Summary

A6NFN9

Homolog: Q3UUE9.
Function: Protein ANKUB1.

Statistics

Total GO Annotation: 157
Unique PROST Go: 76
Unique BLAST Go: 78

Total Homologs: 104
Unique PROST Homologs: 26
Unique BLAST Homologs: 77

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q3UUE9 (Protein ANKUB1) with a FATCAT P-Value: 1.68e-12 and RMSD of 3.25 angstrom. The sequence alignment identity is 32.9%.
Structural alignment shown in left. Query protein A6NFN9 colored as red in alignment, homolog Q3UUE9 colored as blue. Query protein A6NFN9 is also shown in right top, homolog Q3UUE9 showed in right bottom. They are colored based on secondary structures. 

  A6NFN9 MRIFIAFEGSFEPFDVSADETVEVVKLMIKDYFHIPLSEDKQGRRYLELMYAGAALKDSWSLADVGISFCSTLKCFVKEEDKPTLYVFNAVTQDTMPVME 100
  Q3UUE9 MRIFIAFEGSFEAFDVEAHTSVGAIKQMIKDYFHIPLSEDKQGRWYLELMYAGAALRNSWSLSDVGISFCSTLKCFVKKEDKPTLYVFNAVTQEMMPIME 100

  A6NFN9 SISLLDKTVSDLRTLVTLRCGLPVSVYCLRTPRGLEMYDCNTLKDYQTDIGTTLRLDVWDGWKEFLMGCLLGQKLKVQRYLSKEGPVLKYQKRVALYIAA 200
  Q3UUE9 NMSLLDKKVSDLRMLVTLRCGFPVSVYCLRTPTGLEMYDCNTLKDYQTDIGTTLRLDVWDGWKEFLMGCLLGQKPKVQHYLSKEGPVLKYGS-------- 192

  A6NFN9 FCGYIELTEWALKQGARPHEAVGVHPYRAWCHEALHADVSKCPIHAAAEAGQLLILKAFVNYSVLCLECKNAAGQTPLTIVFKHKHKDCVLYLLSKMWST 300
  Q3UUE9 ---------------------------------------------------------------------------------------------------- 192

  A6NFN9 VSFPKISVPMRIYIKIKQWILRAQSHSLHKSQFCGARVFGAKVGDTVMVDGFTKPKMTSKSWHKAGNSDSQSIVLKLPSLSKQTASSKPVNPLAISQPDT 400
  Q3UUE9 ---------------------------------------------------------------------------------------------------- 192

  A6NFN9 RKQALKFHPLVNASSFSELQKHQQQNQKKITATARKKEKLIKNTYLPQVPLPPVSRVGYSHPSFFYATPSADFLLKSSFSSFLEHSGKTPWENAIYCLAV 500
  Q3UUE9 ---------------------------------------------------------------------------------------------------- 192

  A6NFN9 AR 502
  Q3UUE9 -- 192

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0006511 ubiquitin-dependent protein catabolic process
1. PB GO:0016567 protein ubiquitination
1. PB GO:0002020 protease binding
2. P GO:0035591 signaling adaptor activity
2. P GO:0034142 toll-like receptor 4 signaling pathway
2. P GO:0034122 negative regulation of toll-like receptor signaling pathway
2. P GO:0043274 phospholipase binding
2. P GO:0036312 phosphatidylinositol 3-kinase regulatory subunit binding
2. P GO:0051898 negative regulation of protein kinase B signaling
2. P GO:0050869 negative regulation of B cell activation
2. P GO:1902511 negative regulation of apoptotic DNA fragmentation
2. P GO:0009627 systemic acquired resistance
2. P GO:1990782 protein tyrosine kinase binding
2. P GO:0005102 signaling receptor binding
2. P GO:0007084 mitotic nuclear membrane reassembly
2. P GO:0043549 regulation of kinase activity
2. P GO:2000678 negative regulation of transcription regulatory region DNA binding
2. P GO:0009682 induced systemic resistance
2. P GO:0035307 positive regulation of protein dephosphorylation
2. P GO:0061028 establishment of endothelial barrier
2. P GO:0051721 protein phosphatase 2A binding
2. P GO:0034123 positive regulation of toll-like receptor signaling pathway
2. P GO:1900118 negative regulation of execution phase of apoptosis
2. P GO:1903670 regulation of sprouting angiogenesis
2. P GO:0106167 extracellular ATP signaling
2. P GO:0045947 negative regulation of translational initiation
2. P GO:0032715 negative regulation of interleukin-6 production
2. P GO:0035308 negative regulation of protein dephosphorylation
2. P GO:0017020 myosin phosphatase regulator activity
2. P GO:0014066 regulation of phosphatidylinositol 3-kinase signaling
2. P GO:0032076 negative regulation of deoxyribonuclease activity
2. P GO:0031593 polyubiquitin modification-dependent protein binding
2. P GO:0019888 protein phosphatase regulator activity
2. P GO:1903589 positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis
2. P GO:0008157 protein phosphatase 1 binding
2. P GO:0070242 thymocyte apoptotic process
2. P GO:0050731 positive regulation of peptidyl-tyrosine phosphorylation
2. P GO:1990756 ubiquitin ligase-substrate adaptor activity
2. P GO:0043066 negative regulation of apoptotic process
2. P GO:0010200 response to chitin
2. P GO:0031348 negative regulation of defense response
2. P GO:0006878 cellular copper ion homeostasis
2. P GO:0051489 regulation of filopodium assembly
2. P GO:0010112 regulation of systemic acquired resistance
2. P GO:0048471 perinuclear region of cytoplasm
2. P GO:0046676 negative regulation of insulin secretion
2. P GO:0009626 plant-type hypersensitive response
2. P GO:0009617 response to bacterium
2. P GO:0031466 Cul5-RING ubiquitin ligase complex
2. P GO:0080027 response to herbivore
2. P GO:0050832 defense response to fungus
2. P GO:0043410 positive regulation of MAPK cascade
2. P GO:0035304 regulation of protein dephosphorylation
2. P GO:0033132 negative regulation of glucokinase activity
2. P GO:0042995 cell projection
2. P GO:0034134 toll-like receptor 2 signaling pathway
2. P GO:0007417 central nervous system development
2. P GO:0042113 B cell activation
2. P GO:2000031 regulation of salicylic acid mediated signaling pathway
2. P GO:0019900 kinase binding
2. P GO:0060703 deoxyribonuclease inhibitor activity
2. P GO:0031929 TOR signaling
2. P GO:0042325 regulation of phosphorylation
2. P GO:0005829 cytosol
2. P GO:0014068 positive regulation of phosphatidylinositol 3-kinase signaling
2. P GO:2000022 regulation of jasmonic acid mediated signaling pathway
2. P GO:0034162 toll-like receptor 9 signaling pathway
2. P GO:0006309 apoptotic DNA fragmentation
2. P GO:0016607 nuclear speck
2. P GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway
2. P GO:0050727 regulation of inflammatory response
2. P GO:0030176 integral component of endoplasmic reticulum membrane
2. P GO:0034154 toll-like receptor 7 signaling pathway
2. P GO:0050790 regulation of catalytic activity
2. P GO:0035914 skeletal muscle cell differentiation
2. P GO:0042326 negative regulation of phosphorylation
2. P GO:0009625 response to insect
2. P GO:1902309 negative regulation of peptidyl-serine dephosphorylation
2. P GO:0005730 nucleolus
3. B GO:0033621 nuclear-transcribed mRNA catabolic process, meiosis-specific transcripts
3. B GO:0005902 microvillus
3. B GO:0030034 microvillar actin bundle assembly
3. B GO:0032426 stereocilium tip
3. B GO:0031398 positive regulation of protein ubiquitination
3. B GO:0015629 actin cytoskeleton
3. B GO:0022627 cytosolic small ribosomal subunit
3. B GO:0021888 hypothalamus gonadotrophin-releasing hormone neuron development
3. B GO:0031625 ubiquitin protein ligase binding
3. B GO:0051639 actin filament network formation
3. B GO:0043197 dendritic spine
3. B GO:1902255 positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator
3. B GO:0047497 mitochondrion transport along microtubule
3. B GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
3. B GO:0007626 locomotory behavior
3. B GO:0043209 myelin sheath
3. B GO:0030046 parallel actin filament bundle assembly
3. B GO:0000209 protein polyubiquitination
3. B GO:0007141 male meiosis I
3. B GO:0010638 positive regulation of organelle organization
3. B GO:0016601 Rac protein signal transduction
3. B GO:0030334 regulation of cell migration
3. B GO:0032421 stereocilium bundle
3. B GO:0007605 sensory perception of sound
3. B GO:0035096 larval midgut cell programmed cell death
3. B GO:0005634 nucleus
3. B GO:0051881 regulation of mitochondrial membrane potential
3. B GO:0006887 exocytosis
3. B GO:0007030 Golgi organization
3. B GO:0016604 nuclear body
3. B GO:0004842 ubiquitin-protein transferase activity
3. B GO:0045732 positive regulation of protein catabolic process
3. B GO:0007049 cell cycle
3. B GO:1901214 regulation of neuron death
3. B GO:0051494 negative regulation of cytoskeleton organization
3. B GO:0032420 stereocilium
3. B GO:0003208 cardiac ventricle morphogenesis
3. B GO:0030673 axolemma
3. B GO:1902527 positive regulation of protein monoubiquitination
3. B GO:0007144 female meiosis I
3. B GO:0031432 titin binding
3. B GO:0014731 spectrin-associated cytoskeleton
3. B GO:0005737 cytoplasm
3. B GO:0008585 female gonad development
3. B GO:0060613 fat pad development
3. B GO:0061630 ubiquitin protein ligase activity
3. B GO:0051491 positive regulation of filopodium assembly
3. B GO:0017124 SH3 domain binding
3. B GO:0030507 spectrin binding
3. B GO:0043005 neuron projection
3. B GO:0004857 enzyme inhibitor activity
3. B GO:0097009 energy homeostasis
3. B GO:0048812 neuron projection morphogenesis
3. B GO:0070936 protein K48-linked ubiquitination
3. B GO:0031386 protein tag
3. B GO:0003729 mRNA binding
3. B GO:0043025 neuronal cell body
3. B GO:0031267 small GTPase binding
3. B GO:0009693 ethylene biosynthetic process
3. B GO:0005783 endoplasmic reticulum
3. B GO:0030666 endocytic vesicle membrane
3. B GO:0061136 regulation of proteasomal protein catabolic process
3. B GO:0051017 actin filament bundle assembly
3. B GO:0003190 atrioventricular valve formation
3. B GO:0005903 brush border
3. B GO:0072520 seminiferous tubule development
3. B GO:0019941 modification-dependent protein catabolic process
3. B GO:1903427 negative regulation of reactive oxygen species biosynthetic process
3. B GO:0031982 vesicle
3. B GO:0000139 Golgi membrane
3. B GO:0060612 adipose tissue development
3. B GO:0032580 Golgi cisterna membrane
3. B GO:0061025 membrane fusion
3. B GO:0008093 cytoskeletal anchor activity
3. B GO:0045199 maintenance of epithelial cell apical/basal polarity
3. B GO:0031941 filamentous actin
3. B GO:0008584 male gonad development
3. B GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A6NFN9 Protein ANKUB1 0 1.85e-157 0.0
2. P Q9EQ32 Phosphoinositide 3-kinase adapter protein 1 4.49e-01 3.76e-05 NA
2. P Q8VHQ3 Protein phosphatase 1 regulatory inhibitor subunit 16B 3.80e-02 3.58e-03 NA
2. P Q9SZI3 Regulatory protein NPR2 5.34e-02 1.08e-02 NA
2. P Q3U0L2 Ankyrin repeat domain-containing protein 33B 3.87e-03 2.53e-04 NA
2. P Q7ZWN4 Midnolin-A 2.52e-01 7.44e-03 NA
2. P Q923M0 Protein phosphatase 1 regulatory subunit 16A 1.16e-02 2.07e-02 NA
2. P D4AE48 Midnolin 1.41e-01 4.55e-04 NA
2. P Q3TPJ7 Midnolin 1.18e-01 2.71e-05 NA
2. P Q504T8 Midnolin 6.31e-02 1.36e-02 NA
2. P A6NCL7 Ankyrin repeat domain-containing protein 33B 4.41e-03 2.76e-03 NA
2. P Q96S82 Ubiquitin-like protein 7 2.15e-02 1.12e-03 NA
2. P Q80VH0 B-cell scaffold protein with ankyrin repeats 8.95e-01 1.87e-04 NA
2. P O00273 DNA fragmentation factor subunit alpha 2.72e-02 8.32e-03 NA
2. P Q8BH83 Ankyrin repeat domain-containing protein 9 6.00e-03 9.02e-03 NA
2. P Q95N27 Protein phosphatase 1 regulatory inhibitor subunit 16B 2.59e-02 2.35e-02 NA
2. P Q96I34 Protein phosphatase 1 regulatory subunit 16A 3.18e-02 9.02e-03 NA
2. P Q8NDB2 B-cell scaffold protein with ankyrin repeats 5.59e-01 3.16e-05 NA
2. P P93002 Regulatory protein NPR1 1.47e-02 1.14e-02 NA
2. P Q6ZUJ8 Phosphoinositide 3-kinase adapter protein 1 3.70e-01 4.49e-06 NA
2. P Q91W67 Ubiquitin-like protein 7 2.38e-02 1.40e-03 NA
2. P Q2KIS3 Ubiquitin-like protein 7 1.50e-02 4.14e-03 NA
2. P Q7Z3H0 Photoreceptor ankyrin repeat protein 1.17e-01 3.11e-08 NA
2. P Q9DDT2 Phosphoinositide 3-kinase adapter protein 1 4.99e-01 6.40e-06 NA
2. P Q6P1H6 Ankyrin repeat and LEM domain-containing protein 2 1.89e-01 2.39e-04 NA
2. P Q86XL3 Ankyrin repeat and LEM domain-containing protein 2 1.39e-01 1.30e-05 NA
2. P Q7TP65 Ankyrin repeat and LEM domain-containing protein 2 1.11e-01 4.23e-03 NA
3. B Q8H159 Polyubiquitin 10 3.64e-02 NA 0.018
3. B P0CG66 Polyubiquitin-C 9.53e-02 NA 0.039
3. B P0CH27 Ubiquitin-60S ribosomal protein L40 1.29e-03 NA 0.001
3. B Q86SG2 Ankyrin repeat domain-containing protein 23 2.43e-03 NA 0.008
3. B Q3UUE9 Protein ANKUB1 1.68e-12 NA 1.40e-118
3. B P0CG75 Polyubiquitin 1.30e-03 NA 0.038
3. B Q8MKD1 Polyubiquitin-B 5.16e-04 NA 0.029
3. B E1C656 E3 ubiquitin-protein ligase HACE1 4.66e-02 NA 0.010
3. B P16157 Ankyrin-1 3.72e-01 NA 0.016
3. B Q18297 Transient receptor potential cation channel subfamily A member 1 homolog 1.13e-01 NA 0.005
3. B P42739 Polyubiquitin (Fragment) 7.95e-02 NA 0.001
3. B Q1EC66 Polyubiquitin 3 1.66e-03 NA 0.013
3. B B2RXR6 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B 1.04e-01 NA 0.001
3. B P0CG61 Polyubiquitin-C 1.03e-01 NA 0.042
3. B Q3E7K8 Polyubiquitin 12 6.04e-05 NA 0.003
3. B P69325 Polyubiquitin 1.57e-03 NA 0.015
3. B Q63429 Polyubiquitin-C 1.45e-01 NA 0.044
3. B P0CG62 Polyubiquitin-B 9.41e-04 NA 0.025
3. B P0CG53 Polyubiquitin-B 7.41e-04 NA 0.027
3. B P0CG85 Polyubiquitin 3.64e-02 NA 0.018
3. B Q58G87 Polyubiquitin 3 1.97e-03 NA 0.018
3. B P0CG65 Polyubiquitin-B 3.10e-04 NA 0.022
3. B P0C030 Ubiquitin-NEDD8-like protein RUB1 3.36e-06 NA 0.010
3. B P0CG84 Polyubiquitin (Fragment) 9.35e-04 NA 0.017
3. B P0CG83 Polyubiquitin (Fragment) 8.44e-07 NA 0.003
3. B O15084 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A 3.87e-01 NA 0.002
3. B P0CG47 Polyubiquitin-B 5.15e-05 NA 0.022
3. B P0C032 Ubiquitin-like protein-NEDD8-like protein RUB3 5.16e-07 NA 0.022
3. B P0CG50 Polyubiquitin-C 1.46e-01 NA 0.045
3. B Q9BZ19 Ankyrin repeat domain-containing protein 60 4.41e-08 NA 7.43e-04
3. B Q63618 Espin 1.12e-01 NA 0.014
3. B P62976 Polyubiquitin 1.07e-01 NA 0.036
3. B P0CG70 Polyubiquitin 1.55e-03 NA 0.034
3. B P0CG74 Polyubiquitin 1.56e-03 NA 0.030
3. B P62972 Polyubiquitin (Fragment) 3.59e-06 NA 0.024
3. B P0C031 Ubiquitin-NEDD8-like protein RUB2 3.09e-06 NA 0.010
3. B Q8IYU2 E3 ubiquitin-protein ligase HACE1 4.80e-02 NA 0.014
3. B P0CG73 Polyubiquitin 6.63e-05 NA 0.008
3. B Q8N8A2 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B 1.55e-01 NA 0.023
3. B P0CH04 Polyubiquitin 4.56e-02 NA 0.021
3. B P0CH32 Polyubiquitin 4 3.98e-02 NA 0.016
3. B P0CG71 Polyubiquitin-A 1.41e-01 NA 0.006
3. B P0CG51 Polyubiquitin-B 9.13e-04 NA 0.025
3. B P0CH33 Polyubiquitin 11 6.55e-05 NA 0.010
3. B P0CH05 Polyubiquitin 3.56e-02 NA 0.021
3. B P69322 Polyubiquitin 1.35e-03 NA 0.017
3. B Q9ET47 Espin 2.72e-02 NA 0.010
3. B P69309 Polyubiquitin 1.60e-03 NA 0.013
3. B P0CG60 Polyubiquitin-B 1.70e-04 NA 0.022
3. B Q28BK1 E3 ubiquitin-protein ligase HACE1 9.90e-02 NA 0.001
3. B Q3E7T8 Polyubiquitin 14 1.68e-03 NA 0.015
3. B P69315 Polyubiquitin (Fragment) 5.30e-04 NA 0.015
3. B P59669 Polyubiquitin 4.30e-02 NA 0.002
3. B Q8RUC6 Ubiquitin-NEDD8-like protein RUB2 3.68e-06 NA 0.014
3. B P0CG72 Polyubiquitin 4.47e-02 NA 0.039
3. B P0C073 Ubiquitin-NEDD8-like protein RUB1 3.45e-06 NA 0.013
3. B D3ZBM7 E3 ubiquitin-protein ligase HACE1 7.15e-02 NA 0.022
3. B Q9SHE7 Ubiquitin-NEDD8-like protein RUB1 5.32e-06 NA 0.011
3. B P0CG69 Polyubiquitin 1.32e-01 NA 0.041
3. B Q9XZC0 Alpha-latrocrustotoxin-Lt1a (Fragment) 3.19e-01 NA 0.018
3. B P0CG68 Polyubiquitin-C 7.98e-02 NA 0.036
3. B Q3U0D9 E3 ubiquitin-protein ligase HACE1 4.59e-02 NA 0.009
3. B P0CG63 Polyubiquitin 1.09e-03 NA 0.038
3. B P0CG48 Polyubiquitin-C 9.42e-02 NA 0.040
3. B Q505D1 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A 2.09e-01 NA 0.001
3. B P0CG64 Polyubiquitin-C 1.09e-01 NA 0.042
3. B Q7T163 Kinase D-interacting substrate of 220 kDa B 3.53e-01 NA 0.036
3. B P0CG55 Polyubiquitin-B 4.87e-04 NA 0.020
3. B P0CG49 Polyubiquitin-B 8.34e-04 NA 0.025
3. B P42740 Polyubiquitin 4.21e-02 NA 0.002
3. B F1N6G5 E3 ubiquitin-protein ligase HACE1 3.86e-02 NA 0.012
3. B P0CG67 Polyubiquitin-B 1.66e-04 NA 0.022
3. B P23324 Polyubiquitin 6.50e-05 NA 0.001
3. B P0CH28 Polyubiquitin-C 9.27e-02 NA 0.038
3. B F8W2M1 E3 ubiquitin-protein ligase HACE1 6.52e-02 NA 0.004
3. B P0CG54 Polyubiquitin-B 8.89e-04 NA 0.026
3. B Q6DCL5 E3 ubiquitin-protein ligase HACE1 9.11e-02 NA 0.001