Summary

A6NEF3

Homolog: A6NEY3.
Function: Putative golgin subfamily A member 6-like protein 3.

Statistics

Total GO Annotation: 177
Unique PROST Go: 59
Unique BLAST Go: 112

Total Homologs: 93
Unique PROST Homologs: 36
Unique BLAST Homologs: 45

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was A6NEY3 (Putative golgin subfamily A member 6-like protein 3) with a FATCAT P-Value: 5e-15 and RMSD of 2.39 angstrom. The sequence alignment identity is 74.5%.
Structural alignment shown in left. Query protein A6NEF3 colored as red in alignment, homolog A6NEY3 colored as blue. Query protein A6NEF3 is also shown in right top, homolog A6NEY3 showed in right bottom. They are colored based on secondary structures. 

  A6NEF3 MWPQPRFPPHPAMSEKTQQGKLAAAKKKLKAYWQRKSPGIPAGANRKKKINGSSPDTATSGGYHSPGDSATGIYGEGRASSTTLEDLESQYQELAVALDS 100
  A6NEY3 MWPQPRLPPHPAMSEKTQQGKLAAAKKKLKAYWQRKSPGIPAGANRKKKINGSSPDTATSGGYHSPGDSATGIYGEGRASSTTLEDLESQYQELAVALDS 100

  A6NEF3 SSAIISQLTENINSLVRTSKEEKKHEIHLVQKLGRSLFKLKNQTAEPLAPEPPAGPSKVEQLQDETNHLRKELESVGRQLQAEVENNQMLSLLNRRQEER 200
  A6NEY3 SSAIISQLTENINSLVRTSKEEKKHEIHLVQKLGRSLFKLKNQTAEPLAPEPPAGPSKVEQLQDETNHLRKELESVGRQLQAEVENNQMLSLLNRRQEER 200

  A6NEF3 LREQEERLREQEERLR-------EQEDRLHEQEERLREQEERLCEQEERLREHEERLCEQEERLCEQEERLREQEERLH-------EQEERLREQEERLC 286
  A6NEY3 LREQEERLREQEERLREQEERLCEQEERLREQEERLREQEERLCEQEERLREHEERLCEQEERLCEQEERLREQEERLHEQEERLCEQEERLREQEERLC 300

  A6NEF3 EQEERLREQEERLCEQEERLREQEERLCEQEKLPGQERLLEEVEKLLEQERRQEEQERLLERERLLEEVEKLLEQERQQEEQERLLERERLLEEVEKLLE 386
  A6NEY3 EQEERLREQEERLCEQEERLREQEERLCEQEKLPGQERLLEEVEKLLEQERR--------------------------QEEQERLLERERLLEEVEKLLE 374

  A6NEF3 QERRQEEQERLLERERLLDEVEELLDEVEELLEQERLRQQDERLWQQETLQELERLRELERLRELERMLELGWEALYEQRAEPRSGFEELNNENKSTLQL 486
  A6NEY3 QERRQEEQERLLER-------EELLDEVEELLEQERLRQQDERLWQQETLQ------ELERLRELERMLELGWEALYEQRAEPRSGFEEL---------- 451

  A6NEF3 EQQVKELKKSGGAEEPRGSESAAAARPVAGAPVPQGAWMCGQAGWTPQEHPGLSGEAVGTGEAAGGAGEAACHSFRAAENRELNITII 574
  A6NEY3 ---VR-CPTWGGCPLP------------------------------------------------------------------------ 463

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0032091 negative regulation of protein binding
1. PB GO:0032580 Golgi cisterna membrane
1. PB GO:0090307 mitotic spindle assembly
1. PB GO:0007030 Golgi organization
1. PB GO:0000137 Golgi cis cisterna
1. PB GO:0005801 cis-Golgi network
2. P GO:2000781 positive regulation of double-strand break repair
2. P GO:0051656 establishment of organelle localization
2. P GO:0007094 mitotic spindle assembly checkpoint signaling
2. P GO:0030844 positive regulation of intermediate filament depolymerization
2. P GO:0030216 keratinocyte differentiation
2. P GO:0043202 lysosomal lumen
2. P GO:0048858 cell projection morphogenesis
2. P GO:0005201 extracellular matrix structural constituent
2. P GO:0008286 insulin receptor signaling pathway
2. P GO:1900006 positive regulation of dendrite development
2. P GO:0005796 Golgi lumen
2. P GO:0043086 negative regulation of catalytic activity
2. P GO:0030016 myofibril
2. P GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
2. P GO:0031297 replication fork processing
2. P GO:2000179 positive regulation of neural precursor cell proliferation
2. P GO:0000086 G2/M transition of mitotic cell cycle
2. P GO:0005540 hyaluronic acid binding
2. P GO:0031730 CCR5 chemokine receptor binding
2. P GO:0005576 extracellular region
2. P GO:0030168 platelet activation
2. P GO:0045179 apical cortex
2. P GO:0010212 response to ionizing radiation
2. P GO:0050769 positive regulation of neurogenesis
2. P GO:0005199 structural constituent of cell wall
2. P GO:0006909 phagocytosis
2. P GO:0110148 biomineralization
2. P GO:0001533 cornified envelope
2. P GO:0018149 peptide cross-linking
2. P GO:0019215 intermediate filament binding
2. P GO:0000182 rDNA binding
2. P GO:0072089 stem cell proliferation
2. P GO:0031639 plasminogen activation
2. P GO:0005618 cell wall
2. P GO:0044548 S100 protein binding
2. P GO:0051258 protein polymerization
2. P GO:0031424 keratinization
2. P GO:0106333 subcortical maternal complex
2. P GO:0040010 positive regulation of growth rate
2. P GO:0018153 isopeptide cross-linking via N6-(L-isoglutamyl)-L-lysine
2. P GO:0001042 RNA polymerase I core binding
2. P GO:0040024 dauer larval development
2. P GO:1905168 positive regulation of double-strand break repair via homologous recombination
2. P GO:0005813 centrosome
2. P GO:0051017 actin filament bundle assembly
2. P GO:0006936 muscle contraction
2. P GO:0110143 magnetosome
2. P GO:0017022 myosin binding
2. P GO:0040019 positive regulation of embryonic development
2. P GO:0010224 response to UV-B
2. P GO:0045159 myosin II binding
2. P GO:0061187 regulation of ribosomal DNA heterochromatin assembly
2. P GO:0039644 suppression by virus of host NF-kappaB cascade
2. P GO:0031667 response to nutrient levels
2. P GO:0005577 fibrinogen complex
2. P GO:0009303 rRNA transcription
2. P GO:1903611 negative regulation of calcium-dependent ATPase activity
2. P GO:0031076 embryonic camera-type eye development
2. P GO:0033018 sarcoplasmic reticulum lumen
3. B GO:1990535 neuron projection maintenance
3. B GO:0050772 positive regulation of axonogenesis
3. B GO:0002064 epithelial cell development
3. B GO:0043198 dendritic shaft
3. B GO:0005096 GTPase activator activity
3. B GO:0060050 positive regulation of protein glycosylation
3. B GO:0097224 sperm connecting piece
3. B GO:0090161 Golgi ribbon formation
3. B GO:0005874 microtubule
3. B GO:0150001 primary dendrite
3. B GO:0060438 trachea development
3. B GO:0016358 dendrite development
3. B GO:1901588 dendritic microtubule
3. B GO:0061512 protein localization to cilium
3. B GO:0044409 entry into host
3. B GO:0048156 tau protein binding
3. B GO:0009318 exodeoxyribonuclease VII complex
3. B GO:0008855 exodeoxyribonuclease VII activity
3. B GO:1904158 axonemal central apparatus assembly
3. B GO:1990225 rhoptry neck
3. B GO:0098880 maintenance of postsynaptic specialization structure
3. B GO:0043083 synaptic cleft
3. B GO:0050803 regulation of synapse structure or activity
3. B GO:0045168 cell-cell signaling involved in cell fate commitment
3. B GO:0072686 mitotic spindle
3. B GO:0007265 Ras protein signal transduction
3. B GO:0007409 axonogenesis
3. B GO:0070160 tight junction
3. B GO:1990716 axonemal central apparatus
3. B GO:0030134 COPII-coated ER to Golgi transport vesicle
3. B GO:0006486 protein glycosylation
3. B GO:0035255 ionotropic glutamate receptor binding
3. B GO:0002224 toll-like receptor signaling pathway
3. B GO:0008306 associative learning
3. B GO:0045995 regulation of embryonic development
3. B GO:0097229 sperm end piece
3. B GO:0008201 heparin binding
3. B GO:0008569 minus-end-directed microtubule motor activity
3. B GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B GO:0000226 microtubule cytoskeleton organization
3. B GO:0043408 regulation of MAPK cascade
3. B GO:0008017 microtubule binding
3. B GO:0043194 axon initial segment
3. B GO:0007020 microtubule nucleation
3. B GO:0051645 Golgi localization
3. B GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
3. B GO:0031114 regulation of microtubule depolymerization
3. B GO:0097225 sperm midpiece
3. B GO:0036156 inner dynein arm
3. B GO:0006997 nucleus organization
3. B GO:0006308 DNA catabolic process
3. B GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane
3. B GO:0090166 Golgi disassembly
3. B GO:0007613 memory
3. B GO:0099642 retrograde axonal protein transport
3. B GO:1990718 axonemal central pair projection
3. B GO:0050882 voluntary musculoskeletal movement
3. B GO:0098978 glutamatergic synapse
3. B GO:0007018 microtubule-based movement
3. B GO:0044650 adhesion of symbiont to host cell
3. B GO:0030286 dynein complex
3. B GO:0070050 neuron cellular homeostasis
3. B GO:0051289 protein homotetramerization
3. B GO:0044307 dendritic branch
3. B GO:0017124 SH3 domain binding
3. B GO:0099641 anterograde axonal protein transport
3. B GO:0008356 asymmetric cell division
3. B GO:0032224 positive regulation of synaptic transmission, cholinergic
3. B GO:0045505 dynein intermediate chain binding
3. B GO:0010507 negative regulation of autophagy
3. B GO:0048169 regulation of long-term neuronal synaptic plasticity
3. B GO:0043113 receptor clustering
3. B GO:0003341 cilium movement
3. B GO:0007098 centrosome cycle
3. B GO:0019901 protein kinase binding
3. B GO:0043087 regulation of GTPase activity
3. B GO:0051959 dynein light intermediate chain binding
3. B GO:0000922 spindle pole
3. B GO:0046789 host cell surface receptor binding
3. B GO:0005794 Golgi apparatus
3. B GO:0043025 neuronal cell body
3. B GO:1904115 axon cytoplasm
3. B GO:0021591 ventricular system development
3. B GO:0044647 host-symbiont bicellular tight junction
3. B GO:0008542 visual learning
3. B GO:2000010 positive regulation of protein localization to cell surface
3. B GO:0030317 flagellated sperm motility
3. B GO:0005875 microtubule associated complex
3. B GO:0048167 regulation of synaptic plasticity
3. B GO:0007288 sperm axoneme assembly
3. B GO:0005652 nuclear lamina
3. B GO:0097228 sperm principal piece
3. B GO:0090306 meiotic spindle assembly
3. B GO:0014069 postsynaptic density
3. B GO:0045202 synapse
3. B GO:0098609 cell-cell adhesion
3. B GO:0020008 rhoptry
3. B GO:0061676 importin-alpha family protein binding
3. B GO:0043524 negative regulation of neuron apoptotic process
3. B GO:0015631 tubulin binding
3. B GO:1903829 positive regulation of protein localization
3. B GO:0014037 Schwann cell differentiation
3. B GO:1902817 negative regulation of protein localization to microtubule
3. B GO:0050208 polysialic-acid O-acetyltransferase activity
3. B GO:0043655 host extracellular space
3. B GO:0008093 cytoskeletal anchor activity
3. B GO:0099092 postsynaptic density, intracellular component
3. B GO:0019905 syntaxin binding
3. B GO:0046580 negative regulation of Ras protein signal transduction
3. B GO:0050771 negative regulation of axonogenesis
3. B GO:0051225 spindle assembly
3. B GO:0007389 pattern specification process

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A6NEF3 Golgin subfamily A member 6-like protein 4 0 1.01e-156 0.0
1. PB H0YKK7 Putative golgin subfamily A member 6-like protein 19 1.15e-11 8.49e-87 6.65e-133
1. PB Q9NYA3 Golgin subfamily A member 6A 3.66e-09 1.87e-04 3.11e-38
1. PB A6NEY3 Putative golgin subfamily A member 6-like protein 3 5.00e-15 1.21e-28 2.17e-06
1. PB Q8N9W4 Golgin subfamily A member 6-like protein 2 6.07e-07 2.21e-02 5.31e-19
1. PB H0YM25 Golgin subfamily A member 6-like protein 22 9.29e-08 1.34e-06 1.14e-23
1. PB A6NI86 Golgin subfamily A member 6-like protein 10 1.18e-09 1.13e-86 3.22e-141
1. PB A0A1B0GV03 Golgin subfamily A member 6-like protein 7 5.77e-09 2.29e-14 2.51e-19
1. PB A6NEM1 Golgin subfamily A member 6-like protein 9 3.23e-05 4.11e-29 4.67e-124
1. PB A6NDN3 Golgin subfamily A member 6B 2.40e-07 3.08e-03 7.33e-38
1. PB P0CG33 Golgin subfamily A member 6D 1.59e-09 1.19e-03 2.72e-38
1. PB A6NDK9 Golgin subfamily A member 6C 6.86e-07 5.69e-04 1.43e-38
2. P Q0II65 Coiled-coil domain-containing protein 70 2.53e-04 4.02e-03 NA
2. P P24710 Involucrin 9.28e-05 2.68e-02 NA
2. P Q9CAP9 Filament-like plant protein 1 7.39e-08 6.36e-07 NA
2. P P02674 Fibrinogen alpha-1 chain (Fragment) 2.29e-02 7.68e-03 NA
2. P Q9QR71 Protein LANA1 NA 1.09e-02 NA
2. P Q9XVS4 Nucleolar protein dao-5 8.43e-01 4.33e-02 NA
2. P D3ZVV1 KH domain-containing protein 3 4.18e-01 2.87e-02 NA
2. P Q2W8Q7 Magnetosome-associated protein MamJ 8.19e-01 2.53e-02 NA
2. P Q2KI51 Protein phosphatase 1 regulatory subunit 15A 5.32e-01 4.40e-05 NA
2. P P16112 Aggrecan core protein 9.87e-01 2.13e-02 NA
2. P Q0P6D6 Coiled-coil domain-containing protein 15 5.90e-02 3.41e-02 NA
2. P A6NE01 Protein FAM186A 8.88e-02 3.41e-02 NA
2. P P9WG30 Resuscitation-promoting factor RpfA 8.27e-01 1.23e-02 NA
2. P Q80YD3 Protein FAM205C 1.55e-02 2.81e-04 NA
2. P P50468 M protein, serotype 2.1 1.28e-08 8.93e-04 NA
2. P Q66HF9 Leucine-rich repeat flightless-interacting protein 1 2.52e-03 9.32e-04 NA
2. P P08089 M protein, serotype 6 5.55e-08 1.59e-02 NA
2. P Q54L50 Putative uncharacterized protein DDB_G0286901 3.10e-01 3.55e-02 NA
2. P P17941 Involucrin 2.03e-04 1.72e-05 NA
2. P Q04118 Basic salivary proline-rich protein 3 5.85e-01 1.68e-02 NA
2. P P07476 Involucrin 1.25e-02 3.92e-05 NA
2. P P21263 Nestin 1.81e-01 4.76e-02 NA
2. P Q9U0M8 Uncharacterized protein PFA0635c 8.68e-04 2.08e-04 NA
2. P P49054 Plasminogen-binding group A streptococcal M-like protein PAM (Fragment) 1.83e-09 1.40e-04 NA
2. P P50469 M protein, serotype 2.2 9.88e-08 3.13e-02 NA
2. P Q40375 Repetitive proline-rich cell wall protein 2 7.87e-01 1.51e-02 NA
2. P P18175 Involucrin 9.72e-08 2.09e-02 NA
2. P P14591 Involucrin 1.80e-04 2.23e-05 NA
2. P Q54G05 Putative leucine-rich repeat-containing protein DDB_G0290503 1.87e-04 2.20e-04 NA
2. P Q5X9Q9 M protein, serotype 6 2.58e-06 1.91e-03 NA
2. P Q9JJL0 Testis-specific gene A8 protein 5.50e-01 3.08e-03 NA
2. P P9WG31 Resuscitation-promoting factor RpfA 8.41e-01 1.23e-02 NA
2. P P12957 Caldesmon 5.14e-04 3.94e-02 NA
2. P Q01133 Antho-RFamide neuropeptides 3.04e-01 6.88e-03 NA
2. P P02977 M protein, serotype 5 4.60e-09 4.78e-03 NA
2. P P16230 Sarcoplasmic reticulum histidine-rich calcium-binding protein 7.67e-01 1.49e-09 NA
3. B I6L899 Golgin subfamily A member 8R 4.67e-06 NA 5.60e-25
3. B A8SEG5 Protein TIC 214 2.95e-01 NA 0.016
3. B A6NMD2 Golgin subfamily A member 8J 1.55e-05 NA 9.51e-08
3. B Q4ZX12 Exodeoxyribonuclease 7 large subunit 2.90e-03 NA 0.047
3. B F8WBI6 Golgin subfamily A member 8N 4.05e-07 NA 4.69e-25
3. B Q08379 Golgin subfamily A member 2 2.16e-02 NA 1.48e-25
3. B D1FNJ9 CLAVATA3/ESR (CLE)-related protein 4A-1 4.51e-01 NA 8.07e-04
3. B Q8N7Z2 Golgin subfamily A member 6-like protein 1 5.62e-09 NA 1.25e-14
3. B Q60675 Laminin subunit alpha-2 NA NA 1.13e-04
3. B Q4G0P3 Hydrocephalus-inducing protein homolog NA NA 0.005
3. B H3BV12 Golgin subfamily A member 8Q 1.32e-05 NA 3.96e-25
3. B Q0DY81 Nuclear matrix constituent protein 1a 1.42e-05 NA 0.002
3. B Q8IDX6 Reticulocyte-binding protein homolog 2a NA NA 2.65e-19
3. B F6SEU4 Ras/Rap GTPase-activating protein SynGAP 4.27e-01 NA 0.004
3. B Q48LY3 Exodeoxyribonuclease 7 large subunit 2.33e-03 NA 0.026
3. B H3BPF8 Golgin subfamily A member 8S 1.22e-07 NA 1.09e-35
3. B A6NN73 Golgin subfamily A member 8C 2.75e-08 NA 1.68e-22
3. B A8MQT2 Golgin subfamily A member 8B 6.22e-08 NA 1.37e-15
3. B Q5CZC0 Fibrous sheath-interacting protein 2 NA NA 0.007
3. B Q0D2H9 Putative golgin subfamily A member 8D 8.05e-06 NA 4.52e-07
3. B C3K1K5 Exodeoxyribonuclease 7 large subunit 1.14e-03 NA 0.001
3. B A2ARZ3 Fibrous sheath-interacting protein 2 NA NA 0.016
3. B Q6ZQQ6 WD repeat-containing protein 87 NA NA 4.06e-06
3. B H3BQL2 Golgin subfamily A member 8T 1.46e-06 NA 3.50e-24
3. B P34926 Microtubule-associated protein 1A NA NA 0.023
3. B C0H5F4 Reticulocyte-binding protein homolog 2b NA NA 0.011
3. B A6NCC3 Golgin subfamily A member 8O 1.19e-05 NA 4.41e-25
3. B Q3V0Q1 Dynein axonemal heavy chain 12 NA NA 0.027
3. B P78559 Microtubule-associated protein 1A NA NA 4.95e-11
3. B Q8ILR9 Protein PF14_0175 NA NA 3.11e-07
3. B D1FNK2 CLAVATA3/ESR (CLE)-related protein 4B-1 3.23e-01 NA 0.033
3. B A1ADJ6 Polysialic acid O-acetyltransferase 1.61e-03 NA 1.69e-15
3. B Q62839 Golgin subfamily A member 2 4.96e-08 NA 3.87e-08
3. B Q96PV0 Ras/Rap GTPase-activating protein SynGAP 1.86e-01 NA 0.003
3. B Q08AF8 Putative golgin subfamily A member 8F/8G 2.53e-06 NA 1.70e-06
3. B A8MZA4 Golgin subfamily A member 6-like protein 6 1.87e-07 NA 3.79e-29
3. B A7E2F4 Golgin subfamily A member 8A 2.58e-07 NA 1.89e-15
3. B Q923J6 Dynein axonemal heavy chain 12 NA NA 0.028
3. B D1FNK0 CLAVATA3/ESR (CLE)-related protein 4A-2 3.54e-01 NA 7.72e-04
3. B A6NC78 Putative golgin subfamily A member 8I 1.42e-05 NA 6.12e-26
3. B Q921M4 Golgin subfamily A member 2 4.15e-07 NA 2.43e-09
3. B P0CJ92 Golgin subfamily A member 8H 2.18e-08 NA 1.89e-25
3. B Q886X9 Exodeoxyribonuclease 7 large subunit 3.55e-03 NA 0.022
3. B Q9QUH6 Ras/Rap GTPase-activating protein SynGAP 2.91e-01 NA 0.011
3. B H3BSY2 Golgin subfamily A member 8M 2.48e-04 NA 6.52e-26