Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
A8MXZ1
(Putative protein FAM90A23P) with a FATCAT P-Value: 3.21e-07 and RMSD of 8.76 angstrom. The sequence alignment identity is 98.1%.
Structural alignment shown in left. Query protein A6NEW6 colored as red in alignment, homolog A8MXZ1 colored as blue.
Query protein A6NEW6 is also shown in right top, homolog A8MXZ1 showed in right bottom. They are colored based on secondary structures.
A6NEW6 MMARRDPKSWAKRLVRAQTLQKQRRAPVGPRAPPPDEEDPRLKCKNCGAFGHTARSTRCPMKCWKAALVPATLGKKEGKENLKPWKPRVEANPGPLNKDK 100 A8MXZ1 MMARRDPKSWAKRLVRAQTLQKQRRAPVGPRSPPPDEEDPRLKCKNCGAFGHTARSTRCPMKCWKAALVPATLGKKEGKENLKPWKPRAEANPGPLNKDK 100 A6NEW6 GEKEERPRQQDPQRKALLHMFSGKPPEKPLPNGKGSTESSDHLRVASGPMPVHTTSKRPRVDPVLADRSAAEMSGRGSVLASLSPLRKASLSSSSSLGPK 200 A8MXZ1 GEKEERPRQQDPQRKALLHMFSGKPPEKPLPNGKGSTESSDYLRVASGPMPVHTTSKRPRLDPVLADRSATEMSGRGSVLASLSPLRKASLSSSSSLGPK 200 A6NEW6 ERQTGAAADIPQPAVRHQGREPLLVVKPTHSRPEGGCREVPQAASKTHGLLQAARPQAQDKRPAVTSQPCPPAATHSLGLGSNLSFGPGAKRPAQAPIQA 300 A8MXZ1 ERQTGAAADMPQPAVRHQGREPLLVVKPTHSRPEGGCREVPQAASKTHGLLQAARPQAQDKRPAVTPQPCPPAATHSLGLGSNLSFGPGAKRPAQAPIQA 300 A6NEW6 CLNFPKKPRLGPFQIPESAIQGGELGAPENLQPPPAATELGPSTSPQMGRRTPAQVPSVDRQPPHSTPCLPTAQACTMSHHSAASHDGAQPLRVLFRRLE 400 A8MXZ1 CLNFPKKPRLGPFQIPESAIQGGELGAPENLQPPPAATELGPSTSPQMGRRTPAQVPSVDRQPPHSRPCLPTAQACTMSHHPAASHDGAQPLRVLFRRLE 400 A6NEW6 NGRWSSSLLAAPSFHSPEKPGAFLAQSPHVSEKSEAPCVRVPPSVLYEDLQVSSSSEDSDSDLE 464 A8MXZ1 NGRWSSSLLAAPSFHSPEKPGAFLAQSPHVSEKSEAPCVRVPPSVLYEDLQVSSSSEDSDSDLE 464
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0001042 | RNA polymerase I core binding |
| 2. P | GO:1905168 | positive regulation of double-strand break repair via homologous recombination |
| 2. P | GO:0003682 | chromatin binding |
| 2. P | GO:0016973 | poly(A)+ mRNA export from nucleus |
| 2. P | GO:0005813 | centrosome |
| 2. P | GO:0009792 | embryo development ending in birth or egg hatching |
| 2. P | GO:0006334 | nucleosome assembly |
| 2. P | GO:0007051 | spindle organization |
| 2. P | GO:0070317 | negative regulation of G0 to G1 transition |
| 2. P | GO:0006974 | cellular response to DNA damage stimulus |
| 2. P | GO:1903863 | P granule assembly |
| 2. P | GO:0010212 | response to ionizing radiation |
| 2. P | GO:0042995 | cell projection |
| 2. P | GO:0019901 | protein kinase binding |
| 2. P | GO:2001032 | regulation of double-strand break repair via nonhomologous end joining |
| 2. P | GO:0010847 | regulation of chromatin assembly |
| 2. P | GO:0006281 | DNA repair |
| 2. P | GO:0007095 | mitotic G2 DNA damage checkpoint signaling |
| 2. P | GO:0071168 | protein localization to chromatin |
| 2. P | GO:0042393 | histone binding |
| 2. P | GO:0043486 | histone exchange |
| 2. P | GO:0003729 | mRNA binding |
| 2. P | GO:0005730 | nucleolus |
| 2. P | GO:0045860 | positive regulation of protein kinase activity |
| 2. P | GO:0005654 | nucleoplasm |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | A8MXJ8 | Putative protein FAM90A5P | 5.31e-06 | 3.62e-100 | 0.0 |
| 1. PB | P0C7W9 | Putative protein FAM90A14P | 4.88e-07 | 4.68e-111 | 0.0 |
| 1. PB | P0C7V4 | Putative protein FAM90A15P | 1.05e-04 | 5.08e-111 | 0.0 |
| 1. PB | P0C7W8 | Putative protein FAM90A13P | 1.37e-05 | 3.68e-112 | 0.0 |
| 1. PB | A6NIJ5 | Putative protein FAM90A20P | 4.66e-06 | 4.39e-78 | 0.0 |
| 1. PB | A6NNJ1 | Putative protein FAM90A9P | 1.82e-06 | 4.09e-98 | 0.0 |
| 1. PB | A6NE21 | Putative protein FAM90A18P/FAM90A19P | 1.39e-06 | 1.55e-93 | 0.0 |
| 1. PB | Q86YD7 | Protein FAM90A1 | 2.27e-05 | 5.30e-79 | 0.0 |
| 1. PB | A6NEW6 | Putative protein FAM90A16P/FAM90A17P | 0 | 8.57e-148 | 0.0 |
| 1. PB | A6NJQ4 | Putative protein FAM90A8P | 9.75e-06 | 3.73e-130 | 0.0 |
| 1. PB | D6RGX4 | Putative protein FAM90A26 | 1.63e-05 | 6.03e-84 | 0.0 |
| 1. PB | A8MWA6 | Putative protein FAM90A22P | 1.61e-06 | 9.43e-98 | 0.0 |
| 1. PB | A8MXZ1 | Putative protein FAM90A23P | 3.21e-07 | 2.04e-116 | 0.0 |
| 1. PB | P0C7X0 | Putative protein FAM90A24P | 3.69e-06 | 5.52e-112 | 0.0 |
| 1. PB | Q658T7 | Putative protein FAM90A2P | 6.46e-05 | 1.99e-52 | 0.0 |
| 1. PB | A8MX19 | Putative protein FAM90A12P | 2.15e-05 | 1.45e-112 | 0.0 |
| 1. PB | A6NNH2 | Protein FAM90A27P | 4.85e-03 | 4.27e-30 | 1.57e-43 |
| 1. PB | A6NDY2 | Putative protein FAM90A10P | 3.66e-07 | 7.22e-90 | 0.0 |
| 1. PB | A6NKC0 | Putative protein FAM90A7P | 1.70e-06 | 1.87e-104 | 0.0 |
| 2. P | Q3ZBG8 | MRN complex-interacting protein | 9.01e-02 | 4.50e-03 | NA |
| 2. P | Q6DGN6 | Protein SPT2 homolog | 1.80e-01 | 1.28e-02 | NA |
| 2. P | Q3UXL4 | Centrosomal protein kizuna | 2.72e-01 | 4.86e-02 | NA |
| 2. P | Q5ZK13 | Centrosomal protein kizuna | 4.55e-01 | 3.05e-06 | NA |
| 2. P | Q2M2Z5 | Centrosomal protein kizuna | 2.05e-01 | 1.12e-03 | NA |
| 2. P | Q8TAL5 | Uncharacterized protein C9orf43 | 2.92e-01 | 5.00e-04 | NA |
| 2. P | Q95JN2 | Uncharacterized protein C9orf43 homolog | 6.78e-01 | 2.63e-02 | NA |
| 2. P | Q6NZF1 | Zinc finger CCCH domain-containing protein 11A | 3.42e-01 | 1.47e-02 | NA |
| 2. P | D3YT16 | Enlarged germline granules protein 1 | 2.97e-01 | 2.74e-02 | NA |
| 2. P | O75152 | Zinc finger CCCH domain-containing protein 11A | 6.06e-01 | 4.01e-02 | NA |
| 2. P | Q8IMP6 | Protein SPT2 homolog | 4.14e-01 | 1.14e-04 | NA |
| 2. P | Q32PP1 | MRN complex-interacting protein | 6.32e-02 | 4.01e-02 | NA |
| 2. P | Q9UBX2 | Double homeobox protein 4 | 3.13e-01 | 4.17e-02 | NA |
| 2. P | A0A1B0GTU1 | Zinc finger CCCH domain-containing protein 11B | 3.52e-01 | 1.30e-02 | NA |
| 2. P | Q5ZJJ1 | Zinc finger CCCH domain-containing protein 11A | 3.19e-01 | 1.12e-03 | NA |
| 2. P | Q6NTE8 | MRN complex-interacting protein | 1.30e-01 | 5.00e-04 | NA |