Summary

A6NEW6

Homolog: A8MXZ1.
Function: Putative protein FAM90A23P.

Statistics

Total GO Annotation: 25
Unique PROST Go: 25
Unique BLAST Go: 0

Total Homologs: 35
Unique PROST Homologs: 16
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was A8MXZ1 (Putative protein FAM90A23P) with a FATCAT P-Value: 3.21e-07 and RMSD of 8.76 angstrom. The sequence alignment identity is 98.1%.
Structural alignment shown in left. Query protein A6NEW6 colored as red in alignment, homolog A8MXZ1 colored as blue. Query protein A6NEW6 is also shown in right top, homolog A8MXZ1 showed in right bottom. They are colored based on secondary structures. 

  A6NEW6 MMARRDPKSWAKRLVRAQTLQKQRRAPVGPRAPPPDEEDPRLKCKNCGAFGHTARSTRCPMKCWKAALVPATLGKKEGKENLKPWKPRVEANPGPLNKDK 100
  A8MXZ1 MMARRDPKSWAKRLVRAQTLQKQRRAPVGPRSPPPDEEDPRLKCKNCGAFGHTARSTRCPMKCWKAALVPATLGKKEGKENLKPWKPRAEANPGPLNKDK 100

  A6NEW6 GEKEERPRQQDPQRKALLHMFSGKPPEKPLPNGKGSTESSDHLRVASGPMPVHTTSKRPRVDPVLADRSAAEMSGRGSVLASLSPLRKASLSSSSSLGPK 200
  A8MXZ1 GEKEERPRQQDPQRKALLHMFSGKPPEKPLPNGKGSTESSDYLRVASGPMPVHTTSKRPRLDPVLADRSATEMSGRGSVLASLSPLRKASLSSSSSLGPK 200

  A6NEW6 ERQTGAAADIPQPAVRHQGREPLLVVKPTHSRPEGGCREVPQAASKTHGLLQAARPQAQDKRPAVTSQPCPPAATHSLGLGSNLSFGPGAKRPAQAPIQA 300
  A8MXZ1 ERQTGAAADMPQPAVRHQGREPLLVVKPTHSRPEGGCREVPQAASKTHGLLQAARPQAQDKRPAVTPQPCPPAATHSLGLGSNLSFGPGAKRPAQAPIQA 300

  A6NEW6 CLNFPKKPRLGPFQIPESAIQGGELGAPENLQPPPAATELGPSTSPQMGRRTPAQVPSVDRQPPHSTPCLPTAQACTMSHHSAASHDGAQPLRVLFRRLE 400
  A8MXZ1 CLNFPKKPRLGPFQIPESAIQGGELGAPENLQPPPAATELGPSTSPQMGRRTPAQVPSVDRQPPHSRPCLPTAQACTMSHHPAASHDGAQPLRVLFRRLE 400

  A6NEW6 NGRWSSSLLAAPSFHSPEKPGAFLAQSPHVSEKSEAPCVRVPPSVLYEDLQVSSSSEDSDSDLE 464
  A8MXZ1 NGRWSSSLLAAPSFHSPEKPGAFLAQSPHVSEKSEAPCVRVPPSVLYEDLQVSSSSEDSDSDLE 464

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0001042 RNA polymerase I core binding
2. P GO:1905168 positive regulation of double-strand break repair via homologous recombination
2. P GO:0003682 chromatin binding
2. P GO:0016973 poly(A)+ mRNA export from nucleus
2. P GO:0005813 centrosome
2. P GO:0009792 embryo development ending in birth or egg hatching
2. P GO:0006334 nucleosome assembly
2. P GO:0007051 spindle organization
2. P GO:0070317 negative regulation of G0 to G1 transition
2. P GO:0006974 cellular response to DNA damage stimulus
2. P GO:1903863 P granule assembly
2. P GO:0010212 response to ionizing radiation
2. P GO:0042995 cell projection
2. P GO:0019901 protein kinase binding
2. P GO:2001032 regulation of double-strand break repair via nonhomologous end joining
2. P GO:0010847 regulation of chromatin assembly
2. P GO:0006281 DNA repair
2. P GO:0007095 mitotic G2 DNA damage checkpoint signaling
2. P GO:0071168 protein localization to chromatin
2. P GO:0042393 histone binding
2. P GO:0043486 histone exchange
2. P GO:0003729 mRNA binding
2. P GO:0005730 nucleolus
2. P GO:0045860 positive regulation of protein kinase activity
2. P GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A8MXJ8 Putative protein FAM90A5P 5.31e-06 3.62e-100 0.0
1. PB P0C7W9 Putative protein FAM90A14P 4.88e-07 4.68e-111 0.0
1. PB P0C7V4 Putative protein FAM90A15P 1.05e-04 5.08e-111 0.0
1. PB P0C7W8 Putative protein FAM90A13P 1.37e-05 3.68e-112 0.0
1. PB A6NIJ5 Putative protein FAM90A20P 4.66e-06 4.39e-78 0.0
1. PB A6NNJ1 Putative protein FAM90A9P 1.82e-06 4.09e-98 0.0
1. PB A6NE21 Putative protein FAM90A18P/FAM90A19P 1.39e-06 1.55e-93 0.0
1. PB Q86YD7 Protein FAM90A1 2.27e-05 5.30e-79 0.0
1. PB A6NEW6 Putative protein FAM90A16P/FAM90A17P 0 8.57e-148 0.0
1. PB A6NJQ4 Putative protein FAM90A8P 9.75e-06 3.73e-130 0.0
1. PB D6RGX4 Putative protein FAM90A26 1.63e-05 6.03e-84 0.0
1. PB A8MWA6 Putative protein FAM90A22P 1.61e-06 9.43e-98 0.0
1. PB A8MXZ1 Putative protein FAM90A23P 3.21e-07 2.04e-116 0.0
1. PB P0C7X0 Putative protein FAM90A24P 3.69e-06 5.52e-112 0.0
1. PB Q658T7 Putative protein FAM90A2P 6.46e-05 1.99e-52 0.0
1. PB A8MX19 Putative protein FAM90A12P 2.15e-05 1.45e-112 0.0
1. PB A6NNH2 Protein FAM90A27P 4.85e-03 4.27e-30 1.57e-43
1. PB A6NDY2 Putative protein FAM90A10P 3.66e-07 7.22e-90 0.0
1. PB A6NKC0 Putative protein FAM90A7P 1.70e-06 1.87e-104 0.0
2. P Q3ZBG8 MRN complex-interacting protein 9.01e-02 4.50e-03 NA
2. P Q6DGN6 Protein SPT2 homolog 1.80e-01 1.28e-02 NA
2. P Q3UXL4 Centrosomal protein kizuna 2.72e-01 4.86e-02 NA
2. P Q5ZK13 Centrosomal protein kizuna 4.55e-01 3.05e-06 NA
2. P Q2M2Z5 Centrosomal protein kizuna 2.05e-01 1.12e-03 NA
2. P Q8TAL5 Uncharacterized protein C9orf43 2.92e-01 5.00e-04 NA
2. P Q95JN2 Uncharacterized protein C9orf43 homolog 6.78e-01 2.63e-02 NA
2. P Q6NZF1 Zinc finger CCCH domain-containing protein 11A 3.42e-01 1.47e-02 NA
2. P D3YT16 Enlarged germline granules protein 1 2.97e-01 2.74e-02 NA
2. P O75152 Zinc finger CCCH domain-containing protein 11A 6.06e-01 4.01e-02 NA
2. P Q8IMP6 Protein SPT2 homolog 4.14e-01 1.14e-04 NA
2. P Q32PP1 MRN complex-interacting protein 6.32e-02 4.01e-02 NA
2. P Q9UBX2 Double homeobox protein 4 3.13e-01 4.17e-02 NA
2. P A0A1B0GTU1 Zinc finger CCCH domain-containing protein 11B 3.52e-01 1.30e-02 NA
2. P Q5ZJJ1 Zinc finger CCCH domain-containing protein 11A 3.19e-01 1.12e-03 NA
2. P Q6NTE8 MRN complex-interacting protein 1.30e-01 5.00e-04 NA