0.015
3. B Q08706 Guanine nucleotide-binding protein subunit beta 3.35e-03 NA 0.002
3. B Q94AI7 Protein TOPLESS 3.68e-05 NA 0.025
3. B A1D7I5 Eukaryotic translation initiation factor 3 subunit I 1.15e-04 NA 0.023
3. B Q6BU94 Pre-mRNA-splicing factor PRP46 7.43e-04 NA 4.66e-04
3. B Q5M786 WD repeat-containing protein 5 1.83e-04 NA 1.31e-04
3. B O95170 CMT1A duplicated region transcript 1 protein 3.81e-02 NA 0.019
3. B Q5XX13 F-box/WD repeat-containing protein 10 2.43e-01 NA 0.011
3. B B6QC06 Nuclear distribution protein nudF 2 2.70e-04 NA 0.004
3. B Q54KL5 WD repeat-containing protein 5 homolog 2.74e-04 NA 7.51e-05
3. B P57081 tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4 2.46e-02 NA 0.013
3. B Q5VQ78 Coatomer subunit beta'-1 7.03e-06 NA 3.26e-04
3. B Q2UFN8 Probable E3 ubiquitin ligase complex SCF subunit sconB 2.23e-02 NA 0.002
3. B Q9Y263 Phospholipase A-2-activating protein 4.53e-03 NA 0.006
3. B Q15269 Periodic tryptophan protein 2 homolog 1.30e-05 NA 3.87e-04
3. B O45040 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 1.15e-03 NA 0.035
3. B Q54PE0 Periodic tryptophan protein 2 homolog 1.11e-03 NA 0.001
3. B Q54S79 WD repeat-containing protein 3 homolog 6.18e-07 NA 0.001
3. B P62872 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 1.10e-03 NA 0.018
3. B Q9M2Z2 COMPASS-like H3K4 histone methylase component WDR5A 5.59e-05 NA 2.71e-05
3. B Q9AYE4 Target of rapamycin complex subunit LST8 2.69e-04 NA 0.014
3. B P63005 Platelet-activating factor acetylhydrolase IB subunit beta 2.99e-05 NA 0.001
3. B Q5R7R2 Eukaryotic translation initiation factor 3 subunit I 2.84e-04 NA 0.001
3. B Q0CY32 Probable E3 ubiquitin ligase complex SCF subunit sconB 2.69e-02 NA 0.009
3. B P63243 Receptor of activated protein C kinase 1 5.85e-05 NA 0.021
3. B Q2HBX6 Nuclear distribution protein PAC1-1 5.94e-05 NA 1.79e-05
3. B Q8C092 Transcription initiation factor TFIID subunit 5 1.81e-02 NA 4.49e-04
3. B Q09855 F-box/WD repeat-containing protein pof11 8.50e-03 NA 1.70e-04
3. B Q9FUY2 Transcriptional corepressor LEUNIG 1.60e-03 NA 7.91e-04
3. B O13615 Pre-mRNA-splicing factor prp5 1.03e-02 NA 0.037
3. B P93340 Guanine nucleotide-binding protein subunit beta-like protein 3.48e-04 NA 0.001
3. B Q148I1 Proteasomal ATPase-associated factor 1 5.62e-04 NA 0.010
3. B Q922V4 Pleiotropic regulator 1 8.67e-03 NA 0.001
3. B Q5E966 Eukaryotic translation initiation factor 3 subunit I 2.93e-04 NA 0.001
3. B Q10281 Guanine nucleotide-binding protein subunit beta-like protein 2.72e-04 NA 2.64e-05
3. B Q8CIE6 Coatomer subunit alpha 2.38e-04 NA 0.008
3. B Q00659 Probable E3 ubiquitin ligase complex SCF subunit sconB 2.89e-01 NA 0.014
3. B D4AZ50 Nuclear distribution protein PAC1 2.97e-04 NA 8.63e-04
3. B O22785 Pre-mRNA-processing factor 19 homolog 2 8.03e-03 NA 0.009
3. B Q9FLX9 Notchless protein homolog 1.08e-03 NA 0.002
3. B D1ZEB4 Nuclear distribution protein PAC1-1 2.84e-04 NA 0.004
3. B Q6NVM2 Katanin p80 WD40 repeat-containing subunit B1 1.43e-02 NA 0.002
3. B B8N9H4 Nuclear distribution protein nudF 3.79e-03 NA 1.78e-05
3. B Q5JTN6 WD repeat-containing protein 38 3.80e-04 NA 0.025
3. B Q5ZIU8 Katanin p80 WD40 repeat-containing subunit B1 4.44e-03 NA 1.41e-05
3. B P62879 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 1.10e-03 NA 0.002
3. B A6ZPA9 Ribosome biogenesis protein YTM1 3.79e-03 NA 0.001
3. B Q5EA99 p21-activated protein kinase-interacting protein 1 4.93e-03 NA 2.84e-04
3. B Q55563 Uncharacterized WD repeat-containing protein sll0163 1.08e-03 NA 1.38e-04
3. B Q7ZV55 Eukaryotic translation initiation factor 3 subunit I 3.22e-04 NA 0.010
3. B B4MA12 tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho 1.71e-02 NA 0.021
3. B P93107 Flagellar WD repeat-containing protein Pf20 4.88e-03 NA 2.44e-04
3. B Q9JMJ4 Pre-mRNA-processing factor 19 9.66e-03 NA 0.017
3. B D3ZW91 POC1 centriolar protein homolog B 1.32e-03 NA 0.001
3. B O42249 Guanine nucleotide-binding protein subunit beta-2-like 1 5.66e-05 NA 0.016
3. B A2QEV8 Eukaryotic translation initiation factor 3 subunit I 1.17e-04 NA 0.027
3. B O62471 Protein qui-1 6.93e-03 NA 0.002
3. B P68040 Receptor of activated protein C kinase 1 6.06e-05 NA 0.021
3. B Q7T394 Lissencephaly-1 homolog A 1.78e-04 NA 0.009
3. B D3TLL6 Lissencephaly-1 homolog 4.58e-03 NA 0.008
3. B A1CUD6 Nuclear distribution protein nudF 1 4.73e-05 NA 0.001
3. B A8ILK1 Cilia- and flagella-associated protein 52 5.08e-08 NA 0.004
3. B P0CS44 Mitochondrial division protein 1 1.17e-01 NA 0.003
3. B Q9WUC8 Pleiotropic regulator 1 4.87e-03 NA 6.43e-04
3. B Q5RAC9 Autophagy-related protein 16-1 6.54e-03 NA 0.023
3. B P83774 Guanine nucleotide-binding protein subunit beta-like protein 7.75e-05 NA 3.48e-06
3. B O94967 WD repeat-containing protein 47 2.06e-02 NA 0.029
3. B Q9NDC9 Lissencephaly-1 homolog 1.27e-03 NA 0.002
3. B O61585 Katanin p80 WD40 repeat-containing subunit B1 7.16e-04 NA 7.32e-06
3. B Q1LV15 Dynein assembly factor with WDR repeat domains 1 7.06e-04 NA 6.67e-04
3. B Q5EBE8 Eukaryotic translation initiation factor 3 subunit I 2.73e-04 NA 7.61e-04
3. B Q2TBP4 POC1 centriolar protein homolog A 1.13e-02 NA 5.97e-04
3. B Q61011 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 3.74e-03 NA 5.46e-04
3. B Q09715 Transcriptional repressor tup11 1.19e-02 NA 4.74e-04
3. B Q6PH57 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 1.13e-03 NA 7.29e-04
3. B B5FZ19 Eukaryotic translation initiation factor 3 subunit I 2.48e-04 NA 0.003
3. B B5X3Z6 Lissencephaly-1 homolog A 2.23e-04 NA 0.002
3. B Q84JM4 Topless-related protein 3 9.31e-05 NA 0.010
3. B Q5RE95 WD repeat-containing protein 5B 5.85e-04 NA 0.007
3. B Q39836 Guanine nucleotide-binding protein subunit beta-like protein 3.36e-04 NA 7.22e-04
3. B Q7RY30 Nuclear distribution protein nudF-2 3.04e-04 NA 0.001
3. B Q9LV27 Target of rapamycin complex subunit LST8-1 2.85e-04 NA 0.042
3. B Q86VZ2 WD repeat-containing protein 5B 1.95e-04 NA 0.005
3. B B4MY65 Lissencephaly-1 homolog 4.06e-04 NA 0.020
3. B Q9VPR4 Protein Notchless 1.13e-03 NA 5.74e-05
3. B Q5REG7 Platelet-activating factor acetylhydrolase IB subunit alpha 2.84e-05 NA 0.002
3. B Q6PBD6 WD repeat-containing protein 61 6.32e-06 NA 0.028
3. B A9V790 Lissencephaly-1 homolog 3.65e-04 NA 6.11e-04
3. B Q5FWQ6 Dynein assembly factor with WDR repeat domains 1 7.46e-04 NA 0.001
3. B Q17N69 Lissencephaly-1 homolog 2.57e-03 NA 0.003
3. B P62874 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 1.10e-03 NA 0.018
3. B P69103 Guanine nucleotide-binding protein subunit beta-like protein 3.10e-04 NA 1.01e-04
3. B C5JD40 Nuclear distribution protein PAC1 5.84e-03 NA 4.26e-04
3. B P29387 Guanine nucleotide-binding protein subunit beta-4 1.14e-03 NA 0.031
3. B Q91WM3 U3 small nucleolar RNA-interacting protein 2 2.25e-03 NA 3.57e-04
3. B P49027 Guanine nucleotide-binding protein subunit beta-like protein A 4.69e-04 NA 5.49e-04
3. B B7PS00 Lissencephaly-1 homolog 2.14e-05 NA 0.003
3. B Q6C709 Pre-mRNA-splicing factor PRP46 1.85e-02 NA 1.47e-05
3. B Q7ZUV2 Katanin p80 WD40 repeat-containing subunit B1 2.73e-03 NA 2.20e-04
3. B A7TLU2 Probable cytosolic iron-sulfur protein assembly protein 1 7.47e-05 NA 0.024
3. B P52287 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 3.83e-03 NA 5.66e-04
3. B P16520 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 3.71e-03 NA 5.51e-04
3. B Q05BV3 Echinoderm microtubule-associated protein-like 5 1.02e-03 NA 0.006
3. B P43034 Platelet-activating factor acetylhydrolase IB subunit beta 3.46e-03 NA 0.001
3. B P11017 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 1.09e-03 NA 0.002
3. B P27612 Phospholipase A-2-activating protein 4.16e-03 NA 0.004
3. B A1DP19 Nuclear distribution protein nudF 4.37e-04 NA 0.004
3. B Q9AV81 Pre-mRNA-processing factor 19 3.50e-03 NA 0.017
3. B C4JZS6 Nuclear distribution protein PAC1-1 3.81e-04 NA 2.22e-04
3. B P87053 F-box/WD repeat-containing protein pof1 1.71e-02 NA 4.39e-06
3. B Q8BHB4 WD repeat-containing protein 3 5.00e-07 NA 0.002
3. B Q8L828 Coatomer subunit beta'-3 1.19e-05 NA 6.52e-05
3. B Q39336 Guanine nucleotide-binding protein subunit beta-like protein 3.67e-04 NA 6.70e-05
3. B Q4WT34 Pre-mRNA-splicing factor prp46 6.44e-03 NA 0.002
3. B P73595 Uncharacterized WD repeat-containing protein slr1410 3.52e-03 NA 0.046
3. B A1DHW6 Probable E3 ubiquitin ligase complex SCF subunit sconB 2.16e-02 NA 0.023
3. B O14727 Apoptotic protease-activating factor 1 1.26e-05 NA 0.015
3. B Q00664 Nuclear distribution protein nudF 4.16e-04 NA 1.90e-05
3. B A7S338 Lissencephaly-1 homolog 2.70e-05 NA 0.002
3. B Q676U5 Autophagy-related protein 16-1 5.55e-03 NA 0.005
3. B Q4RJN5 Lissencephaly-1 homolog 2.17e-05 NA 0.014
3. B Q9GL51 Platelet-activating factor acetylhydrolase IB subunit alpha 8.89e-04 NA 0.003
3. B Q9EP82 tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4 2.43e-02 NA 0.025
3. B B2B766 Nuclear distribution protein PAC1-2 5.46e-05 NA 0.026
3. B B8NGT5 Probable E3 ubiquitin ligase complex SCF subunit sconB 3.93e-02 NA 0.002