Summary

A6NGG3

Homolog: P14662.
Function: Bactericidin B-2.

Statistics

Total GO Annotation: 11
Unique PROST Go: 11
Unique BLAST Go: 0

Total Homologs: 17
Unique PROST Homologs: 16
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was P14662 (Bactericidin B-2) with a FATCAT P-Value: 0.018 and RMSD of 3.21 angstrom. The sequence alignment identity is 16.5%.
Structural alignment shown in left. Query protein A6NGG3 colored as red in alignment, homolog P14662 colored as blue. Query protein A6NGG3 is also shown in right top, homolog P14662 showed in right bottom. They are colored based on secondary structures. 

  A6NGG3 MARFQRTKEREEDRCSLNIYYVRNTTQGTAP--ACVGKRMQPSPTGKGGKCCTVHGLTRKIHNVQPNLQSPILSAACVD 77
  P14662 ---WNPFKELE--RAG---QRVRDAVISAAPAVATVG---QAAAIARG------------------------------- 37

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0030435 sporulation resulting in formation of a cellular spore
2. P GO:0070979 protein K11-linked ubiquitination
2. P GO:0045664 regulation of neuron differentiation
2. P GO:0017015 regulation of transforming growth factor beta receptor signaling pathway
2. P GO:0019731 antibacterial humoral response
2. P GO:0031103 axon regeneration
2. P GO:0045087 innate immune response
2. P GO:0005680 anaphase-promoting complex
2. P GO:0030071 regulation of mitotic metaphase/anaphase transition
2. P GO:0031145 anaphase-promoting complex-dependent catabolic process
2. P GO:0046740 transport of virus in host, cell to cell

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A6NGG3 Putative uncharacterized protein C9orf92 0 1.27e-147 2.04e-53
2. P Q8TGK1 Uncharacterized protein YHR213W-B 4.90e-02 7.34e-03 NA
2. P Q3E786 Uncharacterized protein YGR240C-A 5.55e-03 5.67e-04 NA
2. P O83206 Uncharacterized protein TP_0176 2.18e-01 4.43e-02 NA
2. P Q7WY63 Protein AntE 2.24e-02 5.31e-04 NA
2. P Q8NFD4 Uncharacterized protein FLJ76381 1.35e-01 1.37e-02 NA
2. P P14662 Bactericidin B-2 1.80e-02 3.69e-02 NA
2. P P40536 Putative uncharacterized protein YIL032C 4.94e-02 2.03e-02 NA
2. P Q5NVD3 Neuronal regeneration-related protein 3.58e-01 2.09e-02 NA
2. P Q03886 Putative uncharacterized protein YIR020W-A 5.22e-01 7.03e-08 NA
2. P Q4ZGE2 Uncharacterized protein C3D6.16 3.21e-01 2.27e-03 NA
2. P P27211 Probable movement protein p8 NA 3.25e-02 NA
2. P O83793 Uncharacterized protein TP_0818 2.55e-04 6.04e-03 NA
2. P Q16612 Neuronal regeneration-related protein 4.06e-01 3.76e-02 NA
2. P O83168 Uncharacterized protein TP_0132 2.86e-04 2.75e-02 NA
2. P Q10493 Meiotically up-regulated gene 106 protein 3.12e-02 2.50e-03 NA
2. P Q5RAQ7 Anaphase-promoting complex subunit CDC26 1.09e-01 4.35e-02 NA