Results | PROST

Summary

A6NEE1

Homolog: B1WBU8.
Function: Pleckstrin homology domain-containing family D member 1.

Statistics

Total GO Annotation: 172
Unique PROST Go: 112
Unique BLAST Go: 55

Total Homologs: 55
Unique PROST Homologs: 40
Unique BLAST Homologs: 11

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was B1WBU8 (Pleckstrin homology domain-containing family D member 1) with a FATCAT P-Value: 0.0 and RMSD of 1.92 angstrom. The sequence alignment identity is 94.7%.
Structural alignment shown in left. Query protein A6NEE1 colored as red in alignment, homolog B1WBU8 colored as blue. Query protein A6NEE1 is also shown in right top, homolog B1WBU8 showed in right bottom. They are colored based on secondary structures.

  A6NEE1 MFTSKSNSVSPSPSLEQADSDALDISTKVQLYGVLWKRPFGRPSAKWSRRFFIIKESFLLYYSESEKKSFETNKYFNIHPKGVIPLGGCLVEPKEEPSMP 100
  B1WBU8 MFTSKSNSVSPSPSLEQADADALDISTKVQLYGVLWKRPFGRSSAKWSRRFFIIKESFLLYYSESERKSFETNKYFNIHPKGVIPLGGCLVEAREEPSMP 100

  A6NEE1 YAMKISHQDFHGNILLAAESEFEQTQWLEMLQESGKVTWKNAQLGEAMIKSLEAQGLQLAKEKQEYLDKLMEETEELCLQREQREELERLNQVLEAEKQQ 200
  B1WBU8 YAMKISHQDFHGNVLLAAESEFEQTQWLEMLQESGKVTWKNAQLGEAMIKSLEAQGLQLAKEKQEYLDKLMEETEELCLQREQREELERLNQVLEAEKQQ 200

  A6NEE1 FEEVVQELRMEQEQIKRELELTARCLKGVEQEKKELRHLTESLQQTLEELSIEKKKTLEMLEENENHLQTLANQSEQPPPSGGLHSNLRQIEEKMQQLLE 300
  B1WBU8 FEEVVQELKVEQEQIKRELELTARCLKGVEQEKKELRHLTESLQHTLEELSIEKKKTLEMLEEDKNQPQPLTNQSEQPPATDGLHSNLRQIEERMQELLA 300

  A6NEE1 EKLLAEKRMKENEERSRALEEEREFYSSQSQALQNSLQELTAEKQQAERELKAEVKVRMDLERRLREAEGALRSLEQGLNSKVRNKEKEERMRADVSHLK 400
  B1WBU8 EKLLAEKRMKENEERSRALEEEREFYSSQSQALQNSLQELTAEKQQAEQELKAEVKVRMDLERRLREAEAALRSLEQGLNSKVRNKEKEERMRADVSHLK 400

  A6NEE1 RFFEECIRNAELEAKMPVIMKNSVYIHKAATRRIKSCRFHRRRSSTSWNDMKPSQSFMTSQLDANNMEELKEVAKRLSRDQRFRESIYHIMATQPGAPSA 500
  B1WBU8 RFFEECIRNAELEAKMPVIMKNSVYIHKAATRRIKSCRFHRRRSSTSWNDMKPSQSFMTSQLEANNIEELKEVAKRLSRDQRFRESIYHIMATQPGA-SA 499

  A6NEE1 LSRGGK 506
  B1WBU8 LPRGGK 505

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0007411	axon guidance
1. PB	GO:0008022	protein C-terminus binding
1. PB	GO:0032266	phosphatidylinositol-3-phosphate binding
1. PB	GO:0034451	centriolar satellite
1. PB	GO:0031234	extrinsic component of cytoplasmic side of plasma membrane
2. P	GO:0005768	endosome
2. P	GO:0005159	insulin-like growth factor receptor binding
2. P	GO:0016055	Wnt signaling pathway
2. P	GO:1902388	ceramide 1-phosphate transfer activity
2. P	GO:0032760	positive regulation of tumor necrosis factor production
2. P	GO:0030705	cytoskeleton-dependent intracellular transport
2. P	GO:0030374	nuclear receptor coactivator activity
2. P	GO:0051260	protein homooligomerization
2. P	GO:0003382	epithelial cell morphogenesis
2. P	GO:0005874	microtubule
2. P	GO:0002446	neutrophil mediated immunity
2. P	GO:0036195	muscle cell projection membrane
2. P	GO:1905719	protein localization to perinuclear region of cytoplasm
2. P	GO:0045022	early endosome to late endosome transport
2. P	GO:0032755	positive regulation of interleukin-6 production
2. P	GO:0003713	transcription coactivator activity
2. P	GO:0048009	insulin-like growth factor receptor signaling pathway
2. P	GO:0007249	I-kappaB kinase/NF-kappaB signaling
2. P	GO:0048874	host-mediated regulation of intestinal microbiota composition
2. P	GO:2000318	positive regulation of T-helper 17 type immune response
2. P	GO:0001819	positive regulation of cytokine production
2. P	GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
2. P	GO:0046330	positive regulation of JNK cascade
2. P	GO:0031122	cytoplasmic microtubule organization
2. P	GO:0008285	negative regulation of cell population proliferation
2. P	GO:0035621	ER to Golgi ceramide transport
2. P	GO:0090263	positive regulation of canonical Wnt signaling pathway
2. P	GO:0032587	ruffle membrane
2. P	GO:1905198	manchette assembly
2. P	GO:0000280	nuclear division
2. P	GO:0043621	protein self-association
2. P	GO:0070374	positive regulation of ERK1 and ERK2 cascade
2. P	GO:0006897	endocytosis
2. P	GO:1901098	positive regulation of autophagosome maturation
2. P	GO:0070695	FHF complex
2. P	GO:0007099	centriole replication
2. P	GO:0036064	ciliary basal body
2. P	GO:2000096	positive regulation of Wnt signaling pathway, planar cell polarity pathway
2. P	GO:0008017	microtubule binding
2. P	GO:0007032	endosome organization
2. P	GO:0016064	immunoglobulin mediated immune response
2. P	GO:0072673	lamellipodium morphogenesis
2. P	GO:0031410	cytoplasmic vesicle
2. P	GO:0008013	beta-catenin binding
2. P	GO:0032663	regulation of interleukin-2 production
2. P	GO:0001881	receptor recycling
2. P	GO:0032675	regulation of interleukin-6 production
2. P	GO:1901214	regulation of neuron death
2. P	GO:0032680	regulation of tumor necrosis factor production
2. P	GO:2000679	positive regulation of transcription regulatory region DNA binding
2. P	GO:0043066	negative regulation of apoptotic process
2. P	GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling
2. P	GO:0051607	defense response to virus
2. P	GO:0030897	HOPS complex
2. P	GO:0043548	phosphatidylinositol 3-kinase binding
2. P	GO:0042803	protein homodimerization activity
2. P	GO:0032494	response to peptidoglycan
2. P	GO:0032274	gonadotropin secretion
2. P	GO:0007040	lysosome organization
2. P	GO:0098536	deuterosome
2. P	GO:0048489	synaptic vesicle transport
2. P	GO:1900017	positive regulation of cytokine production involved in inflammatory response
2. P	GO:0005814	centriole
2. P	GO:0080025	phosphatidylinositol-3,5-bisphosphate binding
2. P	GO:0043330	response to exogenous dsRNA
2. P	GO:0034341	response to interferon-gamma
2. P	GO:0035627	ceramide transport
2. P	GO:1903445	protein transport from ciliary membrane to plasma membrane
2. P	GO:0051959	dynein light intermediate chain binding
2. P	GO:1902387	ceramide 1-phosphate binding
2. P	GO:0000421	autophagosome membrane
2. P	GO:0016605	PML body
2. P	GO:0005776	autophagosome
2. P	GO:0050700	CARD domain binding
2. P	GO:0042493
2. P	GO:0098792	xenophagy
2. P	GO:0061760	antifungal innate immune response
2. P	GO:0043231	intracellular membrane-bounded organelle
2. P	GO:0043325	phosphatidylinositol-3,4-bisphosphate binding
2. P	GO:0005802	trans-Golgi network
2. P	GO:0051451	myoblast migration
2. P	GO:0042981	regulation of apoptotic process
2. P	GO:0120009	intermembrane lipid transfer
2. P	GO:0045089	positive regulation of innate immune response
2. P	GO:0032725	positive regulation of granulocyte macrophage colony-stimulating factor production
2. P	GO:0048743	positive regulation of skeletal muscle fiber development
2. P	GO:0005813	centrosome
2. P	GO:0051092	positive regulation of NF-kappaB transcription factor activity
2. P	GO:0032495	response to muramyl dipeptide
2. P	GO:0005829	cytosol
2. P	GO:0015031	protein transport
2. P	GO:0007520	myoblast fusion
2. P	GO:0032740	positive regulation of interleukin-17 production
2. P	GO:0040019	positive regulation of embryonic development
2. P	GO:0044029	hypomethylation of CpG island
2. P	GO:0051298	centrosome duplication
2. P	GO:0032449	CBM complex
2. P	GO:0030948	negative regulation of vascular endothelial growth factor receptor signaling pathway
2. P	GO:0005546	phosphatidylinositol-4,5-bisphosphate binding
2. P	GO:0008333	endosome to lysosome transport
2. P	GO:2000279	negative regulation of DNA biosynthetic process
2. P	GO:0032722	positive regulation of chemokine production
2. P	GO:0009620	response to fungus
2. P	GO:0032874	positive regulation of stress-activated MAPK cascade
2. P	GO:0005912	adherens junction
2. P	GO:0030518	intracellular steroid hormone receptor signaling pathway
2. P	GO:0045893	positive regulation of transcription, DNA-templated
2. P	GO:0042802	identical protein binding
2. P	GO:0040016	embryonic cleavage
2. P	GO:0098971	anterograde dendritic transport of neurotransmitter receptor complex
2. P	GO:0050830	defense response to Gram-positive bacterium
2. P	GO:0070016	armadillo repeat domain binding
3. B	GO:0071711	basement membrane organization
3. B	GO:0030155	regulation of cell adhesion
3. B	GO:0060445	branching involved in salivary gland morphogenesis
3. B	GO:0007414	axonal defasciculation
3. B	GO:0032224	positive regulation of synaptic transmission, cholinergic
3. B	GO:0102203	brassicasterol glucosyltransferase activity
3. B	GO:0016477	cell migration
3. B	GO:0009888	tissue development
3. B	GO:0005608	laminin-3 complex
3. B	GO:0032012	regulation of ARF protein signal transduction
3. B	GO:0060041	retina development in camera-type eye
3. B	GO:0005604	basement membrane
3. B	GO:0002011	morphogenesis of an epithelial sheet
3. B	GO:0005201	extracellular matrix structural constituent
3. B	GO:0005085	guanyl-nucleotide exchange factor activity
3. B	GO:0005102	signaling receptor binding
3. B	GO:0005606	laminin-1 complex
3. B	GO:0043083	synaptic cleft
3. B	GO:0040017	positive regulation of locomotion
3. B	GO:0000003	reproduction
3. B	GO:0016126	sterol biosynthetic process
3. B	GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding
3. B	GO:0090162	establishment of epithelial cell polarity
3. B	GO:0102205	cholesterol alpha-glucosyltransferase activity
3. B	GO:0045171	intercellular bridge
3. B	GO:0102202	soladodine glucosyltransferase activity
3. B	GO:0016906	sterol 3-beta-glucosyltransferase activity
3. B	GO:0030334	regulation of cell migration
3. B	GO:0002224	toll-like receptor signaling pathway
3. B	GO:0061304	retinal blood vessel morphogenesis
3. B	GO:0048193	Golgi vesicle transport
3. B	GO:0005911	cell-cell junction
3. B	GO:0048514	blood vessel morphogenesis
3. B	GO:0006468	protein phosphorylation
3. B	GO:0045995	regulation of embryonic development
3. B	GO:0031012	extracellular matrix
3. B	GO:0008289	lipid binding
3. B	GO:0045198	establishment of epithelial cell apical/basal polarity
3. B	GO:0007166	cell surface receptor signaling pathway
3. B	GO:0051788	response to misfolded protein
3. B	GO:0032120	ascospore-type prospore membrane formation
3. B	GO:0062023	collagen-containing extracellular matrix
3. B	GO:0007517	muscle organ development
3. B	GO:0043256	laminin complex
3. B	GO:0043010	camera-type eye development
3. B	GO:0034446	substrate adhesion-dependent cell spreading
3. B	GO:0014037	Schwann cell differentiation
3. B	GO:0035633	maintenance of blood-brain barrier
3. B	GO:0043208	glycosphingolipid binding
3. B	GO:0007155	cell adhesion
3. B	GO:0045785	positive regulation of cell adhesion
3. B	GO:0060441	epithelial tube branching involved in lung morphogenesis
3. B	GO:0001726	ruffle
3. B	GO:0010950	positive regulation of endopeptidase activity
3. B	GO:0009887	animal organ morphogenesis

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	B1WBU8	Pleckstrin homology domain-containing family D member 1	0.00e+00	8.28e-96	0.0
1. PB	A6NEE1	Pleckstrin homology domain-containing family D member 1	0	8.69e-141	0.0
1. PB	O45420	Pleckstrin homology domain-containing family D member 1	1.01e-10	9.70e-29	3.82e-64
1. PB	B2RPU2	Pleckstrin homology domain-containing family D member 1	0.00e+00	5.94e-95	0.0
2. P	Q8CGU1	Calcium-binding and coiled-coil domain-containing protein 1	2.15e-07	1.64e-02	NA
2. P	Q7ZVT3	Spindle assembly abnormal protein 6 homolog	7.57e-08	3.59e-05	NA
2. P	P60669	Pleckstrin homology domain-containing family A member 4	1.54e-02	1.49e-09	NA
2. P	B0WPU9	Protein hook	1.39e-07	5.15e-03	NA
2. P	Q96TA1	Protein Niban 2	2.42e-05	2.18e-02	NA
2. P	Q9EPY0	Caspase recruitment domain-containing protein 9	2.05e-07	1.42e-03	NA
2. P	O18737	Calcium-binding and coiled-coil domain-containing protein 2	3.29e-06	1.74e-02	NA
2. P	Q9JIY0	Pleckstrin homology domain-containing family O member 1	2.02e-03	3.49e-02	NA
2. P	Q6UVJ0	Spindle assembly abnormal protein 6 homolog	3.34e-08	6.47e-03	NA
2. P	Q5EBL4	RILP-like protein 1	1.99e-07	2.00e-02	NA
2. P	Q7TMK6	Protein Hook homolog 2	6.65e-07	5.75e-03	NA
2. P	Q5F3C8	Pleckstrin homology domain-containing family O member 1	1.76e-04	1.23e-02	NA
2. P	Q6DF48	Calcium-binding and coiled-coil domain-containing protein 2	5.59e-08	8.02e-03	NA
2. P	A4IFK0	Pleckstrin homology domain-containing family O member 1	4.83e-03	2.25e-02	NA
2. P	Q6P4Y6	Insulin receptor substrate 1	1.38e-02	1.06e-03	NA
2. P	Q6NRB0	Protein Hook homolog 2	2.98e-08	1.79e-02	NA
2. P	Q9H4M7	Pleckstrin homology domain-containing family A member 4	8.48e-03	4.04e-10	NA
2. P	Q96ED9	Protein Hook homolog 2	3.21e-07	5.63e-04	NA
2. P	Q8R1F1	Protein Niban 2	5.97e-05	2.40e-02	NA
2. P	B3NL60	Protein hook	9.67e-07	4.49e-02	NA
2. P	Q8BH49	Sesquipedalian-1	2.10e-01	1.56e-02	NA
2. P	Q8VC98	Pleckstrin homology domain-containing family A member 4	1.35e-02	2.48e-03	NA
2. P	Q9H257	Caspase recruitment domain-containing protein 9	1.22e-08	1.32e-03	NA
2. P	A2AIV8	Caspase recruitment domain-containing protein 9	6.87e-08	4.29e-02	NA
2. P	A2BGD5	Calcium-binding and coiled-coil domain-containing protein 1	1.94e-08	5.61e-06	NA
2. P	Q5BJM5	Pleckstrin homology domain-containing family O member 1	1.14e-03	4.49e-02	NA
2. P	B4F7E8	Protein Niban 2	3.55e-05	1.61e-02	NA
2. P	P78314	SH3 domain-binding protein 2	5.55e-02	1.58e-02	NA
2. P	Q80UK7	Spindle assembly abnormal protein 6 homolog	2.88e-08	6.66e-03	NA
2. P	Q5ZMV2	Spindle assembly abnormal protein 6 homolog	4.71e-09	3.50e-04	NA
2. P	Q66HR5	Calcium-binding and coiled-coil domain-containing protein 1	3.17e-07	1.31e-04	NA
2. P	Q5TZ80	Protein Hook homolog 1	8.40e-07	2.04e-02	NA
2. P	Q7PWT9	Protein hook	3.21e-07	7.39e-04	NA
2. P	Q9ERS4	Pleckstrin homology domain-containing family A member 3	5.31e-06	2.25e-02	NA
2. P	Q2KJ21	Calcium-binding and coiled-coil domain-containing protein 1	4.30e-07	1.01e-02	NA
2. P	Q13137	Calcium-binding and coiled-coil domain-containing protein 2	1.28e-06	1.24e-03	NA
2. P	Q17QG3	RILP-like protein 1	2.95e-09	3.30e-02	NA
2. P	P35978	Kinesin heavy chain	3.52e-05	4.74e-02	NA
2. P	Q5ZJ27	Protein Hook homolog 1	3.85e-07	2.12e-02	NA
2. P	Q9UJC3	Protein Hook homolog 1	9.40e-05	4.09e-02	NA
3. B	Q80YW0	Cytohesin-4	3.28e-02	NA	0.001
3. B	Q8ILR9	Protein PF14_0175	NA	NA	0.048
3. B	Q21313	Laminin-like protein epi-1	NA	NA	0.032
3. B	Q9ST43	Pleckstrin homology domain-containing protein 1	2.74e-04	NA	0.031
3. B	Q5B4C9	Sterol 3-beta-glucosyltransferase	7.73e-02	NA	0.004
3. B	Q18823	Laminin-like protein lam-2	2.22e-03	NA	0.036
3. B	P24043	Laminin subunit alpha-2	NA	NA	7.84e-04
3. B	P19137	Laminin subunit alpha-1	NA	NA	0.018
3. B	Q9UIA0	Cytohesin-4	3.80e-02	NA	0.005
3. B	O08967	Cytohesin-3	1.14e-01	NA	0.030
3. B	P25391	Laminin subunit alpha-1	NA	NA	0.009