Summary

A6NGH7

Homolog: Q2T9U9.
Function: Coiled-coil domain-containing protein 160.

Statistics

Total GO Annotation: 280
Unique PROST Go: 276
Unique BLAST Go: 4

Total Homologs: 288
Unique PROST Homologs: 283
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q2T9U9 (Coiled-coil domain-containing protein 160) with a FATCAT P-Value: 1.56e-11 and RMSD of 2.98 angstrom. The sequence alignment identity is 70.0%.
Structural alignment shown in left. Query protein A6NGH7 colored as red in alignment, homolog Q2T9U9 colored as blue. Query protein A6NGH7 is also shown in right top, homolog Q2T9U9 showed in right bottom. They are colored based on secondary structures. 

  A6NGH7 MDARRKHWKENMFTPFFSAQDVLEETSEPESSSEQTTADSSKGMEEIYNLSSRKFQEESKFKRKKYIFQLNEIEQEQNLRENKRNISKNETDTNSASYES 100
  Q2T9U9 MDARRKHWKENKFAPLFSAQDIPNEAAQLESSSEQMPLDKVKRMEIIFNLSSRKFREENKFKRKEFISQPNENEQESNLIERKINISKTEADTNSVSCES 100

  A6NGH7 SNVDVTTEESFNSTEDNST-----CSTDNLPALLRQDIRKKFMERMSPKLCLNLLNEELEELNMKYRKIEEEFENAEKELLHYKKEIFTKPLNFQETETD 195
  Q2T9U9 SNLDIATEESFNSTEELPTWVIKELSTP--P---QKDKKKKFTEGMSSKLRLNLLNEELEVLDMKCKKIEEEFESAEKELLNSKKEVSTKPLNFQEAEVE 195

  A6NGH7 ASKSDYELQALRNDLSEKATNVKNLSEQLQQAKEVIHKLNLENRNLKEAVRKLKHQTEVGNVLLKEEMKSYYELEMAKIRGELSVIKNELRTEKTLQARN 295
  Q2T9U9 TSKTDWELQALRNDLSEKATNVKNLTEELQQAKEVIHKLSLENKDLKETVRKLKRQTEVGNAFLKEEMKLYYELEMEKIRGELTAIKNELRTEKSLQARN 295

  A6NGH7 NRALELLRKYYASSMVTSSSILDHFTGDFF 325
  Q2T9U9 NRALELLRKHFASVMPSGTS--DNFMGDFF 323

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0010555 response to mannitol
2. P GO:0097539 ciliary transition fiber
2. P GO:0043198 dendritic shaft
2. P GO:0030474 spindle pole body duplication
2. P GO:0007094 mitotic spindle assembly checkpoint signaling
2. P GO:0099078 BORC complex
2. P GO:0005874 microtubule
2. P GO:0061908 phagophore
2. P GO:0010375 stomatal complex patterning
2. P GO:0098653 centromere clustering
2. P GO:0016242 negative regulation of macroautophagy
2. P GO:1903251 multi-ciliated epithelial cell differentiation
2. P GO:0032456 endocytic recycling
2. P GO:0008156 negative regulation of DNA replication
2. P GO:0009704 de-etiolation
2. P GO:0030010 establishment of cell polarity
2. P GO:0051013 microtubule severing
2. P GO:0031122 cytoplasmic microtubule organization
2. P GO:0044772 mitotic cell cycle phase transition
2. P GO:0031965 nuclear membrane
2. P GO:0030275 LRR domain binding
2. P GO:0051168 nuclear export
2. P GO:0048193 Golgi vesicle transport
2. P GO:0051321 meiotic cell cycle
2. P GO:0009903 chloroplast avoidance movement
2. P GO:0051170 import into nucleus
2. P GO:0000138 Golgi trans cisterna
2. P GO:0008340 determination of adult lifespan
2. P GO:1905280 negative regulation of retrograde transport, endosome to Golgi
2. P GO:0035092 sperm DNA condensation
2. P GO:0120095 vacuole-isolation membrane contact site
2. P GO:1905832 positive regulation of spindle assembly
2. P GO:0008017 microtubule binding
2. P GO:0120103 centriolar subdistal appendage
2. P GO:0030139 endocytic vesicle
2. P GO:0120293 dynein axonemal particle
2. P GO:0006997 nucleus organization
2. P GO:0034994 microtubule organizing center attachment site organization
2. P GO:0045504 dynein heavy chain binding
2. P GO:0032465 regulation of cytokinesis
2. P GO:0005869 dynactin complex
2. P GO:0016239 positive regulation of macroautophagy
2. P GO:0031224 intrinsic component of membrane
2. P GO:0051301 cell division
2. P GO:0002756 MyD88-independent toll-like receptor signaling pathway
2. P GO:0030175 filopodium
2. P GO:0000818 nuclear MIS12/MIND complex
2. P GO:0005861 troponin complex
2. P GO:0045786 negative regulation of cell cycle
2. P GO:0000802 transverse filament
2. P GO:0002230 positive regulation of defense response to virus by host
2. P GO:0080009 mRNA methylation
2. P GO:0007346 regulation of mitotic cell cycle
2. P GO:0060048 cardiac muscle contraction
2. P GO:0051878 lateral element assembly
2. P GO:0005886 plasma membrane
2. P GO:0043015 gamma-tubulin binding
2. P GO:0006936 muscle contraction
2. P GO:0055038 recycling endosome membrane
2. P GO:0015031 protein transport
2. P GO:0036159 inner dynein arm assembly
2. P GO:0005880 nuclear microtubule
2. P GO:0098863 nuclear migration by microtubule mediated pushing forces
2. P GO:0051649 establishment of localization in cell
2. P GO:0005816 spindle pole body
2. P GO:0021687 cerebellar molecular layer morphogenesis
2. P GO:0005863 striated muscle myosin thick filament
2. P GO:0044805 late nucleophagy
2. P GO:0051255 spindle midzone assembly
2. P GO:0016592 mediator complex
2. P GO:0006279 premeiotic DNA replication
2. P GO:0043292 contractile fiber
2. P GO:0010564 regulation of cell cycle process
2. P GO:0036126 sperm flagellum
2. P GO:0031985 Golgi cisterna
2. P GO:0008608 attachment of spindle microtubules to kinetochore
2. P GO:0031083 BLOC-1 complex
2. P GO:1903394 protein localization to kinetochore involved in kinetochore assembly
2. P GO:0032388 positive regulation of intracellular transport
2. P GO:1990584 cardiac Troponin complex
2. P GO:0005819 spindle
2. P GO:0048814 regulation of dendrite morphogenesis
2. P GO:0000022 mitotic spindle elongation
2. P GO:0061635 regulation of protein complex stability
2. P GO:0097546 ciliary base
2. P GO:0043621 protein self-association
2. P GO:0030425 dendrite
2. P GO:0030496 midbody
2. P GO:0005634 nucleus
2. P GO:0031511 Mis6-Sim4 complex
2. P GO:0006940 regulation of smooth muscle contraction
2. P GO:0036064 ciliary basal body
2. P GO:0016604 nuclear body
2. P GO:0005930 axoneme
2. P GO:0051382 kinetochore assembly
2. P GO:2000647 negative regulation of stem cell proliferation
2. P GO:1903565 negative regulation of protein localization to cilium
2. P GO:0000743 nuclear migration involved in conjugation with cellular fusion
2. P GO:0098534 centriole assembly
2. P GO:1990498 mitotic spindle microtubule
2. P GO:0043009 chordate embryonic development
2. P GO:0042803 protein homodimerization activity
2. P GO:0000775 chromosome, centromeric region
2. P GO:0032504 multicellular organism reproduction
2. P GO:0000398 mRNA splicing, via spliceosome
2. P GO:0031385 regulation of termination of mating projection growth
2. P GO:0007066 female meiosis sister chromatid cohesion
2. P GO:0060047 heart contraction
2. P GO:0005814 centriole
2. P GO:0005769 early endosome
2. P GO:0000133 polarisome
2. P GO:0035660 MyD88-dependent toll-like receptor 4 signaling pathway
2. P GO:0060155 platelet dense granule organization
2. P GO:0009950 dorsal/ventral axis specification
2. P GO:0000800 lateral element
2. P GO:0071007 U2-type catalytic step 2 spliceosome
2. P GO:0000930 gamma-tubulin complex
2. P GO:0003712 transcription coregulator activity
2. P GO:0031014 troponin T binding
2. P GO:0000795 synaptonemal complex
2. P GO:0051493 regulation of cytoskeleton organization
2. P GO:0000137 Golgi cis cisterna
2. P GO:0005801 cis-Golgi network
2. P GO:0034274 Atg12-Atg5-Atg16 complex
2. P GO:0005797 Golgi medial cisterna
2. P GO:0030345 structural constituent of tooth enamel
2. P GO:0000974 Prp19 complex
2. P GO:0045944 positive regulation of transcription by RNA polymerase II
2. P GO:0000776 kinetochore
2. P GO:0051233 spindle midzone
2. P GO:0044782 cilium organization
2. P GO:0006914 autophagy
2. P GO:0030017 sarcomere
2. P GO:0032258 cytoplasm to vacuole transport by the Cvt pathway
2. P GO:0005768 endosome
2. P GO:0016055 Wnt signaling pathway
2. P GO:0030705 cytoskeleton-dependent intracellular transport
2. P GO:0030172 troponin C binding
2. P GO:0006937 regulation of muscle contraction
2. P GO:0033693 neurofilament bundle assembly
2. P GO:0035093 spermatogenesis, exchange of chromosomal proteins
2. P GO:0009970 cellular response to sulfate starvation
2. P GO:0030016 myofibril
2. P GO:0051510 regulation of unidimensional cell growth
2. P GO:0051294 establishment of spindle orientation
2. P GO:0055037 recycling endosome
2. P GO:0030424 axon
2. P GO:0034451 centriolar satellite
2. P GO:0090404 pollen tube tip
2. P GO:0030543 2-micrometer plasmid partitioning
2. P GO:0070193 synaptonemal complex organization
2. P GO:0010497 plasmodesmata-mediated intercellular transport
2. P GO:0085032 modulation by symbiont of host I-kappaB kinase/NF-kappaB cascade
2. P GO:0051224 negative regulation of protein transport
2. P GO:0035046 pronuclear migration
2. P GO:0140059 dendrite arborization
2. P GO:0110026 regulation of DNA strand resection involved in replication fork processing
2. P GO:0007030 Golgi organization
2. P GO:0007052 mitotic spindle organization
2. P GO:0036156 inner dynein arm
2. P GO:2000221 negative regulation of pseudohyphal growth
2. P GO:0051988 regulation of attachment of spindle microtubules to kinetochore
2. P GO:0000301 retrograde transport, vesicle recycling within Golgi
2. P GO:0000711 meiotic DNA repair synthesis
2. P GO:0043622 cortical microtubule organization
2. P GO:0005628 prospore membrane
2. P GO:0010882 regulation of cardiac muscle contraction by calcium ion signaling
2. P GO:0051315 attachment of mitotic spindle microtubules to kinetochore
2. P GO:0003341 cilium movement
2. P GO:0007098 centrosome cycle
2. P GO:1903568 negative regulation of protein localization to ciliary membrane
2. P GO:0032880 regulation of protein localization
2. P GO:0051959 dynein light intermediate chain binding
2. P GO:2000130 positive regulation of octopamine signaling pathway
2. P GO:0000922 spindle pole
2. P GO:0010073 meristem maintenance
2. P GO:0005823 central plaque of spindle pole body
2. P GO:0034770 histone H4-K20 methylation
2. P GO:0007288 sperm axoneme assembly
2. P GO:0048167 regulation of synaptic plasticity
2. P GO:0061057 peptidoglycan recognition protein signaling pathway
2. P GO:0070847 core mediator complex
2. P GO:0019855 calcium channel inhibitor activity
2. P GO:0030030 cell projection organization
2. P GO:0071013 catalytic step 2 spliceosome
2. P GO:0007130 synaptonemal complex assembly
2. P GO:1905515 non-motile cilium assembly
2. P GO:0000939 inner kinetochore
2. P GO:0032780 negative regulation of ATP-dependent activity
2. P GO:0090235 regulation of metaphase plate congression
2. P GO:0098574 cytoplasmic side of lysosomal membrane
2. P GO:0034315 regulation of Arp2/3 complex-mediated actin nucleation
2. P GO:0000801 central element
2. P GO:0009652 thigmotropism
2. P GO:0097729 9+2 motile cilium
2. P GO:0051225 spindle assembly
2. P GO:0032154 cleavage furrow
2. P GO:0071988 protein localization to spindle pole body
2. P GO:0051010 microtubule plus-end binding
2. P GO:0048592 eye morphogenesis
2. P GO:0030500 regulation of bone mineralization
2. P GO:0097730 non-motile cilium
2. P GO:0007618 mating
2. P GO:0046601 positive regulation of centriole replication
2. P GO:0007610 behavior
2. P GO:0034501 protein localization to kinetochore
2. P GO:0001980 regulation of systemic arterial blood pressure by ischemic conditions
2. P GO:0070056 prospore membrane leading edge
2. P GO:0006501 C-terminal protein lipidation
2. P GO:0006941 striated muscle contraction
2. P GO:0034080 CENP-A containing chromatin assembly
2. P GO:0007199 G protein-coupled receptor signaling pathway coupled to cGMP nucleotide second messenger
2. P GO:0009909 regulation of flower development
2. P GO:0003713 transcription coactivator activity
2. P GO:0009904 chloroplast accumulation movement
2. P GO:0031384 regulation of initiation of mating projection growth
2. P GO:0072384 organelle transport along microtubule
2. P GO:0051310 metaphase plate congression
2. P GO:0097512 cardiac myofibril
2. P GO:0097733 photoreceptor cell cilium
2. P GO:0032120 ascospore-type prospore membrane formation
2. P GO:0007049 cell cycle
2. P GO:0016459 myosin complex
2. P GO:0016321 female meiosis chromosome segregation
2. P GO:1903566 positive regulation of protein localization to cilium
2. P GO:1905037 autophagosome organization
2. P GO:0000070 mitotic sister chromatid segregation
2. P GO:0051019 mitogen-activated protein kinase binding
2. P GO:1903744 positive regulation of anterograde synaptic vesicle transport
2. P GO:0030286 dynein complex
2. P GO:0034045 phagophore assembly site membrane
2. P GO:0000817 COMA complex
2. P GO:0034454 microtubule anchoring at centrosome
2. P GO:0007051 spindle organization
2. P GO:0006357 regulation of transcription by RNA polymerase II
2. P GO:0046628 positive regulation of insulin receptor signaling pathway
2. P GO:0046692 sperm competition
2. P GO:0055010 ventricular cardiac muscle tissue morphogenesis
2. P GO:0005794 Golgi apparatus
2. P GO:0030672 synaptic vesicle membrane
2. P GO:0007286 spermatid development
2. P GO:0016021 integral component of membrane
2. P GO:0000444 MIS12/MIND type complex
2. P GO:0031267 small GTPase binding
2. P GO:0035974 meiotic spindle pole body
2. P GO:0060271 cilium assembly
2. P GO:0042113 B cell activation
2. P GO:0003009 skeletal muscle contraction
2. P GO:0030989 dynein-driven meiotic oscillatory nuclear movement
2. P GO:0031514 motile cilium
2. P GO:0030663 COPI-coated vesicle membrane
2. P GO:0032418 lysosome localization
2. P GO:0005813 centrosome
2. P GO:0051151 negative regulation of smooth muscle cell differentiation
2. P GO:0002177 manchette
2. P GO:0045103 intermediate filament-based process
2. P GO:0006963 positive regulation of antibacterial peptide biosynthetic process
2. P GO:0005829 cytosol
2. P GO:0035371 microtubule plus-end
2. P GO:0046872 metal ion binding
2. P GO:0070652 HAUS complex
2. P GO:0045202 synapse
2. P GO:0044458 motile cilium assembly
2. P GO:0003779 actin binding
2. P GO:0005882 intermediate filament
2. P GO:0031617 NMS complex
2. P GO:0060279 positive regulation of ovulation
2. P GO:0000139 Golgi membrane
2. P GO:1902017 regulation of cilium assembly
2. P GO:0045724 positive regulation of cilium assembly
2. P GO:0019905 syntaxin binding
2. P GO:0042802 identical protein binding
2. P GO:0031214 biomineral tissue development
2. P GO:0031321 ascospore-type prospore assembly
2. P GO:1905342 positive regulation of protein localization to kinetochore
2. P GO:0030674 protein-macromolecule adaptor activity
3. B GO:0005534 galactose binding
3. B GO:0051132 NK T cell activation
3. B GO:0006897 endocytosis
3. B GO:0051861 glycolipid binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q2T9U9 Coiled-coil domain-containing protein 160 1.56e-11 1.17e-49 1.45e-134
1. PB A6NGH7 Coiled-coil domain-containing protein 160 0 1.53e-156 0.0
1. PB A9JSR5 Coiled-coil domain-containing protein 160 homolog 2.38e-07 5.30e-12 2.00e-23
1. PB Q3UYG1 Coiled-coil domain-containing protein 160 1.66e-05 2.27e-40 9.51e-123
2. P Q08DP2 BLOC-1-related complex subunit 5 8.82e-05 1.78e-03 NA
2. P Q86SQ7 Serologically defined colon cancer antigen 8 2.03e-05 3.24e-02 NA
2. P B2GUE2 Leucine-rich repeat flightless-interacting protein 2 6.78e-07 7.87e-03 NA
2. P Q6CL13 Spindle pole component BBP1 2.70e-04 5.76e-09 NA
2. P Q9JHQ5 Leucine zipper transcription factor-like protein 1 6.37e-09 2.20e-09 NA
2. P Q08581 Kinetochore protein SLK19 3.08e-04 1.65e-04 NA
2. P A6ZML8 Autophagy-related protein 16 1.52e-06 1.07e-04 NA
2. P Q6PBE2 Pre-mRNA-splicing factor SPF27 1.25e-05 2.22e-05 NA
2. P Q2T9W6 Leucine-rich repeat flightless-interacting protein 2 8.18e-08 2.09e-03 NA
2. P Q5RKQ0 Pre-mRNA-splicing factor SPF27 5.88e-07 4.37e-04 NA
2. P P40222 Alpha-taxilin 5.86e-05 2.25e-03 NA
2. P Q6K678 Protein HEADING DATE REPRESSOR 1 2.25e-04 1.60e-03 NA
2. P B3NL60 Protein hook 2.00e-04 3.75e-02 NA
2. P Q9NQ48 Leucine zipper transcription factor-like protein 1 2.93e-08 1.87e-10 NA
2. P Q4R3K5 Axonemal dynein light intermediate polypeptide 1 3.20e-05 1.10e-04 NA
2. P Q60547 Synaptonemal complex protein 3 8.84e-09 1.39e-04 NA
2. P Q8K4L4 Protein POF1B 4.50e-04 4.22e-02 NA
2. P Q4V7E8 Leucine-rich repeat flightless-interacting protein 2 4.68e-07 1.62e-07 NA
2. P Q9CYC5 Kinetochore-associated protein DSN1 homolog 2.10e-04 5.14e-03 NA
2. P P0CT51 Blood-induced peptide 1 2.53e-04 2.22e-02 NA
2. P Q6DFC2 Coiled-coil domain-containing protein 77 2.03e-04 4.06e-02 NA
2. P P27500 Protein P1 NA 1.76e-02 NA
2. P Q8BHN1 Gamma-taxilin 3.28e-06 1.67e-05 NA
2. P C7GTR2 Spindle pole component BBP1 1.12e-06 3.52e-09 NA
2. P P27628 Tuftelin 3.29e-07 2.79e-04 NA
2. P Q4R6V9 Leucine zipper transcription factor-like protein 1 1.86e-08 5.91e-12 NA
2. P Q9VTE0 Biogenesis of lysosome-related organelles complex 1 subunit 2 1.15e-06 4.84e-02 NA
2. P Q03818 Autophagy protein 16 6.76e-07 1.07e-04 NA
2. P P60853 Leucine zipper putative tumor suppressor 1 2.00e-08 3.34e-03 NA
2. P D3ZDX9 Multicilin 1.91e-02 6.27e-03 NA
2. P Q8VCS6 Mediator of RNA polymerase II transcription subunit 9 6.04e-03 2.50e-02 NA
2. P P38280 Spore-specific protein YSW1 4.14e-03 3.23e-09 NA
2. P Q08278 Mediator of RNA polymerase II transcription subunit 7 7.57e-04 1.29e-05 NA
2. P Q9H095 Dynein regulatory complex protein 9 1.01e-06 6.88e-03 NA
2. P A7TIN2 Autophagy-related protein 16 1.54e-08 1.10e-02 NA
2. P F4IN23 Basic leucine zipper 34 1.15e-04 1.30e-02 NA
2. P Q5RCA7 Coiled-coil domain-containing protein 91 2.37e-06 3.45e-03 NA
2. P B8AE37 Protein HEADING DATE REPRESSOR 1 3.12e-04 1.60e-03 NA
2. P A1DN59 Mediator of RNA polymerase II transcription subunit 7 7.72e-04 1.44e-02 NA
2. P P20535 14 kDa fusion protein NA 2.53e-02 NA
2. P Q5EA49 Protein MIS12 homolog 1.64e-06 4.70e-02 NA
2. P Q99MY0 Spermatogenic leucine zipper protein 1 1.21e-05 5.68e-05 NA
2. P Q08550 Meiotic plaque component protein 54 1.50e-04 7.10e-05 NA
2. P Q8C963 Coiled-coil domain-containing protein 159 1.09e-05 2.22e-02 NA
2. P P36103 Uncharacterized protein YKL023W 9.88e-06 4.88e-04 NA
2. P Q86YS3 Rab11 family-interacting protein 4 1.86e-04 4.88e-04 NA
2. P Q3ZBL4 Leucine zipper transcription factor-like protein 1 2.83e-08 1.08e-11 NA
2. P Q6RCE1 Intraflagellar transport protein 74 1.36e-05 4.06e-02 NA
2. P Q8BVN8 Axonemal dynein light intermediate polypeptide 1 1.30e-06 9.08e-06 NA
2. P Q7L2Z9 Centromere protein Q 2.81e-05 1.00e-05 NA
2. P Q0WVL7 Golgin candidate 5 5.06e-04 1.63e-03 NA
2. P P11929 Blastoderm-specific protein 25D 3.33e-04 1.42e-02 NA
2. P Q8C7U1 NEDD4-binding protein 3 2.12e-05 1.91e-02 NA
2. P Q6FSH0 Spindle pole component BBP1 5.65e-05 9.42e-06 NA
2. P Q4FZV3 Axonemal dynein light intermediate polypeptide 1 4.71e-06 2.63e-04 NA
2. P Q9U389 Allophagy receptor allo-1 1.03e-06 7.14e-16 NA
2. P Q6FS55 Biogenesis of lysosome-related organelles complex 1 subunit KXD1 3.79e-05 3.90e-02 NA
2. P Q9M9F9 Interactor of constitutive active ROPs 4 4.48e-06 5.05e-04 NA
2. P Q99L00 HAUS augmin-like complex subunit 8 5.98e-06 6.74e-04 NA
2. P Q5RJZ6 Short coiled-coil protein 2.82e-04 1.20e-06 NA
2. P Q6QNY1 Biogenesis of lysosome-related organelles complex 1 subunit 2 4.26e-05 2.53e-03 NA
2. P Q520U5 Autophagy protein 16 4.29e-09 9.28e-05 NA
2. P P60166 Phosphoprotein NA 5.71e-04 NA
2. P Q5RBR4 Leucine zipper transcription factor-like protein 1 3.14e-09 3.32e-10 NA
2. P A0A1L8GXY6 NEDD4-binding protein 3-A 2.94e-04 2.30e-03 NA
2. P Q7TME2 Sperm-associated antigen 5 1.54e-04 7.78e-04 NA
2. P Q8BHX1 HAUS augmin-like complex subunit 1 1.51e-09 1.06e-02 NA
2. P O61493 Protein hook 7.46e-04 1.31e-02 NA
2. P B4JAL5 Protein hook 5.76e-04 4.18e-02 NA
2. P Q6BHS5 Protein ATC1/LIC4 5.26e-05 2.82e-04 NA
2. P Q5U4W1 Leucine zipper putative tumor suppressor 2 homolog 8.63e-04 7.10e-05 NA
2. P Q9H2F9 Coiled-coil domain-containing protein 68 1.51e-07 1.26e-03 NA
2. P Q0IHJ3 HAUS augmin-like complex subunit 8 1.59e-04 2.14e-07 NA
2. P Q3ZU82 Golgin subfamily A member 5 1.36e-03 1.07e-04 NA
2. P Q4WVH5 Autophagy protein 16 8.20e-09 6.17e-04 NA
2. P Q6BKZ4 Mediator of RNA polymerase II transcription subunit 7 2.42e-04 3.52e-03 NA
2. P Q5PQQ6 Dynein regulatory complex protein 9 1.54e-07 1.74e-02 NA
2. P Q86606 Phosphoprotein NA 4.18e-04 NA
2. P P23693 Troponin I, cardiac muscle 3.45e-04 6.60e-03 NA
2. P O15049 NEDD4-binding protein 3 1.74e-03 2.43e-02 NA
2. P Q3TMW1 Coiled-coil domain-containing protein 102A 6.49e-08 2.18e-02 NA
2. P Q6NZW0 Coiled-coil domain-containing protein 102A 2.34e-05 4.98e-03 NA
2. P Q60595 X-linked lymphocyte-regulated protein 3A 1.05e-08 8.78e-04 NA
2. P Q5T0U0 Coiled-coil domain-containing protein 122 1.40e-05 2.40e-03 NA
2. P Q9NNX1 Tuftelin 8.94e-07 1.98e-03 NA
2. P Q95LS7 Coiled-coil domain-containing protein 96 2.13e-06 3.57e-02 NA
2. P Q9JMB0 G kinase-anchoring protein 1 2.32e-07 4.10e-02 NA
2. P Q6P205 X-linked lymphocyte-regulated protein 3B 5.31e-09 1.58e-02 NA
2. P Q6BH63 Autophagy protein 16 6.70e-11 3.59e-06 NA
2. P Q6AXN6 Small kinetochore-associated protein 1.97e-03 5.25e-03 NA
2. P Q06201 Grand meiotic recombination cluster protein 2 1.80e-06 1.12e-04 NA
2. P Q4R764 Synaptonemal complex protein 3 6.10e-09 3.56e-03 NA
2. P Q5UPU1 Uncharacterized protein R253 NA 3.71e-03 NA
2. P Q39604 28 kDa inner dynein arm light chain, axonemal 2.07e-04 3.90e-04 NA
2. P P32788 Uncharacterized protein YBL010C 1.47e-03 5.77e-04 NA
2. P A0A1S3X835 Protein MICROTUBULE BINDING PROTEIN 2C 1.20e-07 1.09e-08 NA
2. P Q6CUE5 Inner kinetochore subunit AME1 3.15e-05 6.17e-05 NA
2. P A9UM82 Myocardial zonula adherens protein 2.50e-05 3.45e-03 NA
2. P E7KV71 Spindle pole component BBP1 8.05e-06 1.37e-09 NA
2. P Q9FH18 WPP domain-interacting protein 2 3.41e-05 1.80e-02 NA
2. P F4KEW8 Protein NETWORKED 4A 2.83e-07 5.64e-04 NA
2. P Q6K3R9 Basic leucine zipper 19 1.31e-06 1.03e-03 NA
2. P P93758 Remorin 4.2 3.30e-05 2.99e-02 NA
2. P Q8CDV0 Coiled-coil domain-containing protein 178 9.57e-06 2.85e-02 NA
2. P Q1T763 Centromere protein R 1.92e-02 6.52e-06 NA
2. P Q1T764 Centromere protein Q 2.67e-04 2.62e-03 NA
2. P Q9LEZ4 Protein MICROTUBULE BINDING PROTEIN 2C 6.88e-06 1.68e-08 NA
2. P Q6DIS8 Leucine zipper putative tumor suppressor 2 homolog 4.35e-04 1.26e-03 NA
2. P Q4WMG1 Mediator of RNA polymerase II transcription subunit 7 1.57e-03 7.95e-03 NA
2. P Q96ST8 Centrosomal protein of 89 kDa 2.16e-05 3.46e-05 NA
2. P A2RUR9 Coiled-coil domain-containing protein 144A 1.54e-02 9.19e-03 NA
2. P Q9C638 Protein WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT-like 2 6.12e-07 4.48e-02 NA
2. P Q54IK9 Protein hook homolog 1.31e-03 4.98e-03 NA
2. P Q8VYU8 Interactor of constitutive active ROPs 5 1.09e-07 2.62e-03 NA
2. P Q6P402 Centrosomal protein of 89 kDa 9.64e-06 8.58e-04 NA
2. P P53298 Inner kinetochore subunit OKP1 2.28e-02 4.75e-02 NA
2. P E7Q3U6 Biogenesis of lysosome-related organelles complex 1 subunit KXD1 NA 2.11e-02 NA
2. P P38236 Protein MUM2 3.17e-05 4.39e-02 NA
2. P O75934 Pre-mRNA-splicing factor SPF27 1.80e-05 5.29e-05 NA
2. P Q9VKD6 Augmin complex subunit dgt2 2.67e-07 7.95e-04 NA
2. P Q54N50 Dynactin subunit 2 1.77e-04 3.90e-02 NA
2. P Q5BBF7 Mediator of RNA polymerase II transcription subunit 7 2.37e-03 5.14e-03 NA
2. P Q12411 Sporulation-specific protein 21 2.05e-04 4.17e-03 NA
2. P Q91WK0 Leucine-rich repeat flightless-interacting protein 2 1.23e-07 1.01e-04 NA
2. P E7NNK3 Spindle pole component BBP1 NA 1.70e-09 NA
2. P Q5IR70 Cancer-associated gene 1 protein homolog 9.06e-06 7.20e-08 NA
2. P C5DT56 Spindle pole component BBP1 5.02e-05 7.10e-07 NA
2. P Q9D287 Pre-mRNA-splicing factor SPF27 3.71e-05 5.29e-05 NA
2. P Q8S8N9 Golgin candidate 1 6.47e-06 9.28e-05 NA
2. P Q6PAM1 Alpha-taxilin 8.48e-05 9.28e-03 NA
2. P Q9H7C4 Syncoilin 2.53e-05 2.53e-03 NA
2. P Q9NUD7 Uncharacterized protein C20orf96 1.46e-05 1.56e-04 NA
2. P Q95JS9 Coiled-coil domain-containing protein 110 6.56e-04 5.11e-04 NA
2. P Q3LUD3 Nedd4 binding protein 3 1.69e-04 8.87e-04 NA
2. P Q969J3 BLOC-1-related complex subunit 5 3.72e-04 2.02e-03 NA
2. P A8E5U3 BLOC-1-related complex subunit 5 9.47e-05 3.24e-02 NA
2. P Q5JLY8 Golgin-84 1.30e-03 6.20e-06 NA
2. P A4IIE8 Rab11 family-interacting protein 4 7.56e-06 7.52e-04 NA
2. P A1CT75 Mediator of RNA polymerase II transcription subunit 7 3.23e-04 1.38e-02 NA
2. P Q63520 Synaptonemal complex protein 3 2.83e-08 4.49e-03 NA
2. P Q9GKR7 Dynein regulatory complex protein 9 1.15e-06 3.57e-02 NA
2. P B5VST2 Spindle pole component BBP1 3.35e-05 1.37e-09 NA
2. P Q9H410 Kinetochore-associated protein DSN1 homolog 1.96e-05 1.24e-07 NA
2. P Q3LGD4 Rab11 family-interacting protein 4A 5.65e-06 5.61e-05 NA
2. P Q8BVC4 Coiled-coil domain-containing protein 68 3.66e-08 1.02e-03 NA
2. P Q08BG7 Short coiled-coil protein A 9.96e-05 5.76e-09 NA
2. P Q9NUQ3 Gamma-taxilin 2.27e-06 6.68e-06 NA
2. P Q6CJY0 Inner kinetochore subunit OKP1 1.21e-03 1.04e-05 NA
2. P Q96C92 Endosome-associated-trafficking regulator 1 4.09e-06 2.96e-05 NA
2. P Q12365 Spindle pole component BBP1 1.46e-05 1.65e-06 NA
2. P Q8VIL3 ZW10 interactor 1.61e-09 2.82e-02 NA
2. P Q6DFL0 Coiled-coil domain-containing protein 102A 3.85e-08 1.23e-03 NA
2. P P06940 Phosphoprotein NA 7.32e-03 NA
2. P Q4HWB3 Uncharacterized protein FGSG_10745 1.63e-05 2.55e-02 NA
2. P P33735 Accessory gland-specific peptide 26Aa 3.37e-05 4.13e-05 NA
2. P B3DGU2 Rab11 family-interacting protein 4B 8.88e-08 1.97e-06 NA
2. P I1RFS8 Autophagy-related protein 16 5.88e-09 2.05e-03 NA
2. P Q78YZ6 Short coiled-coil protein 3.37e-03 1.46e-04 NA
2. P Q9USP4 Meiotically up-regulated gene 1 protein 5.22e-05 2.51e-03 NA
2. P P48787 Troponin I, cardiac muscle 2.58e-04 2.22e-02 NA
2. P P57077 MAP3K7 C-terminal-like protein 5.65e-04 1.57e-06 NA
2. P Q562C6 Leucine zipper transcription factor-like protein 1 2.45e-06 1.05e-08 NA
2. P Q3TCJ8 Coiled-coil domain-containing protein 69 9.90e-11 3.19e-09 NA
2. P P11709 Nuclear fusion protein BIK1 6.70e-05 3.64e-06 NA
2. P P21738 Phosphoprotein NA 6.95e-03 NA
2. P Q8LE98 Interactor of constitutive active ROPs 1 2.53e-08 3.38e-05 NA
2. P P16072 Phosphoprotein NA 1.19e-02 NA
2. P Q54SG7 Pre-mRNA-splicing factor spf27 2.01e-07 1.46e-03 NA
2. P D6RGH6 Multicilin 2.90e-03 1.02e-02 NA
2. P Q3UZ45 Multicilin 3.12e-03 3.05e-04 NA
2. P E7QLJ6 Spindle pole component BBP1 1.48e-04 1.37e-09 NA
2. P Q5RAX7 Pre-mRNA-splicing factor SPF27 1.60e-06 2.86e-05 NA
2. P Q07732 Accumulates dyads protein 3 1.27e-06 1.75e-04 NA
2. P Q10006 Uncharacterized protein hal-3 1.21e-07 1.30e-04 NA
2. P O42657 GRIP and coiled-coil domain-containing protein C27D7.02c 1.22e-05 2.22e-02 NA
2. P Q9CZX2 Centrosomal protein of 89 kDa 4.20e-06 7.36e-04 NA
2. P O14645 Axonemal dynein light intermediate polypeptide 1 1.21e-06 5.95e-05 NA
2. P A0JNH6 Coiled-coil domain-containing protein 102A 4.32e-06 7.03e-03 NA
2. P P53367 Arfaptin-1 1.42e-06 1.20e-02 NA
2. P Q9CQU5 ZW10 interactor 1.07e-05 8.97e-04 NA
2. P F7BHS0 Multicilin 7.17e-04 2.45e-02 NA
2. P Q6GN86 Axonemal dynein light intermediate polypeptide 1 1.23e-04 9.79e-04 NA
2. P Q5JMK6 Basic leucine zipper 6 2.40e-05 1.66e-02 NA
2. P Q9CR92 Coiled-coil domain-containing protein 96 1.63e-06 7.93e-06 NA
2. P Q9LZD7 Mediator of RNA polymerase II transcription subunit 7b 1.22e-03 4.94e-02 NA
2. P Q8TC20 Cancer-associated gene 1 protein 5.52e-06 2.97e-07 NA
2. P Q4R7G2 Centromere protein Q 7.89e-04 1.42e-07 NA
2. P A6ZW01 Spindle pole component BBP1 3.47e-05 1.54e-09 NA
2. P C5E000 Biogenesis of lysosome-related organelles complex 1 subunit KXD1 2.96e-04 3.14e-02 NA
2. P F4IK01 AUGMIN subunit 1 7.65e-09 4.66e-02 NA
2. P Q04359 Sporulation-specific protein 20 1.24e-06 4.35e-02 NA
2. P Q8TFH5 Meiotically up-regulated protein PB17E12.09 6.73e-05 2.50e-11 NA
2. P Q4V8G7 Centromere protein U 2.96e-06 4.27e-04 NA
2. P Q2KJD6 Endosome-associated-trafficking regulator 1 1.66e-06 2.75e-12 NA
2. P A8NJZ7 Short coiled-coil protein homolog 1.61e-03 2.63e-05 NA
2. P O94656 Autophagy protein 16 4.26e-05 4.57e-02 NA
2. P Q94AV5 WPP domain-interacting protein 3 1.09e-03 4.57e-02 NA
2. P G5ECG0 Transforming acid coiled-coil-containing protein 1 3.22e-07 2.60e-06 NA
2. P Q6GNW0 Leucine-rich repeat flightless-interacting protein 2 1.33e-03 4.28e-05 NA
2. P Q2Z1W2 Centromere protein U 2.85e-06 2.54e-11 NA
2. P Q6BHF8 Autophagy-related protein 23 2.70e-04 4.80e-02 NA
2. P Q8N6V9 Testis-expressed protein 9 1.09e-07 7.58e-14 NA
2. P O64584 WPP domain-associated protein 1.30e-04 1.38e-02 NA
2. P Q96A19 Coiled-coil domain-containing protein 102A 6.00e-07 1.91e-02 NA
2. P Q9WUU8 TNFAIP3-interacting protein 1 6.89e-07 6.27e-03 NA
2. P Q96CS2 HAUS augmin-like complex subunit 1 8.14e-10 2.56e-03 NA
2. P Q8TD10 Mirror-image polydactyly gene 1 protein 2.57e-07 7.69e-04 NA
2. P Q0CK31 Mediator of RNA polymerase II transcription subunit 7 1.91e-03 3.96e-03 NA
2. P P38313 Inner kinetochore subunit AME1 7.26e-05 1.21e-09 NA
2. P Q84VY2 Protein NETWORKED 4B 4.50e-07 4.48e-02 NA
2. P P35416 Paramyosin, short form 1.05e-04 2.09e-07 NA
2. P C8ZIC3 Spindle pole component BBP1 2.14e-05 1.37e-09 NA
2. P Q5PQS2 Protein ZNF365 4.72e-07 1.82e-02 NA
2. P U3H042 Kinetochore protein Sos7 1.91e-06 2.38e-06 NA
2. P Q7SXE4 Golgin subfamily A member 5 1.21e-03 6.31e-05 NA
2. P B9DGI8 Basic leucine zipper 63 1.11e-03 1.31e-02 NA
2. P Q5PPY2 BLOC-1-related complex subunit 5 3.82e-06 4.31e-02 NA
2. P Q8BQP8 Rab11 family-interacting protein 4 5.48e-06 1.58e-04 NA
2. P P10333 Accessory gland-specific peptide 26Aa 1.05e-04 4.04e-04 NA
2. P Q8CFC9 Leucine zipper putative tumor suppressor 1 4.64e-05 1.48e-03 NA
2. P Q5PYI0 Troponin I, cardiac muscle 1.10e-03 9.87e-03 NA
2. P P06163 Phosphoprotein NA 4.70e-02 NA
2. P Q8C4M7 Centromere protein U 1.25e-05 1.33e-02 NA
2. P A2CE83 Endosome-associated-trafficking regulator 1 1.65e-06 3.06e-14 NA
2. P Q5AEN6 Mediator of RNA polymerase II transcription subunit 7 9.26e-04 1.31e-02 NA
2. P A3LZW1 Mediator of RNA polymerase II transcription subunit 7 4.78e-04 7.79e-05 NA
2. P O55722 Uncharacterized protein 101L NA 1.53e-02 NA
2. P O08970 Tuftelin 4.24e-06 9.18e-07 NA
2. P Q95JI9 Coiled-coil domain-containing protein 89 8.54e-09 6.81e-03 NA
2. P Q920D3 Mediator of RNA polymerase II transcription subunit 28 3.58e-05 2.96e-02 NA
2. P Q71F23 Centromere protein U 6.81e-06 1.03e-02 NA
2. P Q6CT76 Mediator of RNA polymerase II transcription subunit 21 1.25e-04 1.65e-03 NA
2. P Q9D845 Testis-expressed protein 9 6.82e-07 3.60e-11 NA
2. P P08552 Neurofilament medium polypeptide (Fragment) 2.15e-07 4.35e-03 NA
2. P Q9Y228 TRAF3-interacting JNK-activating modulator 7.15e-05 6.68e-06 NA
2. P A2AIW0 Endosome-associated-trafficking regulator 1 1.62e-06 8.04e-04 NA
2. P P33736 Accessory gland-specific peptide 26Aa 4.76e-06 1.70e-03 NA
2. P Q9GYV5 NF-kappa-B essential modulator 1.48e-04 1.25e-02 NA
2. P B3LKH7 Spindle pole component BBP1 1.25e-05 1.37e-09 NA
2. P Q5BK57 HAUS augmin-like complex subunit 8 6.05e-05 2.22e-04 NA
2. P P40091 Protein PEA2 8.73e-07 3.76e-05 NA
2. P P22044 Phosphoprotein NA 8.68e-04 NA
2. P Q8TBZ0 Coiled-coil domain-containing protein 110 1.60e-04 1.96e-03 NA
2. P Q75AV2 Mediator of RNA polymerase II transcription subunit 7 8.62e-04 1.61e-05 NA
2. P Q9ZSZ8 FKBP12-interacting protein of 37 kDa 3.08e-06 1.44e-02 NA
2. P Q08AV7 Coiled-coil domain-containing protein 69-B 1.75e-06 5.22e-04 NA
2. P Q95JR0 Cancer-associated gene 1 protein homolog 2.20e-04 6.81e-03 NA
2. P Q2UHU3 Mediator of RNA polymerase II transcription subunit 7 4.51e-03 5.59e-03 NA
2. P A1L3H4 Biogenesis of lysosome-related organelles complex 1 subunit 5 1.09e-06 1.13e-02 NA
2. P Q28GJ0 Endosome-associated-trafficking regulator 1 7.70e-07 2.33e-21 NA
2. P Q26630 33 kDa inner dynein arm light chain, axonemal 2.75e-06 8.40e-04 NA
2. P Q32LE2 G kinase-anchoring protein 1 1.32e-05 2.40e-03 NA
2. P Q8TBA6 Golgin subfamily A member 5 1.49e-04 5.09e-03 NA
2. P Q8C0G2 TRAF3-interacting JNK-activating modulator 7.10e-06 1.51e-03 NA
2. P Q07427 Keratin, type I cytoskeletal 18 8.35e-07 2.36e-02 NA
2. P A8WUP2 Zygote defective protein 12 3.20e-05 4.61e-02 NA
2. P Q6GNT7 Golgin subfamily A member 5 3.41e-04 2.25e-05 NA
2. P Q8IQQ4 RAB6-interacting golgin 7.72e-05 1.68e-02 NA
2. P A2QWI7 Mediator of RNA polymerase II transcription subunit 7 1.41e-03 6.81e-04 NA
2. P A7TDM3 Spindle pole component BBP1 4.29e-06 2.09e-08 NA
2. P Q9EPM5 Syncoilin 4.52e-08 2.76e-06 NA
2. P B3MNR6 Protein hook 4.03e-05 3.47e-02 NA
2. P Q9Y608 Leucine-rich repeat flightless-interacting protein 2 1.31e-05 4.72e-04 NA
2. P Q8IZU3 Synaptonemal complex protein 3 9.20e-09 5.25e-03 NA
2. P Q5BH90 Autophagy protein 16 3.50e-10 4.94e-04 NA
2. P O94643 Inner kinetochore subunit mis17 4.87e-05 5.65e-03 NA
2. P Q9HDT8 UPF0612 protein P20C8.01c 6.63e-07 1.30e-03 NA
2. P Q9QYE6 Golgin subfamily A member 5 7.52e-04 1.15e-03 NA
2. P P19717 Phosphoprotein NA 4.04e-03 NA
2. P P34606 Uncharacterized protein ZK1098.6 2.65e-09 1.12e-03 NA
2. P Q755J5 Spindle pole component BBP1 5.02e-04 2.48e-05 NA
2. P Q8BVM7 Flagellum-associated coiled-coil domain-containing protein 1 1.65e-06 1.56e-02 NA
2. P P33308 Mediator of RNA polymerase II transcription subunit 9 7.70e-03 8.13e-04 NA
2. P P58500 MAP3K7 C-terminal-like protein 3.97e-04 3.99e-05 NA
2. P Q6CP69 Mediator of RNA polymerase II transcription subunit 7 3.50e-03 1.80e-02 NA
2. P E7QA20 Spindle pole component BBP1 4.39e-06 1.22e-09 NA
2. P Q9VGG6 Putative inner dynein arm light chain, axonemal 8.96e-06 2.28e-05 NA
2. P C5DBV2 Spindle pole component BBP1 1.85e-06 1.42e-08 NA
2. P Q9MA75 Transcription factor VIP1 5.63e-04 2.75e-04 NA
2. P Q66HB6 Cancer-associated gene 1 protein homolog 1.32e-05 5.07e-08 NA
2. P P90970 Golgin-84 4.03e-06 2.53e-02 NA
2. P P33737 Accessory gland-specific peptide 26Aa 2.54e-05 2.42e-05 NA
2. P Q9BXU0 Testis-expressed protein 12 2.31e-05 2.11e-02 NA
3. B P70194 C-type lectin domain family 4 member F 1.49e-06 NA 0.032