Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
A6NDE8
(G antigen 12H) with a FATCAT P-Value: 9.96e-10 and RMSD of 2.83 angstrom. The sequence alignment identity is 95.7%.
Structural alignment shown in left. Query protein A6NER3 colored as red in alignment, homolog A6NDE8 colored as blue.
Query protein A6NER3 is also shown in right top, homolog A6NDE8 showed in right bottom. They are colored based on secondary structures.
A6NER3 MSWRGRSTYYWPRPRPYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPP 100 A6NDE8 MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQCQDPAAAQKGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPP 100 A6NER3 NPEEVKTPEEGKKQSQC 117 A6NDE8 NPEEVKTPEEGEKQSQC 117
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:1903202 | negative regulation of oxidative stress-induced cell death |
| 2. P | GO:0042594 | response to starvation |
| 2. P | GO:0043066 | negative regulation of apoptotic process |
| 2. P | GO:0003713 | transcription coactivator activity |
| 2. P | GO:0032872 | regulation of stress-activated MAPK cascade |
| 2. P | GO:0006979 | response to oxidative stress |
| 2. P | GO:1903427 | negative regulation of reactive oxygen species biosynthetic process |
| 3. B | GO:0004222 | metalloendopeptidase activity |
| 3. B | GO:0005618 | cell wall |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q8WWM1 | X antigen family member 5 | 2.49e-03 | 8.22e-06 | 5.59e-07 |
| 1. PB | A6NGK3 | G antigen 10 | 3.25e-06 | 1.89e-40 | 8.27e-65 |
| 1. PB | A6NDE8 | G antigen 12H | 9.96e-10 | 4.39e-46 | 5.60e-74 |
| 1. PB | P0CL82 | G antigen 12I | 5.70e-09 | 3.53e-68 | 8.45e-76 |
| 1. PB | Q13069 | G antigen 5 | 3.20e-07 | 1.87e-67 | 4.52e-76 |
| 1. PB | Q96GT9 | X antigen family member 2 | 1.85e-03 | 1.17e-02 | 3.15e-16 |
| 1. PB | Q4V326 | G antigen 2E | 1.46e-08 | 1.75e-49 | 4.80e-71 |
| 1. PB | Q8WTP9 | X antigen family member 3 | 4.77e-03 | 1.48e-11 | 1.88e-13 |
| 1. PB | Q13070 | G antigen 6 | 4.96e-08 | 2.67e-64 | 1.82e-75 |
| 1. PB | P0CL80 | G antigen 12F | 7.46e-08 | 3.53e-68 | 8.45e-76 |
| 1. PB | O76087 | G antigen 7 | 2.39e-07 | 3.53e-68 | 8.45e-76 |
| 1. PB | A6NER3 | G antigen 12J | 0 | 3.84e-144 | 1.64e-78 |
| 1. PB | P0DSO3 | G antigen 4 | 4.40e-08 | 4.15e-73 | 1.10e-76 |
| 1. PB | Q6NT46 | G antigen 2A | 2.29e-08 | 1.25e-40 | 1.62e-70 |
| 1. PB | P0DTW1 | G antigen 1 | 8.21e-07 | 2.03e-64 | 1.10e-75 |
| 1. PB | Q4V321 | G antigen 13 | 2.25e-08 | 2.26e-66 | 4.01e-76 |
| 1. PB | P0CL81 | G antigen 12G | 5.94e-07 | 3.53e-68 | 8.45e-76 |
| 1. PB | Q9UEU5 | G antigen 2D | 1.13e-07 | 1.10e-50 | 6.56e-72 |
| 1. PB | A1L429 | G antigen 12B/C/D/E | 9.49e-08 | 4.58e-53 | 2.30e-74 |
| 1. PB | Q13066 | G antigen 2B/2C | 7.84e-08 | 9.27e-47 | 5.45e-71 |
| 2. P | O60829 | P antigen family member 4 | 1.08e-03 | 1.32e-03 | NA |
| 3. B | Q9L7Q2 | Zinc metalloprotease ZmpB | 9.97e-01 | NA | 0.004 |
| 3. B | Q8DQN5 | Zinc metalloprotease ZmpB | 9.97e-01 | NA | 0.021 |
| 3. B | O75459 | P antigen family member 1 | 9.09e-04 | NA | 1.65e-15 |