Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q9CVN6
(Protein chibby homolog 3) with a FATCAT P-Value: 1.11e-05 and RMSD of 4.01 angstrom. The sequence alignment identity is 53.9%.
Structural alignment shown in left. Query protein A6NI87 colored as red in alignment, homolog Q9CVN6 colored as blue.
Query protein A6NI87 is also shown in right top, homolog Q9CVN6 showed in right bottom. They are colored based on secondary structures.
A6NI87 -----M-WA-SRDHLPEPDLG-----DAAPPGSPSSFWTSGLPRQERSTSRQRSRGSPSSTCVPYKVHALATFECSATSHASRLWQTLQQFWADHISRPF 88 Q9CVN6 MADSKMKWGQAWD----SSLGTATTSSSSATGSPSPFQNIRVP----DT-R-----APR---VAHTTFTLEAFECLAASQAGRLWKQVRQFWVDHFSRRF 83 A6NI87 SPRRPPLRRMPSLSTFYLLDHNTRQAELGLAYGAPCMRLSNQAFVFRGGRWTTESQLARTRSPLLSRTAWGWKAQVQRSKSQVLLEENNYLKLQQELLID 188 Q9CVN6 SPRRPPLRHISSMSTFYLLDHRTRQAELGLNYGEPRTRLSDEAFVFRGGRWTPEGKRASARTPLPSSTIPAWKPQVQPIKSQVLLEENNYLKLQQELLMD 183 A6NI87 MLTETMARMHLLEKQRNPEVIPTAAARAGQRKMRKRAGASAGVLMIQPCALDSQ 242 Q9CVN6 MLTETTARMQLLEKKVDADNNPAAPARSWKRKMPKQRG--AGVLIIQPRALESR 235
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0008013 | beta-catenin binding |
| 1. PB | GO:0045444 | fat cell differentiation |
| 1. PB | GO:0033504 | floor plate development |
| 1. PB | GO:0090090 | negative regulation of canonical Wnt signaling pathway |
| 1. PB | GO:0008104 | protein localization |
| 1. PB | GO:0051289 | protein homotetramerization |
| 1. PB | GO:0030030 | cell projection organization |
| 1. PB | GO:0016607 | nuclear speck |
| 1. PB | GO:0005802 | trans-Golgi network |
| 1. PB | GO:0030178 | negative regulation of Wnt signaling pathway |
| 1. PB | GO:0042802 | identical protein binding |
| 1. PB | GO:0045892 | negative regulation of transcription, DNA-templated |
| 1. PB | GO:0060271 | cilium assembly |
| 1. PB | GO:0005814 | centriole |
| 1. PB | GO:0036064 | ciliary basal body |
| 1. PB | GO:0055007 | cardiac muscle cell differentiation |
| 1. PB | GO:0042803 | protein homodimerization activity |
| 2. P | GO:0016239 | positive regulation of macroautophagy |
| 2. P | GO:1902902 | negative regulation of autophagosome assembly |
| 2. P | GO:0009651 | response to salt stress |
| 2. P | GO:0031385 | regulation of termination of mating projection growth |
| 2. P | GO:0017069 | snRNA binding |
| 2. P | GO:0009908 | flower development |
| 2. P | GO:0005933 | cellular bud |
| 2. P | GO:0005935 | cellular bud neck |
| 2. P | GO:0000133 | polarisome |
| 2. P | GO:0032880 | regulation of protein localization |
| 2. P | GO:0009909 | regulation of flower development |
| 2. P | GO:0007118 | budding cell apical bud growth |
| 2. P | GO:0032456 | endocytic recycling |
| 2. P | GO:0031384 | regulation of initiation of mating projection growth |
| 2. P | GO:0007124 | pseudohyphal growth |
| 2. P | GO:0055037 | recycling endosome |
| 2. P | GO:0030010 | establishment of cell polarity |
| 2. P | GO:0061635 | regulation of protein complex stability |
| 2. P | GO:0043332 | mating projection tip |
| 2. P | GO:0007121 | bipolar cellular bud site selection |
| 2. P | GO:2000251 | positive regulation of actin cytoskeleton reorganization |
| 2. P | GO:0030447 | filamentous growth |
| 2. P | GO:0004861 | cyclin-dependent protein serine/threonine kinase inhibitor activity |
| 2. P | GO:0005634 | nucleus |
| 2. P | GO:0045736 | negative regulation of cyclin-dependent protein serine/threonine kinase activity |
| 2. P | GO:0000131 | incipient cellular bud site |
| 2. P | GO:0005934 | cellular bud tip |
| 2. P | GO:0097322 | 7SK snRNA binding |
| 2. P | GO:0045724 | positive regulation of cilium assembly |
| 2. P | GO:1903566 | positive regulation of protein localization to cilium |
| 2. P | GO:0032465 | regulation of cytokinesis |
| 3. B | GO:0031410 | cytoplasmic vesicle |
| 3. B | GO:0042995 | cell projection |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q9D1C2 | Protein chibby homolog 1 | 2.46e-05 | 1.21e-02 | 2.57e-21 |
| 1. PB | Q8MJK1 | Protein chibby homolog 1 | 1.77e-05 | 1.29e-02 | 6.52e-21 |
| 1. PB | A6NI87 | Protein chibby homolog 3 | 0 | 1.82e-125 | 1.37e-179 |
| 1. PB | Q8K4I6 | Protein chibby homolog 1 | 4.98e-05 | 8.35e-03 | 2.92e-21 |
| 1. PB | Q9CVN6 | Protein chibby homolog 3 | 1.11e-05 | 1.57e-21 | 4.48e-77 |
| 2. P | Q3TVI4 | Protein HEXIM2 | 1.50e-03 | 3.03e-04 | NA |
| 2. P | Q6TYB5 | Fasciculation and elongation protein zeta-2 | 1.64e-02 | 3.26e-02 | NA |
| 2. P | Q9UIL1 | Short coiled-coil protein | 8.65e-03 | 1.11e-03 | NA |
| 2. P | P40091 | Protein PEA2 | 3.88e-02 | 3.13e-02 | NA |
| 2. P | Q6K678 | Protein HEADING DATE REPRESSOR 1 | 7.18e-03 | 4.06e-03 | NA |
| 2. P | Q8S9N6 | Homeobox-leucine zipper protein ATHB-17 | 2.48e-02 | 4.61e-03 | NA |
| 2. P | B8AE37 | Protein HEADING DATE REPRESSOR 1 | 1.71e-03 | 4.06e-03 | NA |
| 2. P | A2CE83 | Endosome-associated-trafficking regulator 1 | 6.30e-03 | 1.11e-02 | NA |
| 3. B | Q8NA61 | Protein chibby homolog 2 | 1.90e-02 | NA | 2.74e-04 |
| 3. B | Q6AXV6 | Protein chibby homolog 2 | 8.38e-02 | NA | 6.68e-04 |
| 3. B | Q95JK3 | Protein chibby homolog 2 | 2.56e-02 | NA | 1.50e-04 |
| 3. B | A6QQS3 | Protein chibby homolog 2 | 7.54e-02 | NA | 0.010 |
| 3. B | Q32MG2 | Protein chibby homolog 2 | 3.20e-02 | NA | 1.80e-04 |
| 3. B | Q9Y3M2 | Protein chibby homolog 1 | 8.44e-05 | NA | 2.17e-20 |