Summary

A6NEQ2

Homolog: A7MB34.
Function: Protein FAM181B.

Statistics

Total GO Annotation: 90
Unique PROST Go: 79
Unique BLAST Go: 11

Total Homologs: 16
Unique PROST Homologs: 11
Unique BLAST Homologs: 2

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was A7MB34 (Protein FAM181B) with a FATCAT P-Value: 3.66e-09 and RMSD of 5.21 angstrom. The sequence alignment identity is 83.9%.
Structural alignment shown in left. Query protein A6NEQ2 colored as red in alignment, homolog A7MB34 colored as blue. Query protein A6NEQ2 is also shown in right top, homolog A7MB34 showed in right bottom. They are colored based on secondary structures. 

  A6NEQ2 MAVQAALLSTHPFVPFGFGGSPDGLGGAFGALDKGCCFEDDETGAPAGALLSGAEGGDVREATRDLLSFIDSASSNIKLALDKPGKSKRKVNHRKYLQKQ 100
  A7MB34 MAVQAALLSTHPFVPFGFGGSPDGLGGAFGALEKGCCFEDEETGTPAGALLAGAESGDAREATRDLLSFIDSASSNIKLALDKPGKSKRKVNHRKYLQKQ 100

  A6NEQ2 IKRCSGLMGAAPPGPPSPSAADTPAKRPLA-APSAPTVAAPAHGKAAPRREASQAAAAASLQSRSLAALFDSLRHVPGGAEPAGGEVAAPAAGLGGAGTG 199
  A7MB34 IKRCSGLMGAAPPGPSSPGAADTPAKRPLAGAQTVP-VPVPAHGKAAPRREASQAAAAASLQSRSLAALFDSLRHVPGGADPAGVAEAVPAAGL------ 193

  A6NEQ2 GAGGDVAGPAGATAIPGARKVPLRARNLPPSFFTEPSRAGGGGCGPSGPDVSLGDLEKGAEAVEFFELLGPDYGAGTEAAVLLAAEPLDVFPAGASVLRG 299
  A7MB34 -VRGDAAGSAGGPAVPGARKVPLRARNLPPSFFTEPSRAGGCVCGPSGPGVSLGDLEKGSEAAEFFELLGPDYGAGTEAGALLAAEPLDVFPAGAAVLRG 292

  A6NEQ2 PPELEPGLFEPPPAVVGNLLYPEPWSVPGCSP-TKKSPLTAPRGGLTLNEPLSPLYPAAADSPGGEDGRGHLASFAPFFPDCALPPPPPPHQVSYDYSAG 398
  A7MB34 PPELEPGLFDPQPAMVGSLLYPEPWSAPG-GPATKKPPLPAPGGGLTLNEPLRSVYPAAADSPGGDDGPGLLASFTPFFSDCALPPAPPPQQVSYDYSAG 391

  A6NEQ2 YSRTAYSSLWRSDGVWEGAPGEEGAHRD 426
  A7MB34 YSRTAFAGLWRPDGAWEGAPGEEGAPRD 419

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0000976 transcription cis-regulatory region binding
2. P GO:0060548 negative regulation of cell death
2. P GO:0035458 cellular response to interferon-beta
2. P GO:0031106 septin ring organization
2. P GO:0003215 cardiac right ventricle morphogenesis
2. P GO:0032488 Cdc42 protein signal transduction
2. P GO:0043374 CD8-positive, alpha-beta T cell differentiation
2. P GO:0070822 Sin3-type complex
2. P GO:0008285 negative regulation of cell population proliferation
2. P GO:0030010 establishment of cell polarity
2. P GO:0060174 limb bud formation
2. P GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
2. P GO:0031397 negative regulation of protein ubiquitination
2. P GO:0003289 atrial septum primum morphogenesis
2. P GO:0021522 spinal cord motor neuron differentiation
2. P GO:0060412 ventricular septum morphogenesis
2. P GO:0032735 positive regulation of interleukin-12 production
2. P GO:0005634 nucleus
2. P GO:0032481 positive regulation of type I interferon production
2. P GO:0031647 regulation of protein stability
2. P GO:0060993 kidney morphogenesis
2. P GO:0061484 hematopoietic stem cell homeostasis
2. P GO:0048485 sympathetic nervous system development
2. P GO:0002328 pro-B cell differentiation
2. P GO:2000761 positive regulation of N-terminal peptidyl-lysine acetylation
2. P GO:0033309 SBF transcription complex
2. P GO:0002376 immune system process
2. P GO:0045588 positive regulation of gamma-delta T cell differentiation
2. P GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
2. P GO:0035019 somatic stem cell population maintenance
2. P GO:0000785 chromatin
2. P GO:0060563 neuroepithelial cell differentiation
2. P GO:0140585 promoter-enhancer loop anchoring activity
2. P GO:0007096 regulation of exit from mitosis
2. P GO:0000083 regulation of transcription involved in G1/S transition of mitotic cell cycle
2. P GO:0006878 cellular copper ion homeostasis
2. P GO:0035910 ascending aorta morphogenesis
2. P GO:0045590 negative regulation of regulatory T cell differentiation
2. P GO:0006977 DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
2. P GO:0010723 positive regulation of transcription from RNA polymerase II promoter in response to iron
2. P GO:0006357 regulation of transcription by RNA polymerase II
2. P GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
2. P GO:0071260 cellular response to mechanical stimulus
2. P GO:0005667 transcription regulator complex
2. P GO:0003357 noradrenergic neuron differentiation
2. P GO:0002819 regulation of adaptive immune response
2. P GO:0005935 cellular bud neck
2. P GO:0014009 glial cell proliferation
2. P GO:0016602 CCAAT-binding factor complex
2. P GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
2. P GO:0021510 spinal cord development
2. P GO:0030217 T cell differentiation
2. P GO:0035198 miRNA binding
2. P GO:0030907 MBF transcription complex
2. P GO:0042769 obsolete DNA damage response, detection of DNA damage
2. P GO:0034124 regulation of MyD88-dependent toll-like receptor signaling pathway
2. P GO:0003211 cardiac ventricle formation
2. P GO:0043332 mating projection tip
2. P GO:0060333 interferon-gamma-mediated signaling pathway
2. P GO:0045088 regulation of innate immune response
2. P GO:2000816 negative regulation of mitotic sister chromatid separation
2. P GO:0031018 endocrine pancreas development
2. P GO:0032728 positive regulation of interferon-beta production
2. P GO:0051276 chromosome organization
2. P GO:2000564 regulation of CD8-positive, alpha-beta T cell proliferation
2. P GO:0045143 homologous chromosome segregation
2. P GO:0000792 heterochromatin
2. P GO:0001841 neural tube formation
2. P GO:0033217 regulation of transcription from RNA polymerase II promoter in response to iron ion starvation
2. P GO:0000131 incipient cellular bud site
2. P GO:1903715 regulation of aerobic respiration
2. P GO:0032024 positive regulation of insulin secretion
2. P GO:0045944 positive regulation of transcription by RNA polymerase II
2. P GO:0044182 filamentous growth of a population of unicellular organisms
2. P GO:0005934 cellular bud tip
2. P GO:0021782 glial cell development
2. P GO:0071333 cellular response to glucose stimulus
2. P GO:0003183 mitral valve morphogenesis
2. P GO:0070868 obsolete heterochromatin organization involved in chromatin silencing
3. B GO:0007411 axon guidance
3. B GO:0005085 guanyl-nucleotide exchange factor activity
3. B GO:0004674 protein serine/threonine kinase activity
3. B GO:0007185 transmembrane receptor protein tyrosine phosphatase signaling pathway
3. B GO:0051056 regulation of small GTPase mediated signal transduction
3. B GO:0106311
3. B GO:0007417 central nervous system development
3. B GO:0106310 protein serine kinase activity
3. B GO:0045599 negative regulation of fat cell differentiation
3. B GO:0048812 neuron projection morphogenesis
3. B GO:0042995 cell projection

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A7MB34 Protein FAM181B 3.66e-09 7.81e-53 0.0
1. PB Q80VF6 Protein FAM181B 7.45e-07 3.73e-58 0.0
1. PB A6NEQ2 Protein FAM181B 0 1.13e-149 0.0
2. P Q5AFK0 Metal-binding activator 1 3.26e-01 1.69e-02 NA
2. P P24488 Transcriptional activator hap2 4.79e-01 7.60e-03 NA
2. P P38785 GTPase-interacting component 1 3.71e-01 2.85e-04 NA
2. P J9VEC2 AP-1-like transcription factor yap1 2.79e-01 3.31e-02 NA
2. P O97930 Proto-oncogene c-Fos 1.46e-01 4.77e-02 NA
2. P P10914 Interferon regulatory factor 1 4.40e-01 2.90e-02 NA
2. P A0A1B0GUS0 Uncharacterized protein C19orf85 2.17e-01 7.10e-06 NA
2. P Q06945 Transcription factor SOX-4 6.26e-01 1.77e-02 NA
2. P Q9NZH5 Securin-2 5.39e-01 2.54e-02 NA
2. P Q91731 Transcription factor Sox-11-A 1.40e-01 3.96e-02 NA
2. P P42845 Protein STB1 6.67e-01 3.31e-02 NA
3. B Q8N9Y4 Protein FAM181A 4.26e-02 NA 1.94e-07
3. B O75962 Triple functional domain protein NA NA 0.023