Summary

A6NEY3

Homolog: A6NEF3.
Function: Golgin subfamily A member 6-like protein 4.

Statistics

Total GO Annotation: 185
Unique PROST Go: 80
Unique BLAST Go: 99

Total Homologs: 100
Unique PROST Homologs: 47
Unique BLAST Homologs: 39

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was A6NEF3 (Golgin subfamily A member 6-like protein 4) with a FATCAT P-Value: 3.33e-16 and RMSD of 2.03 angstrom. The sequence alignment identity is 74.5%.
Structural alignment shown in left. Query protein A6NEY3 colored as red in alignment, homolog A6NEF3 colored as blue. Query protein A6NEY3 is also shown in right top, homolog A6NEF3 showed in right bottom. They are colored based on secondary structures. 

  A6NEY3 MWPQPRLPPHPAMSEKTQQGKLAAAKKKLKAYWQRKSPGIPAGANRKKKINGSSPDTATSGGYHSPGDSATGIYGEGRASSTTLEDLESQYQELAVALDS 100
  A6NEF3 MWPQPRFPPHPAMSEKTQQGKLAAAKKKLKAYWQRKSPGIPAGANRKKKINGSSPDTATSGGYHSPGDSATGIYGEGRASSTTLEDLESQYQELAVALDS 100

  A6NEY3 SSAIISQLTENINSLVRTSKEEKKHEIHLVQKLGRSLFKLKNQTAEPLAPEPPAGPSKVEQLQDETNHLRKELESVGRQLQAEVENNQMLSLLNRRQEER 200
  A6NEF3 SSAIISQLTENINSLVRTSKEEKKHEIHLVQKLGRSLFKLKNQTAEPLAPEPPAGPSKVEQLQDETNHLRKELESVGRQLQAEVENNQMLSLLNRRQEER 200

  A6NEY3 LREQEERLREQEERLREQEERLCEQEERLREQEERLREQEERLCEQEERLREHEERLCEQEERLCEQEERLREQEERLHEQEERLCEQEERLREQEERLC 300
  A6NEF3 LREQEERLREQEERLR-------EQEDRLHEQEERLREQEERLCEQEERLREHEERLCEQEERLCEQEERLREQEERLH-------EQEERLREQEERLC 286

  A6NEY3 EQEERLREQEERLCEQEERLREQEERLCEQEKLPGQERLLEEVEKLLEQERR--------------------------QEEQERLLERERLLEEVEKLLE 374
  A6NEF3 EQEERLREQEERLCEQEERLREQEERLCEQEKLPGQERLLEEVEKLLEQERRQEEQERLLERERLLEEVEKLLEQERQQEEQERLLERERLLEEVEKLLE 386

  A6NEY3 QERRQEEQERLLER-------EELLDEVEELLEQERLRQQDERLWQQETLQ------ELERLRELERMLELGWEALYEQRAEPRSGFEEL---------- 451
  A6NEF3 QERRQEEQERLLERERLLDEVEELLDEVEELLEQERLRQQDERLWQQETLQELERLRELERLRELERMLELGWEALYEQRAEPRSGFEELNNENKSTLQL 486

  A6NEY3 ---VR-CPTWGGCPLP------------------------------------------------------------------------ 463
  A6NEF3 EQQVKELKKSGGAEEPRGSESAAAARPVAGAPVPQGAWMCGQAGWTPQEHPGLSGEAVGTGEAAGGAGEAACHSFRAAENRELNITII 574

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0032580 Golgi cisterna membrane
1. PB GO:0014069 postsynaptic density
1. PB GO:0007030 Golgi organization
1. PB GO:0000137 Golgi cis cisterna
1. PB GO:0000226 microtubule cytoskeleton organization
1. PB GO:0005801 cis-Golgi network
2. P GO:0099184 structural constituent of postsynaptic intermediate filament cytoskeleton
2. P GO:0005213 structural constituent of egg chorion
2. P GO:1990830 cellular response to leukemia inhibitory factor
2. P GO:2000781 positive regulation of double-strand break repair
2. P GO:0051656 establishment of organelle localization
2. P GO:0000122 negative regulation of transcription by RNA polymerase II
2. P GO:0030216 keratinocyte differentiation
2. P GO:0007530 sex determination
2. P GO:0097418 neurofibrillary tangle
2. P GO:0043202 lysosomal lumen
2. P GO:0097440 apical dendrite
2. P GO:0043619 regulation of transcription from RNA polymerase II promoter in response to oxidative stress
2. P GO:1900006 positive regulation of dendrite development
2. P GO:0033693 neurofilament bundle assembly
2. P GO:0005796 Golgi lumen
2. P GO:0030238 male sex determination
2. P GO:1902513 regulation of organelle transport along microtubule
2. P GO:0031297 replication fork processing
2. P GO:0045987 positive regulation of smooth muscle contraction
2. P GO:0045110 intermediate filament bundle assembly
2. P GO:0007306 eggshell chorion assembly
2. P GO:0150017 basal proximal dendrite
2. P GO:0033150 cytoskeletal calyx
2. P GO:0005540 hyaluronic acid binding
2. P GO:0005576 extracellular region
2. P GO:0009653 anatomical structure morphogenesis
2. P GO:0031103 axon regeneration
2. P GO:0045179 apical cortex
2. P GO:0070935 3'-UTR-mediated mRNA stabilization
2. P GO:0007304 chorion-containing eggshell formation
2. P GO:0001552 ovarian follicle atresia
2. P GO:0098685 Schaffer collateral - CA1 synapse
2. P GO:0043204 perikaryon
2. P GO:0042311 vasodilation
2. P GO:0001942 hair follicle development
2. P GO:0005516 calmodulin binding
2. P GO:0042220 response to cocaine
2. P GO:0005199 structural constituent of cell wall
2. P GO:0046914 transition metal ion binding
2. P GO:0001533 cornified envelope
2. P GO:0042600 egg chorion
2. P GO:1903935 response to sodium arsenite
2. P GO:0008301 DNA binding, bending
2. P GO:0035686 sperm fibrous sheath
2. P GO:0048936 peripheral nervous system neuron axonogenesis
2. P GO:0018149 peptide cross-linking
2. P GO:0061564 axon development
2. P GO:0015643 toxic substance binding
2. P GO:1903937 response to acrylamide
2. P GO:0099160 postsynaptic intermediate filament cytoskeleton
2. P GO:0007420 brain development
2. P GO:0030154 cell differentiation
2. P GO:0005200 structural constituent of cytoskeleton
2. P GO:0033234 negative regulation of protein sumoylation
2. P GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
2. P GO:0021510 spinal cord development
2. P GO:0045104 intermediate filament cytoskeleton organization
2. P GO:0031424 keratinization
2. P GO:0106333 subcortical maternal complex
2. P GO:0005883 neurofilament
2. P GO:0018153 isopeptide cross-linking via N6-(L-isoglutamyl)-L-lysine
2. P GO:0007288 sperm axoneme assembly
2. P GO:0020003 symbiont-containing vacuole
2. P GO:1905168 positive regulation of double-strand break repair via homologous recombination
2. P GO:0010628 positive regulation of gene expression
2. P GO:0005813 centrosome
2. P GO:0007088 regulation of mitotic nuclear division
2. P GO:0097228 sperm principal piece
2. P GO:0008494 translation activator activity
2. P GO:0040019 positive regulation of embryonic development
2. P GO:0010224 response to UV-B
2. P GO:0016607 nuclear speck
2. P GO:0005882 intermediate filament
2. P GO:0071447 cellular response to hydroperoxide
2. P GO:0039644 suppression by virus of host NF-kappaB cascade
2. P GO:0007548 sex differentiation
2. P GO:0060052 neurofilament cytoskeleton organization
2. P GO:1990393 3M complex
2. P GO:0009877 nodulation
2. P GO:0030674 protein-macromolecule adaptor activity
3. B GO:1990535 neuron projection maintenance
3. B GO:0050772 positive regulation of axonogenesis
3. B GO:0043198 dendritic shaft
3. B GO:0060050 positive regulation of protein glycosylation
3. B GO:0009971 anastral spindle assembly involved in male meiosis
3. B GO:0090161 Golgi ribbon formation
3. B GO:0005874 microtubule
3. B GO:0030430 host cell cytoplasm
3. B GO:0150001 primary dendrite
3. B GO:0016358 dendrite development
3. B GO:1901588 dendritic microtubule
3. B GO:0044409 entry into host
3. B GO:0048156 tau protein binding
3. B GO:0009524 phragmoplast
3. B GO:2000014 regulation of endosperm development
3. B GO:1990225 rhoptry neck
3. B GO:0098880 maintenance of postsynaptic specialization structure
3. B GO:0043083 synaptic cleft
3. B GO:0004198 calcium-dependent cysteine-type endopeptidase activity
3. B GO:0045168 cell-cell signaling involved in cell fate commitment
3. B GO:0050803 regulation of synapse structure or activity
3. B GO:0072686 mitotic spindle
3. B GO:0007265 Ras protein signal transduction
3. B GO:0007409 axonogenesis
3. B GO:0070160 tight junction
3. B GO:0030134 COPII-coated ER to Golgi transport vesicle
3. B GO:0006486 protein glycosylation
3. B GO:0035255 ionotropic glutamate receptor binding
3. B GO:0032091 negative regulation of protein binding
3. B GO:0097264 self proteolysis
3. B GO:0002224 toll-like receptor signaling pathway
3. B GO:0008306 associative learning
3. B GO:0045995 regulation of embryonic development
3. B GO:0008201 heparin binding
3. B GO:0008569 minus-end-directed microtubule motor activity
3. B GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B GO:0043408 regulation of MAPK cascade
3. B GO:0008017 microtubule binding
3. B GO:0043194 axon initial segment
3. B GO:0007020 microtubule nucleation
3. B GO:0051645 Golgi localization
3. B GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
3. B GO:0031114 regulation of microtubule depolymerization
3. B GO:0090307 mitotic spindle assembly
3. B GO:0006997 nucleus organization
3. B GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane
3. B GO:0090166 Golgi disassembly
3. B GO:0007613 memory
3. B GO:0099642 retrograde axonal protein transport
3. B GO:0050882 voluntary musculoskeletal movement
3. B GO:0044650 adhesion of symbiont to host cell
3. B GO:0070050 neuron cellular homeostasis
3. B GO:0051289 protein homotetramerization
3. B GO:0044307 dendritic branch
3. B GO:0017124 SH3 domain binding
3. B GO:0099641 anterograde axonal protein transport
3. B GO:0008356 asymmetric cell division
3. B GO:0032224 positive regulation of synaptic transmission, cholinergic
3. B GO:0010507 negative regulation of autophagy
3. B GO:0048169 regulation of long-term neuronal synaptic plasticity
3. B GO:0043113 receptor clustering
3. B GO:0007098 centrosome cycle
3. B GO:0019901 protein kinase binding
3. B GO:0043087 regulation of GTPase activity
3. B GO:2000011 regulation of adaxial/abaxial pattern formation
3. B GO:0000922 spindle pole
3. B GO:0046789 host cell surface receptor binding
3. B GO:0005872 minus-end kinesin complex
3. B GO:0005794 Golgi apparatus
3. B GO:0043025 neuronal cell body
3. B GO:1904115 axon cytoplasm
3. B GO:0044647 host-symbiont bicellular tight junction
3. B GO:0008542 visual learning
3. B GO:2000010 positive regulation of protein localization to cell surface
3. B GO:0090628 plant epidermal cell fate specification
3. B GO:0005875 microtubule associated complex
3. B GO:0048167 regulation of synaptic plasticity
3. B GO:0005652 nuclear lamina
3. B GO:0090306 meiotic spindle assembly
3. B GO:0098609 cell-cell adhesion
3. B GO:0045202 synapse
3. B GO:0020008 rhoptry
3. B GO:0061676 importin-alpha family protein binding
3. B GO:0043524 negative regulation of neuron apoptotic process
3. B GO:0015631 tubulin binding
3. B GO:1903829 positive regulation of protein localization
3. B GO:0014037 Schwann cell differentiation
3. B GO:0043655 host extracellular space
3. B GO:1902817 negative regulation of protein localization to microtubule
3. B GO:0050208 polysialic-acid O-acetyltransferase activity
3. B GO:0008093 cytoskeletal anchor activity
3. B GO:0009934 regulation of meristem structural organization
3. B GO:0019905 syntaxin binding
3. B GO:0099092 postsynaptic density, intracellular component
3. B GO:0046580 negative regulation of Ras protein signal transduction
3. B GO:0050771 negative regulation of axonogenesis
3. B GO:0051225 spindle assembly
3. B GO:2000024 regulation of leaf development
3. B GO:0007389 pattern specification process

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A6NEF3 Golgin subfamily A member 6-like protein 4 3.33e-16 1.55e-25 1.80e-128
1. PB H0YKK7 Putative golgin subfamily A member 6-like protein 19 2.35e-12 1.09e-25 2.56e-145
1. PB Q9NYA3 Golgin subfamily A member 6A 1.63e-08 3.95e-05 5.99e-40
1. PB A6NEY3 Putative golgin subfamily A member 6-like protein 3 0 5.67e-145 0.0
1. PB Q8N9W4 Golgin subfamily A member 6-like protein 2 1.67e-08 1.49e-03 3.34e-22
1. PB H0YM25 Golgin subfamily A member 6-like protein 22 1.95e-07 3.59e-09 4.54e-30
1. PB A6NI86 Golgin subfamily A member 6-like protein 10 7.25e-13 1.40e-29 6.92e-143
1. PB Q8N7Z2 Golgin subfamily A member 6-like protein 1 2.49e-09 6.97e-05 5.38e-18
1. PB A0A1B0GV03 Golgin subfamily A member 6-like protein 7 2.15e-10 3.32e-16 4.43e-25
1. PB A6NEM1 Golgin subfamily A member 6-like protein 9 1.35e-04 7.81e-14 4.39e-127
1. PB A6NDN3 Golgin subfamily A member 6B 6.68e-09 2.09e-04 1.47e-39
1. PB P0CG33 Golgin subfamily A member 6D 9.84e-09 5.99e-04 5.60e-40
1. PB A6NDK9 Golgin subfamily A member 6C 4.36e-09 4.83e-05 4.10e-40
1. PB A8MZA4 Golgin subfamily A member 6-like protein 6 2.47e-07 2.06e-08 4.35e-32
2. P P18170 Defective chorion-1 protein, FC106 isoform 3.27e-03 2.38e-04 NA
2. P P16884 Neurofilament heavy polypeptide 7.40e-06 1.11e-02 NA
2. P Q05738 Sex-determining region Y protein 1.95e-06 2.03e-04 NA
2. P Q0II65 Coiled-coil domain-containing protein 70 1.69e-09 1.20e-03 NA
2. P Q08696 Axoneme-associated protein mst101(2) 2.49e-05 5.39e-04 NA
2. P P24710 Involucrin 5.91e-06 3.21e-03 NA
2. P P08297 Early nodulin-75 7.53e-01 7.69e-04 NA
2. P P24712 Involucrin 1.55e-04 7.93e-04 NA
2. P P18899 Stress protein DDR48 7.84e-01 1.55e-02 NA
2. P Q62563 Sex-determining region Y protein 1.27e-01 6.82e-05 NA
2. P Q9QR71 Protein LANA1 NA 2.38e-05 NA
2. P Q6IC83 Uncharacterized protein C22orf42 1.18e-02 6.58e-04 NA
2. P D3ZVV1 KH domain-containing protein 3 3.42e-01 3.42e-02 NA
2. P Q13117 Deleted in azoospermia protein 2 9.80e-01 1.04e-02 NA
2. P P16112 Aggrecan core protein 9.99e-01 2.29e-02 NA
2. P A6NE01 Protein FAM186A 4.41e-02 1.02e-04 NA
2. P Q8X482 Secreted effector protein EspF(U) NA 3.14e-04 NA
2. P Q90WZ1 Kininogen-1b 8.31e-01 2.41e-04 NA
2. P Q6XPR3 Repetin 1.41e-01 6.95e-03 NA
2. P O08884 Keratin-associated protein 6-2 9.96e-01 3.15e-02 NA
2. P D3YZV8 Coiled-coil domain-containing protein 8 homolog 8.26e-01 1.43e-05 NA
2. P P17941 Involucrin 6.58e-07 4.33e-06 NA
2. P P62521 Coiled-coil domain-containing protein 8 6.04e-01 1.08e-05 NA
2. P Q2T9N0 Fibrous sheath CABYR-binding protein 7.01e-01 2.68e-04 NA
2. P P07476 Involucrin 1.70e-02 5.22e-04 NA
2. P A6QP35 Keratin-associated protein 10-8 8.28e-01 2.27e-02 NA
2. P Q9U0M8 Uncharacterized protein PFA0635c 3.62e-04 2.55e-03 NA
2. P Q62565 Sex-determining region Y protein 3.59e-03 1.82e-03 NA
2. P P08012 Repetitive proline-rich cell wall protein 1 5.30e-01 1.75e-03 NA
2. P Q95337 Involucrin 1.82e-09 9.49e-03 NA
2. P Q62267 Cornifin-B 7.74e-01 4.36e-02 NA
2. P P14591 Involucrin 3.85e-04 2.12e-04 NA
2. P P21733 Uncharacterized 29.1 kDa protein in cryB1 5'region 9.98e-01 1.94e-03 NA
2. P Q54G05 Putative leucine-rich repeat-containing protein DDB_G0290503 1.11e-03 2.08e-02 NA
2. P Q03400 S-antigen protein 7.01e-01 2.68e-02 NA
2. P Q90W88 Kininogen-1c 7.39e-01 5.99e-03 NA
2. P Q9JJL0 Testis-specific gene A8 protein 8.71e-01 1.36e-04 NA
2. P Q8N402 Putative uncharacterized protein LOC388882 5.76e-01 3.62e-02 NA
2. P A1EGX6 Fibrous sheath CABYR-binding protein 8.46e-01 2.44e-02 NA
2. P P24709 Involucrin 3.26e-06 3.46e-04 NA
2. P P05227 Histidine-rich protein PFHRP-II 4.39e-02 1.51e-02 NA
2. P Q9RXP1 Uncharacterized protein DR_0269 2.53e-02 4.04e-03 NA
2. P Q6NSX1 Coiled-coil domain-containing protein 70 1.08e-07 3.36e-02 NA
2. P Q01133 Antho-RFamide neuropeptides 2.60e-01 9.86e-03 NA
2. P P35324 Cornifin alpha 5.68e-01 2.44e-02 NA
2. P P19246 Neurofilament heavy polypeptide 2.33e-06 1.49e-02 NA
2. P Q28092 Cylicin-2 9.30e-01 3.76e-02 NA
3. B I6L899 Golgin subfamily A member 8R 2.36e-08 NA 3.09e-25
3. B A6NMD2 Golgin subfamily A member 8J 4.45e-08 NA 2.42e-24
3. B Q07970 Kinesin-like protein KIN-14C 7.74e-06 NA 0.033
3. B F8WBI6 Golgin subfamily A member 8N 3.39e-08 NA 2.72e-25
3. B Q9CEE2 Ribonuclease Y 6.79e-06 NA 0.040
3. B Q08379 Golgin subfamily A member 2 3.75e-08 NA 1.68e-25
3. B D1FNJ9 CLAVATA3/ESR (CLE)-related protein 4A-1 2.25e-01 NA 0.003
3. B Q60675 Laminin subunit alpha-2 NA NA 0.032
3. B Q0DY81 Nuclear matrix constituent protein 1a 4.88e-06 NA 0.006
3. B H3BV12 Golgin subfamily A member 8Q 2.44e-09 NA 2.12e-25
3. B F6SEU4 Ras/Rap GTPase-activating protein SynGAP 2.82e-01 NA 0.026
3. B Q8IDX6 Reticulocyte-binding protein homolog 2a NA NA 1.30e-16
3. B H3BPF8 Golgin subfamily A member 8S 4.75e-10 NA 1.49e-12
3. B D1FNK3 CLAVATA3/ESR (CLE)-related protein 4B-2 1.88e-01 NA 0.004
3. B A6NN73 Golgin subfamily A member 8C 6.03e-09 NA 9.34e-23
3. B A8MQT2 Golgin subfamily A member 8B 9.88e-08 NA 1.41e-15
3. B Q0D2H9 Putative golgin subfamily A member 8D 6.93e-08 NA 3.11e-07
3. B D6RF30 Golgin subfamily A member 8K 2.46e-07 NA 2.53e-24
3. B Q6ZQQ6 WD repeat-containing protein 87 NA NA 1.65e-05
3. B H3BQL2 Golgin subfamily A member 8T 1.44e-07 NA 2.25e-24
3. B P34926 Microtubule-associated protein 1A NA NA 0.003
3. B C0H5F4 Reticulocyte-binding protein homolog 2b NA NA 0.014
3. B A6NCC3 Golgin subfamily A member 8O 2.95e-08 NA 2.51e-25
3. B P78559 Microtubule-associated protein 1A NA NA 1.06e-07
3. B Q8ILR9 Protein PF14_0175 NA NA 1.08e-06
3. B D1FNK2 CLAVATA3/ESR (CLE)-related protein 4B-1 2.84e-01 NA 0.011
3. B A1ADJ6 Polysialic acid O-acetyltransferase 4.06e-05 NA 3.53e-15
3. B Q62839 Golgin subfamily A member 2 7.54e-09 NA 3.44e-08
3. B Q96PV0 Ras/Rap GTPase-activating protein SynGAP 4.09e-01 NA 0.028
3. B Q6ZFZ4 Calpain-type cysteine protease ADL1 3.77e-01 NA 0.041
3. B Q08AF8 Putative golgin subfamily A member 8F/8G 2.28e-08 NA 1.30e-06
3. B A7E2F4 Golgin subfamily A member 8A 5.70e-09 NA 2.08e-15
3. B D1FNK0 CLAVATA3/ESR (CLE)-related protein 4A-2 1.92e-01 NA 0.002
3. B A6NC78 Putative golgin subfamily A member 8I 1.18e-05 NA 3.12e-26
3. B Q1KXH4 Protein TIC 214 2.28e-01 NA 0.010
3. B Q921M4 Golgin subfamily A member 2 4.16e-08 NA 3.02e-09
3. B P0CJ92 Golgin subfamily A member 8H 2.55e-07 NA 9.98e-26
3. B Q2KZF3 Exodeoxyribonuclease 7 large subunit 6.36e-04 NA 0.019
3. B H3BSY2 Golgin subfamily A member 8M 9.84e-09 NA 3.06e-26