Results | PROST

Summary

A6NIK2

Homolog: Q5BKY1.
Function: Leucine-rich repeat-containing protein 10.

Statistics

Total GO Annotation: 621
Unique PROST Go: 132
Unique BLAST Go: 408

Total Homologs: 765
Unique PROST Homologs: 153
Unique BLAST Homologs: 529

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q5BKY1 (Leucine-rich repeat-containing protein 10) with a FATCAT P-Value: 0.0 and RMSD of 1.89 angstrom. The sequence alignment identity is 38.6%.
Structural alignment shown in left. Query protein A6NIK2 colored as red in alignment, homolog Q5BKY1 colored as blue. Query protein A6NIK2 is also shown in right top, homolog Q5BKY1 showed in right bottom. They are colored based on secondary structures.

  A6NIK2 MGIAESTPDEL----PSD-----AEEQLRSG--DQQLELSGRRLRRLPSAVCALSRLQKLYVSGTGLRELPEEIEELRELRILALDFNKLERLPDGLCRL 89
  Q5BKY1 MG---NTIRALVAFIPADRCQNYVVRDLREMPLDKMVDLSGSQLRRFPLHVCSFRELVKLYLSDNHLNSLPPELGQLQNLQILALDFNNFKALPQVVCTL 97

  A6NIK2 PRLTRLYLGGNRLLALPADFAQLQSLRCLWIEGNFLRRFPRPLLRLVALQSLQMGDNRLRALPAELPRMTGLRGLWLYGNRFEEFPPALLRMGRLHILDL 189
  Q5BKY1 KQLCILYLGNNKLCDLPSELSLLQNLRTLWIEANCLTQLPDVVCELSLLKTLHAGSNALRLLPGQLRRLQELRTIWLSGNRLTDFPTVLLHMPFLEVIDV 197

  A6NIK2 DRNRLGGFPDL-HPLRALRVFSYDHNPVTGPPRVADTVFLVGEGAVERMAERDEPTPRPPPRRPAR--AFEDEEEEDL-----LIGGAGSRALGAPGGSF 281
  Q5BKY1 DWNSIRYFPSLAH-LSSLKLVIYDHNPCRNAPKVAKGVRRVG-----RWAEE---TPEPDPRK-ARRYALVREESQELQAPVPLLPPTNS---------- 277

  A6NIK2 RALEAAPGLGT 292
  Q5BKY1 ----------- 277

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0043198	dendritic shaft
1. PB	GO:1901970	positive regulation of mitotic sister chromatid separation
1. PB	GO:0038131	neuregulin receptor activity
1. PB	GO:0002718	regulation of cytokine production involved in immune response
1. PB	GO:0007409	axonogenesis
1. PB	GO:0030517	negative regulation of axon extension
1. PB	GO:0002091	negative regulation of receptor internalization
1. PB	GO:0031430	M band
1. PB	GO:0030426	growth cone
1. PB	GO:0032729	positive regulation of interferon-gamma production
1. PB	GO:0035025	positive regulation of Rho protein signal transduction
1. PB	GO:0099060	integral component of postsynaptic specialization membrane
1. PB	GO:0048495	Roundabout binding
1. PB	GO:0060076	excitatory synapse
1. PB	GO:0005615	extracellular space
1. PB	GO:0009986	cell surface
1. PB	GO:0007165	signal transduction
1. PB	GO:0099061	integral component of postsynaptic density membrane
1. PB	GO:0004722	protein serine/threonine phosphatase activity
1. PB	GO:0050919	negative chemotaxis
1. PB	GO:0050808	synapse organization
1. PB	GO:0098978	glutamatergic synapse
1. PB	GO:0055013	cardiac muscle cell development
1. PB	GO:0052083	suppression by symbiont of host cell-mediated immune response
1. PB	GO:0010977	negative regulation of neuron projection development
1. PB	GO:0070062	extracellular exosome
1. PB	GO:0046813	receptor-mediated virion attachment to host cell
1. PB	GO:0050431	transforming growth factor beta binding
1. PB	GO:0043231	intracellular membrane-bounded organelle
1. PB	GO:1905573	ganglioside GM1 binding
1. PB	GO:0032728	positive regulation of interferon-beta production
1. PB	GO:0035418	protein localization to synapse
1. PB	GO:0060348	bone development
1. PB	GO:1905606	regulation of presynapse assembly
1. PB	GO:1905576	ganglioside GT1b binding
1. PB	GO:0022038	corpus callosum development
1. PB	GO:0044074	negative regulation by symbiont of host translation
1. PB	GO:0005614	interstitial matrix
1. PB	GO:0043547	positive regulation of GTPase activity
1. PB	GO:0007411	axon guidance
1. PB	GO:0030500	regulation of bone mineralization
1. PB	GO:0010544	negative regulation of platelet activation
1. PB	GO:1900155	negative regulation of bone trabecula formation
1. PB	GO:0035197	siRNA binding
1. PB	GO:1901398	regulation of transforming growth factor beta3 activation
1. PB	GO:0043236	laminin binding
1. PB	GO:0044295	axonal growth cone
1. PB	GO:0038187	pattern recognition receptor activity
1. PB	GO:0032727	positive regulation of interferon-alpha production
1. PB	GO:0007249	I-kappaB kinase/NF-kappaB signaling
1. PB	GO:1903124	negative regulation of thioredoxin peroxidase activity
1. PB	GO:0002224	toll-like receptor signaling pathway
1. PB	GO:0031012	extracellular matrix
1. PB	GO:0005518	collagen binding
1. PB	GO:0008201	heparin binding
1. PB	GO:0001968	fibronectin binding
1. PB	GO:0099055	integral component of postsynaptic membrane
1. PB	GO:0043204	perikaryon
1. PB	GO:0007155	cell adhesion
1. PB	GO:0023041	neuronal signal transduction
1. PB	GO:0031362	anchored component of external side of plasma membrane
1. PB	GO:0046696	lipopolysaccharide receptor complex
1. PB	GO:0098982	GABA-ergic synapse
1. PB	GO:0048681	negative regulation of axon regeneration
1. PB	GO:1901388	regulation of transforming growth factor beta activation
1. PB	GO:0051393	alpha-actinin binding
1. PB	GO:0030254	protein secretion by the type III secretion system
1. PB	GO:0051965	positive regulation of synapse assembly
1. PB	GO:0098868	bone growth
1. PB	GO:1903077	negative regulation of protein localization to plasma membrane
1. PB	GO:0062009	secondary palate development
1. PB	GO:0099151	regulation of postsynaptic density assembly
1. PB	GO:0003779	actin binding
1. PB	GO:0062023	collagen-containing extracellular matrix
1. PB	GO:0004888	transmembrane signaling receptor activity
1. PB	GO:0010811	positive regulation of cell-substrate adhesion
1. PB	GO:0042060	wound healing
1. PB	GO:0007596	blood coagulation
1. PB	GO:0035374	chondroitin sulfate binding
1. PB	GO:0035640	exploration behavior
1. PB	GO:0030017	sarcomere
2. P	GO:0021540	corpus callosum morphogenesis
2. P	GO:0021766	hippocampus development
2. P	GO:0005874	microtubule
2. P	GO:0050729	positive regulation of inflammatory response
2. P	GO:0006404	RNA import into nucleus
2. P	GO:0051932	synaptic transmission, GABAergic
2. P	GO:0005686	U2 snRNP
2. P	GO:0002237	response to molecule of bacterial origin
2. P	GO:0045121	membrane raft
2. P	GO:0090090	negative regulation of canonical Wnt signaling pathway
2. P	GO:0048874	host-mediated regulation of intestinal microbiota composition
2. P	GO:0005619	ascospore wall
2. P	GO:0030424	axon
2. P	GO:0042043	neurexin family protein binding
2. P	GO:0085032	modulation by symbiont of host I-kappaB kinase/NF-kappaB cascade
2. P	GO:0000389	mRNA 3'-splice site recognition
2. P	GO:0015459	potassium channel regulator activity
2. P	GO:0140059	dendrite arborization
2. P	GO:1902350	cellular response to chloroquine
2. P	GO:0039513	suppression by virus of host catalytic activity
2. P	GO:0003431	growth plate cartilage chondrocyte development
2. P	GO:0090497	mesenchymal cell migration
2. P	GO:0004842	ubiquitin-protein transferase activity
2. P	GO:0030620	U2 snRNA binding
2. P	GO:0045504	dynein heavy chain binding
2. P	GO:0009897	external side of plasma membrane
2. P	GO:0016200	synaptic target attraction
2. P	GO:0014005	microglia development
2. P	GO:0050871	positive regulation of B cell activation
2. P	GO:0006954	inflammatory response
2. P	GO:0035583	sequestering of TGFbeta in extracellular matrix
2. P	GO:0033344	cholesterol efflux
2. P	GO:0005815	microtubule organizing center
2. P	GO:0005154	epidermal growth factor receptor binding
2. P	GO:0030318	melanocyte differentiation
2. P	GO:0043005	neuron projection
2. P	GO:0006801	superoxide metabolic process
2. P	GO:0008076	voltage-gated potassium channel complex
2. P	GO:0036157	outer dynein arm
2. P	GO:0042995	cell projection
2. P	GO:0039517	modulation by virus of host protein serine/threonine phosphatase activity
2. P	GO:0010921	regulation of phosphatase activity
2. P	GO:0071805	potassium ion transmembrane transport
2. P	GO:0008203	cholesterol metabolic process
2. P	GO:0021670	lateral ventricle development
2. P	GO:0098793	presynapse
2. P	GO:0042635	positive regulation of hair cycle
2. P	GO:0034055	effector-mediated induction of programmed cell death in host
2. P	GO:0038023	signaling receptor activity
2. P	GO:0045671	negative regulation of osteoclast differentiation
2. P	GO:0044164	host cell cytosol
2. P	GO:0070840	dynein complex binding
2. P	GO:0005783	endoplasmic reticulum
2. P	GO:0002730	regulation of dendritic cell cytokine production
2. P	GO:0071005	U2-type precatalytic spliceosome
2. P	GO:0030890	positive regulation of B cell proliferation
2. P	GO:0061073	ciliary body morphogenesis
2. P	GO:0006913	nucleocytoplasmic transport
2. P	GO:0050921	positive regulation of chemotaxis
2. P	GO:0034162	toll-like receptor 9 signaling pathway
2. P	GO:0071013	catalytic step 2 spliceosome
2. P	GO:0040022	feminization of hermaphroditic germ-line
2. P	GO:0032911	negative regulation of transforming growth factor beta1 production
2. P	GO:0005856	cytoskeleton
2. P	GO:0051729	germline cell cycle switching, mitotic to meiotic cell cycle
2. P	GO:0099104	potassium channel activator activity
2. P	GO:0060291	long-term synaptic potentiation
2. P	GO:0021960	anterior commissure morphogenesis
2. P	GO:0036364	transforming growth factor beta1 activation
2. P	GO:0060122	inner ear receptor cell stereocilium organization
2. P	GO:0030430	host cell cytoplasm
2. P	GO:0060760	positive regulation of response to cytokine stimulus
2. P	GO:0007179	transforming growth factor beta receptor signaling pathway
2. P	GO:0044314	protein K27-linked ubiquitination
2. P	GO:0036158	outer dynein arm assembly
2. P	GO:0016363	nuclear matrix
2. P	GO:0019834	phospholipase A2 inhibitor activity
2. P	GO:0043486	histone exchange
2. P	GO:1903818	positive regulation of voltage-gated potassium channel activity
2. P	GO:0071014	post-mRNA release spliceosomal complex
2. P	GO:1904761	negative regulation of myofibroblast differentiation
2. P	GO:0036019	endolysosome
2. P	GO:0044325	transmembrane transporter binding
2. P	GO:0048539	bone marrow development
2. P	GO:0002218	activation of innate immune response
2. P	GO:0031103	axon regeneration
2. P	GO:0007166	cell surface receptor signaling pathway
2. P	GO:0045322	unmethylated CpG binding
2. P	GO:0098685	Schaffer collateral - CA1 synapse
2. P	GO:0043010	camera-type eye development
2. P	GO:0019212	phosphatase inhibitor activity
2. P	GO:0009277	fungal-type cell wall
2. P	GO:0005681	spliceosomal complex
2. P	GO:0071004	U2-type prespliceosome
2. P	GO:0022414	reproductive process
2. P	GO:0038008	TRAF-mediated signal transduction
2. P	GO:0042393	histone binding
2. P	GO:0043014	alpha-tubulin binding
2. P	GO:0030286	dynein complex
2. P	GO:0048471	perinuclear region of cytoplasm
2. P	GO:0032741	positive regulation of interleukin-18 production
2. P	GO:0090009	primitive streak formation
2. P	GO:0042632	cholesterol homeostasis
2. P	GO:0000398	mRNA splicing, via spliceosome
2. P	GO:0030178	negative regulation of Wnt signaling pathway
2. P	GO:0043410	positive regulation of MAPK cascade
2. P	GO:0097009	energy homeostasis
2. P	GO:0005618	cell wall
2. P	GO:0052170	suppression by symbiont of host innate immune response
2. P	GO:0002639	positive regulation of immunoglobulin production
2. P	GO:0031225	anchored component of membrane
2. P	GO:0032009	early phagosome
2. P	GO:0042981	regulation of apoptotic process
2. P	GO:0030532	small nuclear ribonucleoprotein complex
2. P	GO:0002755	MyD88-dependent toll-like receptor signaling pathway
2. P	GO:0071007	U2-type catalytic step 2 spliceosome
2. P	GO:0042025	host cell nucleus
2. P	GO:0000812	Swr1 complex
2. P	GO:0002177	manchette
2. P	GO:0034165	positive regulation of toll-like receptor 9 signaling pathway
2. P	GO:0015630	microtubule cytoskeleton
2. P	GO:0031505	fungal-type cell wall organization
2. P	GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway
2. P	GO:0015631	tubulin binding
2. P	GO:0046658	anchored component of plasma membrane
2. P	GO:0045577	regulation of B cell differentiation
2. P	GO:0098686	hippocampal mossy fiber to CA3 synapse
2. P	GO:0039644	suppression by virus of host NF-kappaB cascade
2. P	GO:0005249	voltage-gated potassium channel activity
2. P	GO:0008355	olfactory learning
2. P	GO:0034163	regulation of toll-like receptor 9 signaling pathway
2. P	GO:0043326	chemotaxis to folate
3. B	GO:0003345	proepicardium cell migration involved in pericardium morphogenesis
3. B	GO:0030198	extracellular matrix organization
3. B	GO:0010449	root meristem growth
3. B	GO:0010555	response to mannitol
3. B	GO:0030014	CCR4-NOT complex
3. B	GO:0042277	peptide binding
3. B	GO:0009729	detection of brassinosteroid stimulus
3. B	GO:0016080	synaptic vesicle targeting
3. B	GO:0009556	microsporogenesis
3. B	GO:0044300	cerebellar mossy fiber
3. B	GO:0090141	positive regulation of mitochondrial fission
3. B	GO:0046007	negative regulation of activated T cell proliferation
3. B	GO:0070848	response to growth factor
3. B	GO:0005589	collagen type VI trimer
3. B	GO:0055046	microgametogenesis
3. B	GO:0004706	JUN kinase kinase kinase activity
3. B	GO:0090037	positive regulation of protein kinase C signaling
3. B	GO:2001013	epithelial cell proliferation involved in renal tubule morphogenesis
3. B	GO:0006368	transcription elongation from RNA polymerase II promoter
3. B	GO:0005201	extracellular matrix structural constituent
3. B	GO:0007089	traversing start control point of mitotic cell cycle
3. B	GO:1903217	negative regulation of protein processing involved in protein targeting to mitochondrion
3. B	GO:0005796	Golgi lumen
3. B	GO:0070052	collagen V binding
3. B	GO:0099147	extrinsic component of postsynaptic density membrane
3. B	GO:0006884	cell volume homeostasis
3. B	GO:0043615	astrocyte cell migration
3. B	GO:0010640	regulation of platelet-derived growth factor receptor signaling pathway
3. B	GO:0061161	positive regulation of establishment of bipolar cell polarity regulating cell shape
3. B	GO:0005095	GTPase inhibitor activity
3. B	GO:0036360	sorocarp stalk morphogenesis
3. B	GO:0030539	male genitalia development
3. B	GO:0048281	inflorescence morphogenesis
3. B	GO:0001964	startle response
3. B	GO:0060026	convergent extension
3. B	GO:0010069	zygote asymmetric cytokinesis in embryo sac
3. B	GO:0060412	ventricular septum morphogenesis
3. B	GO:0015734	taurine transport
3. B	GO:0071470	cellular response to osmotic stress
3. B	GO:0090406	pollen tube
3. B	GO:0030021	extracellular matrix structural constituent conferring compression resistance
3. B	GO:0045663	positive regulation of myoblast differentiation
3. B	GO:1904417	positive regulation of xenophagy
3. B	GO:0010376	stomatal complex formation
3. B	GO:0071672	negative regulation of smooth muscle cell chemotaxis
3. B	GO:0019903	protein phosphatase binding
3. B	GO:0106310	protein serine kinase activity
3. B	GO:0072542	protein phosphatase activator activity
3. B	GO:0010103	stomatal complex morphogenesis
3. B	GO:0016500	protein-hormone receptor activity
3. B	GO:0060628	regulation of ER to Golgi vesicle-mediated transport
3. B	GO:0008330	protein tyrosine/threonine phosphatase activity
3. B	GO:0050732	negative regulation of peptidyl-tyrosine phosphorylation
3. B	GO:0050840	extracellular matrix binding
3. B	GO:0032228	regulation of synaptic transmission, GABAergic
3. B	GO:0043116	negative regulation of vascular permeability
3. B	GO:0007163	establishment or maintenance of cell polarity
3. B	GO:0032474	otolith morphogenesis
3. B	GO:0050896	response to stimulus
3. B	GO:0060581	cell fate commitment involved in pattern specification
3. B	GO:0072282	metanephric nephron tubule morphogenesis
3. B	GO:0016239	positive regulation of macroautophagy
3. B	GO:0007416	synapse assembly
3. B	GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
3. B	GO:0030336	negative regulation of cell migration
3. B	GO:1904027	negative regulation of collagen fibril organization
3. B	GO:0106307
3. B	GO:1904887	Wnt signalosome assembly
3. B	GO:0030054	cell junction
3. B	GO:0048508	embryonic meristem development
3. B	GO:0034052	positive regulation of plant-type hypersensitive response
3. B	GO:0030587	sorocarp development
3. B	GO:0002667	regulation of T cell anergy
3. B	GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
3. B	GO:0045930	negative regulation of mitotic cell cycle
3. B	GO:0002329	pre-B cell differentiation
3. B	GO:0098887	neurotransmitter receptor transport, endosome to postsynaptic membrane
3. B	GO:2000786	positive regulation of autophagosome assembly
3. B	GO:0000076	DNA replication checkpoint signaling
3. B	GO:1902803	regulation of synaptic vesicle transport
3. B	GO:0030534	adult behavior
3. B	GO:0002764	immune response-regulating signaling pathway
3. B	GO:0061975	articular cartilage development
3. B	GO:2001222	regulation of neuron migration
3. B	GO:0010075	regulation of meristem growth
3. B	GO:0010606	positive regulation of cytoplasmic mRNA processing body assembly
3. B	GO:0014041	regulation of neuron maturation
3. B	GO:0045108	regulation of intermediate filament polymerization or depolymerization
3. B	GO:0070100	negative regulation of chemokine-mediated signaling pathway
3. B	GO:0005886	plasma membrane
3. B	GO:1905034	regulation of antifungal innate immune response
3. B	GO:0001768	establishment of T cell polarity
3. B	GO:1903351	cellular response to dopamine
3. B	GO:0044753	amphisome
3. B	GO:0070966	nuclear-transcribed mRNA catabolic process, no-go decay
3. B	GO:0006970	response to osmotic stress
3. B	GO:0030714	anterior/posterior axis specification, follicular epithelium
3. B	GO:0140360	cyclic-GMP-AMP transmembrane transporter activity
3. B	GO:0032588	trans-Golgi network membrane
3. B	GO:0071485	cellular response to absence of light
3. B	GO:0019199	transmembrane receptor protein kinase activity
3. B	GO:0070086	ubiquitin-dependent endocytosis
3. B	GO:0010596	negative regulation of endothelial cell migration
3. B	GO:0016336	establishment or maintenance of polarity of larval imaginal disc epithelium
3. B	GO:0042734	presynaptic membrane
3. B	GO:0050929	induction of negative chemotaxis
3. B	GO:0009934	regulation of meristem structural organization
3. B	GO:0030282	bone mineralization
3. B	GO:0005176	ErbB-2 class receptor binding
3. B	GO:0090548	response to nitrate starvation
3. B	GO:0034142	toll-like receptor 4 signaling pathway
3. B	GO:2000280	regulation of root development
3. B	GO:0034750	Scrib-APC-beta-catenin complex
3. B	GO:0099560	synaptic membrane adhesion
3. B	GO:0007601	visual perception
3. B	GO:0099400	caveola neck
3. B	GO:0030239	myofibril assembly
3. B	GO:0042659	regulation of cell fate specification
3. B	GO:0044403	biological process involved in symbiotic interaction
3. B	GO:1905103	integral component of lysosomal membrane
3. B	GO:0005887	integral component of plasma membrane
3. B	GO:0021972	corticospinal neuron axon guidance through spinal cord
3. B	GO:0009742	brassinosteroid mediated signaling pathway
3. B	GO:0071215	cellular response to abscisic acid stimulus
3. B	GO:0003181	atrioventricular valve morphogenesis
3. B	GO:0045175	basal protein localization
3. B	GO:0030056	hemidesmosome
3. B	GO:0090038	negative regulation of protein kinase C signaling
3. B	GO:0071676	negative regulation of mononuclear cell migration
3. B	GO:0098968	neurotransmitter receptor transport postsynaptic membrane to endosome
3. B	GO:0002689	negative regulation of leukocyte chemotaxis
3. B	GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity
3. B	GO:0004532	exoribonuclease activity
3. B	GO:0051014	actin filament severing
3. B	GO:0035385	Roundabout signaling pathway
3. B	GO:0007502	digestive tract mesoderm development
3. B	GO:0060561	apoptotic process involved in morphogenesis
3. B	GO:0003401	axis elongation
3. B	GO:0005789	endoplasmic reticulum membrane
3. B	GO:0072202	cell differentiation involved in metanephros development
3. B	GO:0048437	floral organ development
3. B	GO:0006952	defense response
3. B	GO:0008157	protein phosphatase 1 binding
3. B	GO:0048243	norepinephrine secretion
3. B	GO:0036020	endolysosome membrane
3. B	GO:0002758	innate immune response-activating signal transduction
3. B	GO:0006171	cAMP biosynthetic process
3. B	GO:0001974	blood vessel remodeling
3. B	GO:0003677	DNA binding
3. B	GO:0051900	regulation of mitochondrial depolarization
3. B	GO:0010088	phloem development
3. B	GO:0040036	regulation of fibroblast growth factor receptor signaling pathway
3. B	GO:0003184	pulmonary valve morphogenesis
3. B	GO:0004672	protein kinase activity
3. B	GO:0043531	ADP binding
3. B	GO:0019800	peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan
3. B	GO:0008528	G protein-coupled peptide receptor activity
3. B	GO:0010067	procambium histogenesis
3. B	GO:0043030	regulation of macrophage activation
3. B	GO:0010148	transpiration
3. B	GO:0010359	regulation of anion channel activity
3. B	GO:0099523	presynaptic cytosol
3. B	GO:0048812	neuron projection morphogenesis
3. B	GO:0060427	lung connective tissue development
3. B	GO:0000188	obsolete inactivation of MAPK activity
3. B	GO:1903980	positive regulation of microglial cell activation
3. B	GO:0042730	fibrinolysis
3. B	GO:0048229	gametophyte development
3. B	GO:0009649	entrainment of circadian clock
3. B	GO:0005583	fibrillar collagen trimer
3. B	GO:0021836	chemorepulsion involved in postnatal olfactory bulb interneuron migration
3. B	GO:0010183	pollen tube guidance
3. B	GO:0070997	neuron death
3. B	GO:0140058	neuron projection arborization
3. B	GO:0010078	maintenance of root meristem identity
3. B	GO:0043928	exonucleolytic catabolism of deadenylated mRNA
3. B	GO:0061290	canonical Wnt signaling pathway involved in metanephric kidney development
3. B	GO:0032495	response to muramyl dipeptide
3. B	GO:0106311
3. B	GO:0098609	cell-cell adhesion
3. B	GO:0014069	postsynaptic density
3. B	GO:0048833	specification of floral organ number
3. B	GO:0060658	nipple morphogenesis
3. B	GO:0033612	receptor serine/threonine kinase binding
3. B	GO:0001818	negative regulation of cytokine production
3. B	GO:0050673	epithelial cell proliferation
3. B	GO:0048683	regulation of collateral sprouting of intact axon in response to injury
3. B	GO:0014912	negative regulation of smooth muscle cell migration
3. B	GO:0016045	detection of bacterium
3. B	GO:0106306
3. B	GO:1900747	negative regulation of vascular endothelial growth factor signaling pathway
3. B	GO:0036335	intestinal stem cell homeostasis
3. B	GO:1903206	negative regulation of hydrogen peroxide-induced cell death
3. B	GO:0034137	positive regulation of toll-like receptor 2 signaling pathway
3. B	GO:0007639	homeostasis of number of meristem cells
3. B	GO:0035970	peptidyl-threonine dephosphorylation
3. B	GO:0005635	nuclear envelope
3. B	GO:0051414	response to cortisol
3. B	GO:1902902	negative regulation of autophagosome assembly
3. B	GO:0010508	positive regulation of autophagy
3. B	GO:0071666	Slit-Robo signaling complex
3. B	GO:0050772	positive regulation of axonogenesis
3. B	GO:0070973	protein localization to endoplasmic reticulum exit site
3. B	GO:0048653	anther development
3. B	GO:0071287	cellular response to manganese ion
3. B	GO:0030374	nuclear receptor coactivator activity
3. B	GO:0090288	negative regulation of cellular response to growth factor stimulus
3. B	GO:0035089	establishment of apical/basal cell polarity
3. B	GO:0043202	lysosomal lumen
3. B	GO:1902499	positive regulation of protein autoubiquitination
3. B	GO:0032968	positive regulation of transcription elongation from RNA polymerase II promoter
3. B	GO:0140361	cyclic-GMP-AMP transmembrane import across plasma membrane
3. B	GO:0031223	auditory behavior
3. B	GO:0051646	mitochondrion localization
3. B	GO:1900140	regulation of seedling development
3. B	GO:0051898	negative regulation of protein kinase B signaling
3. B	GO:0032914	positive regulation of transforming growth factor beta1 production
3. B	GO:0070171	negative regulation of tooth mineralization
3. B	GO:0009506	plasmodesma
3. B	GO:1905289	regulation of CAMKK-AMPK signaling cascade
3. B	GO:0060603	mammary gland duct morphogenesis
3. B	GO:0090263	positive regulation of canonical Wnt signaling pathway
3. B	GO:0045171	intercellular bridge
3. B	GO:0051058	negative regulation of small GTPase mediated signal transduction
3. B	GO:0043069	negative regulation of programmed cell death
3. B	GO:1900744	regulation of p38MAPK cascade
3. B	GO:0071504	cellular response to heparin
3. B	GO:0043237	laminin-1 binding
3. B	GO:0022028	tangential migration from the subventricular zone to the olfactory bulb
3. B	GO:0042567	insulin-like growth factor ternary complex
3. B	GO:1905279	regulation of retrograde transport, endosome to Golgi
3. B	GO:0035308	negative regulation of protein dephosphorylation
3. B	GO:0061809	NAD+ nucleotidase, cyclic ADP-ribose generating
3. B	GO:1901333	positive regulation of lateral root development
3. B	GO:0007190	activation of adenylate cyclase activity
3. B	GO:0090260	negative regulation of retinal ganglion cell axon guidance
3. B	GO:0008543	fibroblast growth factor receptor signaling pathway
3. B	GO:1900244	positive regulation of synaptic vesicle endocytosis
3. B	GO:0048831	regulation of shoot system development
3. B	GO:0035751	regulation of lysosomal lumen pH
3. B	GO:0042562	hormone binding
3. B	GO:0043194	axon initial segment
3. B	GO:0046849	bone remodeling
3. B	GO:0071896	protein localization to adherens junction
3. B	GO:0046777	protein autophosphorylation
3. B	GO:0001942	hair follicle development
3. B	GO:0030859	polarized epithelial cell differentiation
3. B	GO:0005030	neurotrophin receptor activity
3. B	GO:0048846	axon extension involved in axon guidance
3. B	GO:0034702	ion channel complex
3. B	GO:0005737	cytoplasm
3. B	GO:0034144	negative regulation of toll-like receptor 4 signaling pathway
3. B	GO:0048226	Casparian strip
3. B	GO:0009626	plant-type hypersensitive response
3. B	GO:0016020	membrane
3. B	GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
3. B	GO:0016323	basolateral plasma membrane
3. B	GO:0043031	negative regulation of macrophage activation
3. B	GO:0097120	receptor localization to synapse
3. B	GO:0097487	multivesicular body, internal vesicle
3. B	GO:1990523	bone regeneration
3. B	GO:0004535	poly(A)-specific ribonuclease activity
3. B	GO:0070433	negative regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway
3. B	GO:0010234	anther wall tapetum cell fate specification
3. B	GO:0060384	innervation
3. B	GO:0035564	regulation of kidney size
3. B	GO:0004674	protein serine/threonine kinase activity
3. B	GO:0043394	proteoglycan binding
3. B	GO:0048657	anther wall tapetum cell differentiation
3. B	GO:2000405	negative regulation of T cell migration
3. B	GO:0005520	insulin-like growth factor binding
3. B	GO:0010073	meristem maintenance
3. B	GO:1904713	beta-catenin destruction complex binding
3. B	GO:0021772	olfactory bulb development
3. B	GO:0009610	response to symbiotic fungus
3. B	GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process
3. B	GO:1902288	regulation of defense response to oomycetes
3. B	GO:1902025	nitrate import
3. B	GO:0021747	cochlear nucleus development
3. B	GO:1990869	cellular response to chemokine
3. B	GO:0009755	hormone-mediated signaling pathway
3. B	GO:0006470	protein dephosphorylation
3. B	GO:0070831	basement membrane assembly
3. B	GO:0000932	P-body
3. B	GO:0001649	osteoblast differentiation
3. B	GO:0048565	digestive tract development
3. B	GO:0045087	innate immune response
3. B	GO:0035335	peptidyl-tyrosine dephosphorylation
3. B	GO:0010955	negative regulation of protein processing
3. B	GO:0120163	negative regulation of cold-induced thermogenesis
3. B	GO:0071638	negative regulation of monocyte chemotactic protein-1 production
3. B	GO:0031047	gene silencing by RNA
3. B	GO:0032870	cellular response to hormone stimulus
3. B	GO:0046755	viral budding
3. B	GO:0034154	toll-like receptor 7 signaling pathway
3. B	GO:0030015	CCR4-NOT core complex
3. B	GO:0090394	negative regulation of excitatory postsynaptic potential
3. B	GO:0099072	regulation of postsynaptic membrane neurotransmitter receptor levels
3. B	GO:1990909	Wnt signalosome
3. B	GO:0004675	transmembrane receptor protein serine/threonine kinase activity
3. B	GO:0031150	sorocarp stalk development
3. B	GO:0019806	bromide peroxidase activity
3. B	GO:0003180	aortic valve morphogenesis
3. B	GO:0021756	striatum development
3. B	GO:0015810	aspartate transmembrane transport
3. B	GO:0008154	actin polymerization or depolymerization
3. B	GO:0098633	collagen fibril binding
3. B	GO:2000172	regulation of branching morphogenesis of a nerve
3. B	GO:0035748	myelin sheath abaxonal region
3. B	GO:0060159	regulation of dopamine receptor signaling pathway
3. B	GO:0034122	negative regulation of toll-like receptor signaling pathway
3. B	GO:0050918	positive chemotaxis
3. B	GO:1902533	positive regulation of intracellular signal transduction
3. B	GO:0016791	phosphatase activity
3. B	GO:0010080	regulation of floral meristem growth
3. B	GO:0051901	positive regulation of mitochondrial depolarization
3. B	GO:0044754	autolysosome
3. B	GO:0036035	osteoclast development
3. B	GO:0010087	phloem or xylem histogenesis
3. B	GO:0005225	volume-sensitive anion channel activity
3. B	GO:0001678	cellular glucose homeostasis
3. B	GO:0005102	signaling receptor binding
3. B	GO:0045806	negative regulation of endocytosis
3. B	GO:0036289	peptidyl-serine autophosphorylation
3. B	GO:0090696	post-embryonic plant organ development
3. B	GO:0000175	3'-5'-exoribonuclease activity
3. B	GO:0062200	RAM/MOR signaling pathway
3. B	GO:0045197	establishment or maintenance of epithelial cell apical/basal polarity
3. B	GO:0004016	adenylate cyclase activity
3. B	GO:0016335	morphogenesis of larval imaginal disc epithelium
3. B	GO:0050728	negative regulation of inflammatory response
3. B	GO:0048478	replication fork protection
3. B	GO:0035996	rhabdomere microvillus
3. B	GO:0016601	Rac protein signal transduction
3. B	GO:0032185	septin cytoskeleton organization
3. B	GO:0000287	magnesium ion binding
3. B	GO:0010051	xylem and phloem pattern formation
3. B	GO:0061364	apoptotic process involved in luteolysis
3. B	GO:0034136	negative regulation of toll-like receptor 2 signaling pathway
3. B	GO:0009945	radial axis specification
3. B	GO:0090190	positive regulation of branching involved in ureteric bud morphogenesis
3. B	GO:2000067	regulation of root morphogenesis
3. B	GO:0043068	positive regulation of programmed cell death
3. B	GO:0050135	NAD(P)+ nucleosidase activity
3. B	GO:0050807	regulation of synapse organization
3. B	GO:0043408	regulation of MAPK cascade
3. B	GO:0032757	positive regulation of interleukin-8 production
3. B	GO:0007567	parturition
3. B	GO:1902692	regulation of neuroblast proliferation
3. B	GO:0005539	glycosaminoglycan binding
3. B	GO:0001530	lipopolysaccharide binding
3. B	GO:0032584	growth cone membrane
3. B	GO:0090024	negative regulation of neutrophil chemotaxis
3. B	GO:0042592	homeostatic process
3. B	GO:0072224	metanephric glomerulus development
3. B	GO:0051019	mitogen-activated protein kinase binding
3. B	GO:0001921	positive regulation of receptor recycling
3. B	GO:0046328	regulation of JNK cascade
3. B	GO:1905421	regulation of plant organ morphogenesis
3. B	GO:0009994	oocyte differentiation
3. B	GO:0032473	cytoplasmic side of mitochondrial outer membrane
3. B	GO:0140376	innate immune receptor activity
3. B	GO:0016593	Cdc73/Paf1 complex
3. B	GO:0060007	linear vestibuloocular reflex
3. B	GO:0010593	negative regulation of lamellipodium assembly
3. B	GO:0036479	peroxidase inhibitor activity
3. B	GO:0099149	regulation of postsynaptic neurotransmitter receptor internalization
3. B	GO:0050832	defense response to fungus
3. B	GO:0035580	specific granule lumen
3. B	GO:0030154	cell differentiation
3. B	GO:0090708	specification of plant organ axis polarity
3. B	GO:0043113	receptor clustering
3. B	GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening
3. B	GO:0034214	protein hexamerization
3. B	GO:0098656	anion transmembrane transport
3. B	GO:0010070	zygote asymmetric cell division
3. B	GO:0010082	regulation of root meristem growth
3. B	GO:0002093	auditory receptor cell morphogenesis
3. B	GO:0090027	negative regulation of monocyte chemotaxis
3. B	GO:0021562	vestibulocochlear nerve development
3. B	GO:0001932	regulation of protein phosphorylation
3. B	GO:0016331	morphogenesis of embryonic epithelium
3. B	GO:0016021	integral component of membrane
3. B	GO:1903125	negative regulation of thioredoxin peroxidase activity by peptidyl-threonine phosphorylation
3. B	GO:0007252	I-kappaB phosphorylation
3. B	GO:0046579	positive regulation of Ras protein signal transduction
3. B	GO:1901727	positive regulation of histone deacetylase activity
3. B	GO:0001653	peptide receptor activity
3. B	GO:1901528	hydrogen peroxide mediated signaling pathway involved in stomatal movement
3. B	GO:0051302	regulation of cell division
3. B	GO:1903215	negative regulation of protein targeting to mitochondrion
3. B	GO:0045499	chemorepellent activity
3. B	GO:0006820	anion transport
3. B	GO:0031102	neuron projection regeneration
3. B	GO:0030199	collagen fibril organization
3. B	GO:0051016	barbed-end actin filament capping
3. B	GO:0046872	metal ion binding
3. B	GO:0034260	negative regulation of GTPase activity
3. B	GO:1903224	regulation of endodermal cell differentiation
3. B	GO:0060161	positive regulation of dopamine receptor signaling pathway
3. B	GO:0042645	mitochondrial nucleoid
3. B	GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway
3. B	GO:0002238	response to molecule of fungal origin
3. B	GO:0000164	protein phosphatase type 1 complex
3. B	GO:1902823	negative regulation of late endosome to lysosome transport
3. B	GO:0010074	maintenance of meristem identity
3. B	GO:0035239	tube morphogenesis
3. B	GO:0034211	GTP-dependent protein kinase activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	A4IHG1	Leucine-rich repeat-containing protein 58	5.83e-13	1.08e-16	2.78e-16
1. PB	O08770	Platelet glycoprotein V	2.74e-09	1.88e-08	3.24e-09
1. PB	Q65YW8	Tsukushi-A	1.31e-06	4.24e-02	0.018
1. PB	P22194	Protein phosphatase 1 regulatory subunit SDS22	3.46e-13	2.29e-02	0.019
1. PB	Q32NT4	Leucine-rich repeat-containing protein 58	1.72e-12	3.38e-16	1.02e-19
1. PB	Q9D1G5	Leucine-rich repeat-containing protein 57	4.66e-15	1.02e-09	3.71e-12
1. PB	Q99PI8	Reticulon-4 receptor	1.08e-06	1.36e-03	1.30e-06
1. PB	Q8N456	Leucine-rich repeat-containing protein 18	9.74e-08	2.74e-27	1.03e-12
1. PB	Q9CQ76	Nephrocan	2.41e-08	6.57e-11	4.33e-04
1. PB	Q99M75	Reticulon-4 receptor	1.63e-07	5.20e-04	1.96e-04
1. PB	Q9D9Q0	Leucine-rich repeat-containing protein 69	1.09e-11	1.16e-15	8.82e-16
1. PB	O93233	Phospholipase A2 inhibitor	2.21e-12	9.13e-04	0.004
1. PB	Q80VQ1	Leucine-rich repeat-containing protein 1	2.43e-07	4.81e-16	8.87e-19
1. PB	Q5G5D8	Plant intracellular Ras-group-related LRR protein 7	1.30e-09	3.59e-18	1.01e-15
1. PB	A1A4H9	Leucine-rich repeat transmembrane neuronal protein 1	1.41e-06	2.09e-03	1.09e-04
1. PB	A6NM36	Leucine-rich repeat-containing protein 30	5.55e-16	1.18e-02	3.81e-17
1. PB	Q9DBB9	Carboxypeptidase N subunit 2	2.08e-05	1.34e-05	3.12e-13
1. PB	Q8CI70	Leucine-rich repeat-containing protein 20	3.51e-11	8.84e-08	4.59e-05
1. PB	Q5E9C0	Ras suppressor protein 1	9.33e-13	8.30e-28	2.98e-19
1. PB	Q8ZQQ2	E3 ubiquitin-protein ligase SlrP	4.25e-05	6.33e-03	0.004
1. PB	Q9CQ07	Leucine-rich repeat-containing protein 18	7.36e-09	3.73e-31	8.06e-13
1. PB	F1R6I3	Leucine-rich repeat-containing protein 39	7.73e-11	3.06e-08	3.14e-19
1. PB	Q8TF66	Leucine-rich repeat-containing protein 15	4.29e-06	4.62e-07	1.94e-08
1. PB	Q6DHL5	Leucine-rich repeat-containing protein 57	1.49e-14	8.90e-09	2.99e-18
1. PB	O15335	Chondroadherin	3.75e-09	5.94e-03	1.64e-06
1. PB	O55226	Chondroadherin	2.97e-09	1.32e-02	6.23e-07
1. PB	Q9SVM3	Receptor-like protein 49	6.88e-05	1.52e-02	0.006
1. PB	Q86UE6	Leucine-rich repeat transmembrane neuronal protein 1	2.64e-06	5.63e-04	1.06e-04
1. PB	Q3KQF4	Leucine-rich repeat-containing protein 69	2.06e-12	1.23e-12	2.85e-22
1. PB	Q9BTT6	Leucine-rich repeat-containing protein 1	2.25e-07	4.66e-18	6.33e-23
1. PB	Q24K06	Leucine-rich repeat-containing protein 10	0.00e+00	2.16e-38	2.72e-60
1. PB	Q5R6B1	Leucine-rich repeat transmembrane neuronal protein 1	2.67e-06	5.63e-04	4.46e-05
1. PB	O70210	Chondroadherin	2.92e-09	2.02e-03	2.57e-06
1. PB	Q9N0E3	Reticulon-4 receptor	1.13e-06	1.80e-05	4.08e-05
1. PB	P40197	Platelet glycoprotein V	1.07e-05	2.67e-08	2.14e-05
1. PB	Q14392	Transforming growth factor beta activator LRRC32	1.15e-08	1.01e-02	5.64e-05
1. PB	D4A6D8	Leucine-rich repeat transmembrane neuronal protein 1	1.29e-06	8.50e-03	1.79e-04
1. PB	Q8R5M3	Leucine-rich repeat-containing protein 15	3.75e-06	3.87e-06	9.71e-08
1. PB	Q15404	Ras suppressor protein 1	8.85e-13	4.91e-29	2.95e-19
1. PB	Q7Z2Q7	Leucine-rich repeat-containing protein 70	3.05e-06	4.74e-02	7.85e-05
1. PB	Q9Z1S7	Osteomodulin	7.69e-09	1.10e-07	1.58e-04
1. PB	D3ZXS4	Leucine-rich repeat-containing protein 39	1.92e-11	5.24e-06	2.43e-17
1. PB	Q149C3	Leucine-rich repeat and immunoglobulin-like domain containing-NOGO receptor-interacting protein 4	7.94e-04	1.33e-03	3.99e-04
1. PB	P18009	Probable E3 ubiquitin-protein ligase ipaH4.5	1.69e-05	5.89e-05	0.006
1. PB	Q54AX5	Leucine-rich repeat protein lrrA	4.29e-09	1.35e-04	1.67e-13
1. PB	Q7XNY1	Plant intracellular Ras-group-related LRR protein 1	5.18e-09	2.79e-25	2.56e-16
1. PB	D0ZRB2	E3 ubiquitin-protein ligase SlrP	7.13e-05	1.25e-02	0.001
1. PB	B9F655	Plant intracellular Ras-group-related LRR protein 7	8.92e-14	1.08e-16	5.48e-17
1. PB	Q01730	Ras suppressor protein 1	1.27e-12	4.76e-28	3.19e-17
1. PB	Q4R3P6	Leucine-rich repeat-containing protein 40	4.47e-07	2.67e-02	3.48e-20
1. PB	Q5FVI3	Leucine-rich repeat-containing protein 57	3.23e-14	9.16e-09	2.96e-12
1. PB	A6NIK2	Leucine-rich repeat-containing protein 10B	0	4.85e-172	0.0
1. PB	Q8N9N7	Leucine-rich repeat-containing protein 57	8.44e-15	4.27e-08	1.10e-11
1. PB	Q99983	Osteomodulin	8.28e-08	2.10e-07	0.011
1. PB	A6NIV6	Leucine-rich repeat and IQ domain-containing protein 4	1.20e-09	7.58e-03	9.19e-22
1. PB	Q8K377	Leucine-rich repeat transmembrane neuronal protein 1	7.76e-07	6.60e-03	7.37e-05
1. PB	Q96DD0	Leucine-rich repeat-containing protein 39	1.66e-11	7.38e-05	1.89e-16
1. PB	O64566	Plant intracellular Ras-group-related LRR protein 6	1.04e-09	9.06e-18	5.20e-18
1. PB	Q8K3W2	Leucine-rich repeat-containing protein 10	1.11e-16	1.78e-34	6.65e-58
1. PB	Q9BZR6	Reticulon-4 receptor	7.27e-07	1.63e-05	7.60e-06
1. PB	Q9H9A6	Leucine-rich repeat-containing protein 40	2.28e-08	2.57e-02	2.64e-19
1. PB	Q66HD6	Leucine-rich repeat-containing protein 18	3.22e-10	5.88e-30	5.55e-12
1. PB	Q6INV3	Leucine-rich repeat-containing protein 57	3.46e-14	1.69e-11	9.90e-19
1. PB	Q8BGI7	Leucine-rich repeat-containing protein 39	1.93e-11	3.54e-06	3.07e-17
1. PB	O08742	Platelet glycoprotein V	2.89e-09	6.37e-08	3.36e-07
1. PB	Q8TCA0	Leucine-rich repeat-containing protein 20	3.06e-11	4.88e-10	3.18e-06
1. PB	Q80X72	Leucine-rich repeat-containing protein 15	2.12e-05	3.43e-05	1.73e-08
1. PB	C0STK7	Phospholipase A2 inhibitor beta	NA	1.14e-03	1.28e-05
1. PB	Q8RWE5	Plant intracellular Ras-group-related LRR protein 8	1.79e-10	1.27e-15	4.71e-19
1. PB	Q6UY18	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 4	1.05e-04	1.25e-02	1.82e-04
1. PB	Q86X40	Leucine-rich repeat-containing protein 28	4.44e-16	3.52e-09	1.74e-08
1. PB	Q5BKY1	Leucine-rich repeat-containing protein 10	0.00e+00	2.25e-37	6.82e-59
1. PB	Q3TX51	Leucine-rich repeat-containing protein 28	6.66e-16	1.61e-08	1.59e-11
1. PB	O35103	Osteomodulin	1.02e-07	1.86e-07	7.57e-04
1. PB	A6H793	Leucine-rich repeat-containing protein 3	3.96e-03	1.29e-02	0.020
1. PB	P22792	Carboxypeptidase N subunit 2	6.12e-06	3.67e-08	2.79e-12
1. PB	Q3UGP9	Leucine-rich repeat-containing protein 58	1.94e-08	4.72e-14	1.70e-17
1. PB	Q5RF01	Transforming growth factor beta activator LRRC32	1.52e-08	1.52e-02	1.97e-04
1. PB	Q3ZC49	Leucine-rich repeat-containing protein 39	1.26e-11	9.51e-07	1.83e-17
1. PB	Q6GLE8	Leucine-rich repeat-containing protein 28	4.44e-16	6.03e-08	1.41e-14
1. PB	Q96CX6	Leucine-rich repeat-containing protein 58	9.57e-09	2.31e-12	9.13e-18
1. PB	Q6ZNQ3	Leucine-rich repeat-containing protein 69	4.74e-09	5.73e-15	8.07e-11
1. PB	Q32KX5	Leucine-rich repeat-containing protein 28	6.66e-16	2.38e-09	9.96e-09
2. P	Q92688	Acidic leucine-rich nuclear phosphoprotein 32 family member B	3.06e-05	1.52e-02	NA
2. P	Q9Y546	Leucine-rich repeat-containing protein 42	9.03e-03	2.07e-03	NA
2. P	Q7L985	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2	4.98e-09	1.12e-03	NA
2. P	Q9XHH2	Dynein axonemal light chain 1	2.41e-06	3.15e-04	NA
2. P	Q6QMY6	Tsukushi	4.74e-06	4.69e-02	NA
2. P	P83503	Nyctalopin	1.28e-07	1.52e-08	NA
2. P	Q9H756	Leucine-rich repeat-containing protein 19	1.71e-05	1.43e-02	NA
2. P	Q7Z4L9	Protein phosphatase 1 regulatory subunit 42	7.59e-09	1.13e-21	NA
2. P	Q4KLL3	Leucine-rich repeat-containing protein 55	2.87e-07	1.83e-02	NA
2. P	Q6FV04	U2 small nuclear ribonucleoprotein A'	8.78e-04	1.19e-06	NA
2. P	O01615	Acidic leucine-rich nuclear phosphoprotein 32-related protein 2	3.96e-05	4.10e-08	NA
2. P	Q5F4A3	Acidic leucine-rich nuclear phosphoprotein 32 family member E	3.47e-05	3.52e-03	NA
2. P	Q8BGA3	Leucine-rich repeat transmembrane neuronal protein 2	2.31e-06	3.69e-04	NA
2. P	O35381	Acidic leucine-rich nuclear phosphoprotein 32 family member A	5.23e-05	5.48e-05	NA
2. P	O43423	Acidic leucine-rich nuclear phosphoprotein 32 family member C	4.47e-05	7.34e-03	NA
2. P	Q6GQN5	Protein phosphatase 1 regulatory subunit 42	1.34e-07	4.24e-18	NA
2. P	Q66HV9	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1-B	1.47e-04	1.46e-02	NA
2. P	Q7ZUP0	Acidic leucine-rich nuclear phosphoprotein 32 family member A	8.43e-05	2.74e-03	NA
2. P	Q96PB8	Leucine-rich repeat-containing protein 3B	3.71e-04	4.42e-02	NA
2. P	Q326Z6	E3 ubiquitin-protein ligase ipaH9.8	2.60e-05	8.78e-03	NA
2. P	Q4P5F9	U2 small nuclear ribonucleoprotein A'	5.22e-04	7.82e-08	NA
2. P	Q2EEY0	Toll-like receptor 9	6.00e-04	3.80e-02	NA
2. P	P49911	Acidic leucine-rich nuclear phosphoprotein 32 family member A	5.29e-06	4.87e-07	NA
2. P	O62220	Acidic leucine-rich nuclear phosphoprotein 32-related protein 1	1.51e-04	5.34e-07	NA
2. P	Q4R747	Leucine-rich repeat-containing protein 46	6.85e-05	6.82e-04	NA
2. P	Q86UN2	Reticulon-4 receptor-like 1	1.59e-07	2.97e-04	NA
2. P	Q8R2R5	Leucine-rich repeat-containing protein 61	6.90e-05	1.65e-04	NA
2. P	Q587K4	Leucine-rich repeat-containing protein 73	5.68e-05	1.37e-07	NA
2. P	Q5I2M4	Toll-like receptor 9	1.34e-04	2.05e-03	NA
2. P	Q9BV99	Leucine-rich repeat-containing protein 61	3.03e-04	1.24e-05	NA
2. P	Q8VSC3	E3 ubiquitin-protein ligase ipaH9.8	3.08e-05	6.40e-03	NA
2. P	Q86UN3	Reticulon-4 receptor-like 2	1.26e-07	1.84e-05	NA
2. P	Q9V895	Acidic leucine-rich nuclear phosphoprotein 32 family member A	3.73e-05	1.57e-03	NA
2. P	Q5I2M7	Toll-like receptor 9	6.61e-04	2.09e-02	NA
2. P	O43300	Leucine-rich repeat transmembrane neuronal protein 2	4.73e-06	1.23e-04	NA
2. P	Q13641	Trophoblast glycoprotein	1.87e-05	1.19e-02	NA
2. P	Q9LHF1	Leucine-rich repeat extensin-like protein 4	1.79e-05	4.88e-02	NA
2. P	Q6P7C4	Leucine-rich repeat-containing protein 26	1.30e-06	7.01e-08	NA
2. P	O74411	Meiotic expression up-regulated protein 10	1.34e-02	3.62e-02	NA
2. P	P59034	Leucine-rich repeat-containing protein 3	4.69e-03	1.77e-03	NA
2. P	Q7M6Z0	Reticulon-4 receptor-like 2	8.36e-07	1.57e-05	NA
2. P	Q9DAK8	Leucine-rich repeat-containing protein 51	2.25e-04	5.54e-05	NA
2. P	Q01819	Connectin	6.68e-05	1.93e-02	NA
2. P	Q6C417	U2 small nuclear ribonucleoprotein A'	2.35e-03	1.91e-08	NA
2. P	A2VDH3	Leucine-rich repeat-containing protein 38	1.62e-07	6.67e-03	NA
2. P	P0C6S8	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3	6.74e-06	7.74e-03	NA
2. P	Q9D9B4	Leucine-rich melanocyte differentiation-associated protein	5.60e-04	2.75e-09	NA
2. P	Q9ZPE4	F-box protein FBW2	1.84e-03	5.17e-03	NA
2. P	Q8HY67	Acidic leucine-rich nuclear phosphoprotein 32 family member A	NA	5.00e-07	NA
2. P	B6CZ45	Leucine-rich repeat-containing protein 51	1.33e-03	2.16e-07	NA
2. P	B2TT54	E3 ubiquitin-protein ligase ipaH9.8	2.69e-05	2.32e-02	NA
2. P	A6H759	Leucine-rich repeat-containing protein 72	3.50e-05	1.04e-09	NA
2. P	D4A7P2	Leucine-rich repeat transmembrane neuronal protein 2	1.58e-05	4.19e-04	NA
2. P	P59035	Leucine-rich repeat-containing protein 3	2.52e-03	2.26e-03	NA
2. P	P09661	U2 small nuclear ribonucleoprotein A'	2.63e-04	4.36e-09	NA
2. P	Q08963	U2 small nuclear ribonucleoprotein A'	1.41e-03	1.27e-13	NA
2. P	Q7ZY40	Acidic leucine-rich nuclear phosphoprotein 32 family member E	5.86e-05	5.89e-04	NA
2. P	Q9USX8	U2 small nuclear ribonucleoprotein A'	3.73e-05	6.82e-06	NA
2. P	P97822	Acidic leucine-rich nuclear phosphoprotein 32 family member E	3.78e-05	2.47e-04	NA
2. P	P39687	Acidic leucine-rich nuclear phosphoprotein 32 family member A	3.36e-05	1.44e-06	NA
2. P	A8WHP9	Leucine-rich repeat-containing protein 3	1.24e-03	8.42e-03	NA
2. P	B6CZ54	Leucine-rich repeat-containing protein 51	1.28e-03	2.16e-07	NA
2. P	Q4R8Y9	Trophoblast glycoprotein	1.77e-05	2.32e-02	NA
2. P	Q4R803	Protein phosphatase 1 regulatory subunit 42	1.79e-07	1.77e-18	NA
2. P	Q5PPX0	Protein phosphatase 1 regulatory subunit 42	6.19e-07	2.07e-11	NA
2. P	Q4V8D9	Leucine-rich repeat-containing protein 34	4.24e-06	4.00e-03	NA
2. P	Q2KID4	Dynein axonemal light chain 1	1.05e-06	4.11e-05	NA
2. P	Q9M0U9	F-box protein SKIP19	8.84e-05	2.67e-02	NA
2. P	Q8CBR6	Tsukushi	3.86e-06	4.24e-02	NA
2. P	Q6NUW5	Acidic leucine-rich nuclear phosphoprotein 32 family member E	1.62e-04	1.02e-04	NA
2. P	Q4LDG9	Dynein axonemal light chain 1	9.55e-07	5.17e-06	NA
2. P	P11745	Ran GTPase-activating protein 1	1.13e-05	1.30e-04	NA
2. P	Q86YC3	Transforming growth factor beta activator LRRC33	2.77e-08	6.82e-04	NA
2. P	Q6GQU6	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3	8.48e-06	1.43e-02	NA
2. P	Q641R9	Dynein axonemal light chain 1	1.48e-06	2.44e-04	NA
2. P	Q5BGW9	U2 small nuclear ribonucleoprotein A'	9.68e-04	2.59e-02	NA
2. P	Q9H2I8	Leucine-rich melanocyte differentiation-associated protein	5.45e-03	7.98e-03	NA
2. P	Q3URE9	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2	1.86e-05	2.74e-03	NA
2. P	P0CAE6	Transmembrane protein I329L	NA	4.31e-03	NA
2. P	P43333	U2 small nuclear ribonucleoprotein A'	7.77e-05	8.29e-09	NA
2. P	Q9DAP0	Leucine-rich repeat-containing protein 46	4.58e-05	9.95e-03	NA
2. P	Q6PAF6	Acidic leucine-rich nuclear phosphoprotein 32 family member A	4.25e-05	1.21e-04	NA
2. P	Q9U3A0	P-granule-associated novel protein 1	5.89e-09	1.50e-07	NA
2. P	P18014	Probable E3 ubiquitin-protein ligase ipaH7.8	1.15e-07	4.48e-04	NA
2. P	Q7S9P4	U2 small nuclear ribonucleoprotein A'	4.78e-04	1.29e-04	NA
2. P	Q8N7C0	Leucine-rich repeat-containing protein 52	3.31e-07	4.55e-09	NA
2. P	D2AJU0	E3 ubiquitin-protein ligase ipaH9.8	2.60e-05	2.93e-02	NA
2. P	Q9BTT0	Acidic leucine-rich nuclear phosphoprotein 32 family member E	8.46e-05	5.88e-03	NA
2. P	O36972	IkB-like protein	NA	1.83e-02	NA
2. P	Q6BT60	U2 small nuclear ribonucleoprotein A'	1.13e-03	2.86e-07	NA
2. P	Q9BLB6	Probable U2 small nuclear ribonucleoprotein A'	8.74e-04	1.50e-08	NA
2. P	Q5M8M9	Leucine-rich repeat-containing protein 52	1.30e-05	4.77e-08	NA
2. P	P0DKB5	Trophoblast glycoprotein-like	4.43e-05	3.22e-04	NA
2. P	Q8N6Y2	Leucine-rich repeat-containing protein 17	9.48e-05	8.59e-03	NA
2. P	Q28G94	Dynein axonemal light chain 1	9.89e-07	6.23e-04	NA
2. P	D4AZK9	Cell surface GPI-anchored protein ARB_01627	6.50e-03	2.73e-02	NA
2. P	Q3ZBI5	Transforming growth factor beta activator LRRC33	3.62e-05	1.19e-02	NA
2. P	Q4WV66	U2 small nuclear ribonucleoprotein A'	2.73e-04	7.93e-05	NA
2. P	Q9GZU5	Nyctalopin	5.37e-06	2.37e-07	NA
2. P	P57784	U2 small nuclear ribonucleoprotein A'	2.08e-04	6.15e-09	NA
2. P	Q9V4Q8	Probable U2 small nuclear ribonucleoprotein A'	1.57e-03	7.09e-09	NA
2. P	Q5VT99	Leucine-rich repeat-containing protein 38	2.17e-07	1.98e-03	NA
2. P	Q6A1I3	Acidic leucine-rich nuclear phosphoprotein 32 family member B	1.10e-05	6.53e-03	NA
2. P	P0CAE5	Transmembrane protein I329L	NA	3.33e-03	NA
2. P	Q3UY51	Leucine-rich repeat-containing protein 55	2.16e-07	1.43e-02	NA
2. P	O77742	Osteomodulin	2.59e-07	1.84e-07	NA
2. P	Q12355	Cell wall mannoprotein PST1	1.64e-03	2.34e-02	NA
2. P	Q83RJ4	E3 ubiquitin-protein ligase ipaH3	8.68e-08	9.74e-03	NA
2. P	Q4WNS8	Protein ecm33	2.26e-02	2.87e-03	NA
2. P	Q5EAD8	Leucine-rich repeat-containing protein 51	1.61e-03	1.75e-06	NA
2. P	Q8C013	Trophoblast glycoprotein-like	6.30e-06	1.59e-04	NA
2. P	Q6AXZ2	Leucine-rich repeat-containing protein 46	3.70e-05	5.08e-04	NA
2. P	Q3YTH5	E3 ubiquitin-protein ligase ipaH9.8	2.61e-05	2.20e-02	NA
2. P	Q2I0M4	Leucine-rich repeat-containing protein 26	4.77e-07	5.78e-07	NA
2. P	Q80WD0	Reticulon-4 receptor-like 1	3.20e-07	6.03e-05	NA
2. P	P71451	Internalin C	1.03e-04	1.54e-08	NA
2. P	Q6DHB1	Dynein axonemal light chain 1	1.15e-06	4.09e-03	NA
2. P	Q91W20	Leucine-rich repeat-containing protein 26	1.83e-07	2.31e-09	NA
2. P	Q8ILI6	Acidic leucine-rich nuclear phosphoprotein 32-related protein	1.66e-04	1.12e-02	NA
2. P	Q5JTD7	Leucine-rich repeat-containing protein 73	8.03e-06	5.89e-09	NA
2. P	Q5XIE0	Acidic leucine-rich nuclear phosphoprotein 32 family member E	3.40e-05	1.76e-04	NA
2. P	Q05A62	Dynein axonemal light chain 1	9.36e-07	1.58e-06	NA
2. P	Q8R1Z4	Protein phosphatase 1 regulatory subunit 42	6.68e-08	5.78e-14	NA
2. P	A0A096MJZ0	Dynein axonemal light chain 1	9.17e-07	1.46e-05	NA
2. P	P51122	Acidic leucine-rich nuclear phosphoprotein 32 family member A	1.83e-04	1.24e-05	NA
2. P	Q2T9T5	Leucine-rich repeat-containing protein 61	2.37e-05	3.54e-07	NA
2. P	Q8T888	Dynein axonemal light chain 1	1.02e-06	3.65e-04	NA
2. P	Q5I2M5	Toll-like receptor 9	1.91e-04	3.05e-02	NA
2. P	Q96FV0	Leucine-rich repeat-containing protein 46	5.08e-05	3.07e-04	NA
2. P	B6CZ61	Leucine-rich repeat-containing protein 51	1.23e-04	5.24e-06	NA
2. P	Q9J5G9	Putative ankyrin repeat protein FPV034	NA	1.05e-02	NA
2. P	Q96E66	Leucine-rich repeat-containing protein 51	5.90e-04	8.02e-07	NA
2. P	Q755D2	U2 small nuclear ribonucleoprotein A'	2.92e-04	5.18e-10	NA
2. P	Q65Z91	Tsukushi	1.11e-06	8.62e-05	NA
2. P	Q8K0S5	Reticulon-4 receptor-like 1	2.12e-06	2.89e-05	NA
2. P	P27945	Transmembrane protein I329L	NA	3.63e-03	NA
2. P	Q76U48	IkB-like protein	NA	1.08e-02	NA
2. P	A6ZY20	Cell wall mannoprotein PST1	3.08e-04	4.37e-02	NA
2. P	Q5PQV5	Trophoblast glycoprotein	4.23e-06	4.78e-02	NA
2. P	A6NJI9	Leucine-rich repeat-containing protein 72	4.63e-04	8.65e-09	NA
2. P	Q9CXD9	Leucine-rich repeat-containing protein 17	3.77e-06	1.49e-03	NA
2. P	P0CAE4	Transmembrane protein I329L	NA	8.78e-03	NA
2. P	Q4R8Y8	U2 small nuclear ribonucleoprotein A'	1.71e-04	4.36e-09	NA
2. P	Q5UQX3	Putative leucine-rich repeat protein R380	NA	2.05e-10	NA
2. P	Q5A449	U2 small nuclear ribonucleoprotein A'	2.22e-04	3.00e-11	NA
2. P	Q31SH3	E3 ubiquitin-protein ligase ipaH9.8	2.58e-05	1.51e-02	NA
2. P	Q80WD1	Reticulon-4 receptor-like 2	4.53e-07	2.38e-05	NA
2. P	Q9DAM1	Leucine-rich repeat-containing protein 34	2.54e-08	3.52e-03	NA
2. P	P0C964	IkB-like protein	NA	2.54e-02	NA
2. P	P14770	Platelet glycoprotein IX	5.80e-03	8.87e-03	NA
2. P	B6CZ40	Leucine-rich repeat-containing protein 51	2.00e-03	3.45e-07	NA
2. P	C3YZ59	Leucine-rich repeat-containing protein Bf66946	2.12e-03	1.49e-02	NA
2. P	Q50L44	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1	3.99e-04	2.73e-02	NA
3. B	Q504C1	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2	2.07e-04	NA	0.010
3. B	O75094	Slit homolog 3 protein	4.33e-02	NA	4.79e-06
3. B	Q08817	Leucine-rich repeat-containing protein SOG2	5.39e-03	NA	4.86e-05
3. B	Q9BYS8	Leucine-rich repeat-containing protein 2	3.11e-11	NA	7.99e-14
3. B	Q8AVI4	Leucine-rich repeat protein SHOC-2	8.57e-12	NA	1.34e-18
3. B	Q8GRU6	Leucine-rich repeat receptor-like kinase protein HAR1	1.73e-04	NA	4.07e-07
3. B	Q9SCX7	Inactive disease resistance protein RPS4	4.56e-03	NA	0.033
3. B	Q9VJ07	Protein phosphatase PHLPP-like protein	2.08e-07	NA	7.80e-07
3. B	Q5RFE9	Leucine-rich repeat-containing protein 40	1.22e-08	NA	1.38e-20
3. B	C0LGU1	Probable LRR receptor-like serine/threonine-protein kinase At5g37450	3.95e-03	NA	1.20e-05
3. B	Q5S007	Leucine-rich repeat serine/threonine-protein kinase 2	5.61e-02	NA	1.12e-04
3. B	Q9DE68	Decorin	7.10e-12	NA	0.018
3. B	Q5NVQ6	Immunoglobulin superfamily containing leucine-rich repeat protein	3.59e-04	NA	0.015
3. B	Q5VUJ6	Leucine-rich repeat and calponin homology domain-containing protein 2	5.32e-06	NA	1.76e-13
3. B	P51885	Lumican	4.04e-12	NA	2.11e-04
3. B	Q9FMD7	Probable inactive receptor kinase At5g16590	3.08e-03	NA	0.002
3. B	Q96RT1	Erbin	2.09e-03	NA	2.08e-23
3. B	Q6FRT2	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	6.14e-02	NA	1.92e-09
3. B	Q8L899	Systemin receptor SR160	1.26e-03	NA	6.58e-06
3. B	Q3V1N1	Malignant fibrous histiocytoma-amplified sequence 1 homolog	1.04e-04	NA	9.78e-24
3. B	Q3UMG5	Leucine-rich repeat and calponin homology domain-containing protein 2	1.49e-06	NA	1.67e-13
3. B	Q80YS5	Leucine-rich repeat-containing protein 27	1.56e-03	NA	0.003
3. B	P60838	Disease resistance protein SUMM2	1.46e-03	NA	0.014
3. B	Q9XSD9	Decorin	7.21e-12	NA	0.018
3. B	Q9XGM3	Disease resistance protein RPS4	9.89e-03	NA	0.032
3. B	Q9SHI2	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230	6.94e-03	NA	3.07e-04
3. B	P0DQD2	Internalin B	7.10e-04	NA	0.012
3. B	Q9LVP0	Probable leucine-rich repeat receptor-like protein kinase At5g63930	3.72e-03	NA	1.52e-05
3. B	Q4H4B6	Protein scribble homolog	2.10e-03	NA	2.93e-20
3. B	Q6GPJ5	Leucine-rich repeat-containing protein 40	1.46e-09	NA	2.79e-18
3. B	P13605	Fibromodulin	9.97e-12	NA	6.14e-07
3. B	O49471	Probable disease resistance protein At4g19530	1.15e-02	NA	0.007
3. B	B5DX45	Leucine-rich repeat protein soc-2 homolog	1.20e-07	NA	1.25e-17
3. B	C0LGE4	Probable LRR receptor-like serine/threonine-protein kinase At1g12460	4.49e-04	NA	6.23e-05
3. B	C0LGE0	Probable LRR receptor-like serine/threonine-protein kinase At1g07650	4.03e-06	NA	0.032
3. B	Q3UHC2	Leucine-rich repeat serine/threonine-protein kinase 1	2.40e-02	NA	5.97e-08
3. B	F4KIF3	Disease resistance-like protein CSA1	2.57e-03	NA	1.91e-06
3. B	Q7Z5L7	Podocan	9.05e-06	NA	1.19e-06
3. B	Q9SKG5	Somatic embryogenesis receptor kinase 4	2.22e-02	NA	0.011
3. B	F4IUU1	Receptor like protein 27	4.01e-04	NA	0.019
3. B	Q6UXK2	Immunoglobulin superfamily containing leucine-rich repeat protein 2	4.34e-05	NA	0.017
3. B	Q6JN47	Receptor-like protein EIX1	1.89e-03	NA	1.01e-05
3. B	Q9C9H7	Receptor-like protein 12	7.77e-05	NA	7.32e-07
3. B	F1MLX5	Leucine-rich repeat-containing G-protein coupled receptor 4	7.19e-04	NA	8.57e-15
3. B	Q8RX63	Receptor-like protein 31	9.52e-05	NA	6.31e-04
3. B	P93194	Receptor-like protein kinase	1.78e-03	NA	1.06e-05
3. B	Q2WF71	Leucine-rich repeat and fibronectin type III domain-containing protein 1	1.71e-04	NA	0.017
3. B	Q8BGR2	Volume-regulated anion channel subunit LRRC8D	1.80e-06	NA	5.61e-18
3. B	Q9SI85	Probable disease resistance protein At1g62630	1.35e-03	NA	0.011
3. B	C0LGN2	Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840	8.43e-06	NA	0.001
3. B	Q5M8G4	Leucine-rich repeat-containing protein 40	6.07e-09	NA	1.16e-18
3. B	A8XWW4	Leucine-rich repeat protein soc-2	3.70e-12	NA	1.27e-17
3. B	O02678	Biglycan	1.38e-11	NA	0.012
3. B	P47853	Biglycan	1.40e-11	NA	0.006
3. B	Q6BMM5	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.50e-02	NA	3.94e-08
3. B	Q6R6I7	Relaxin receptor 1	2.13e-07	NA	2.19e-04
3. B	Q63912	Oligodendrocyte-myelin glycoprotein	1.02e-07	NA	8.07e-04
3. B	O49879	Receptor-like protein Cf-9 homolog	7.44e-04	NA	1.45e-05
3. B	Q5ZLN0	Leucine-rich repeat-containing protein 40	5.49e-12	NA	7.69e-20
3. B	P28654	Decorin	3.78e-12	NA	0.013
3. B	Q942F3	Brassinosteroid LRR receptor kinase BRI1	7.00e-03	NA	2.85e-09
3. B	Q810B8	SLIT and NTRK-like protein 4	7.96e-05	NA	3.04e-05
3. B	P51888	Prolargin	3.60e-09	NA	0.001
3. B	Q93YT3	Receptor-like protein 50	7.31e-07	NA	2.47e-05
3. B	F4HTV6	Putative receptor-like protein 16	1.71e-11	NA	2.02e-04
3. B	Q9SSL9	Leucine-rich repeat receptor-like protein kinase PEPR1	2.89e-04	NA	0.006
3. B	Q9WTR8	PH domain leucine-rich repeat protein phosphatase 1	7.19e-05	NA	2.71e-12
3. B	Q22875	Leucine-rich repeat protein soc-2	7.35e-12	NA	1.90e-17
3. B	Q6NSJ5	Volume-regulated anion channel subunit LRRC8E	7.89e-07	NA	2.31e-13
3. B	Q40392	TMV resistance protein N	4.64e-06	NA	6.95e-12
3. B	Q5F334	Leucine-rich repeat-containing protein 59	3.28e-06	NA	1.52e-05
3. B	Q15435	Protein phosphatase 1 regulatory subunit 7	1.02e-09	NA	2.27e-06
3. B	F4JT80	Disease resistance protein RPP2B	2.44e-03	NA	2.75e-05
3. B	Q93Y06	Probable inactive receptor kinase At5g67200	9.24e-03	NA	0.008
3. B	F1MT22	Leucine-rich repeat-containing G-protein coupled receptor 5	2.59e-07	NA	2.67e-12
3. B	Q9C699	Receptor-like protein 7	1.70e-04	NA	1.65e-05
3. B	Q6Z8P4	Plant intracellular Ras-group-related LRR protein 4	2.05e-07	NA	7.99e-22
3. B	Q92626	Peroxidasin homolog	9.62e-02	NA	1.57e-05
3. B	P0C895	LRR repeats and ubiquitin-like domain-containing protein At2g30105	1.72e-10	NA	9.06e-13
3. B	Q9LJS2	Receptor-like protein 41	8.87e-05	NA	3.00e-06
3. B	Q9LRR5	Putative disease resistance protein At3g14460	1.07e-02	NA	4.19e-05
3. B	Q9FL28	LRR receptor-like serine/threonine-protein kinase FLS2	4.36e-03	NA	3.84e-09
3. B	Q9R1B9	Slit homolog 2 protein	2.44e-02	NA	5.21e-04
3. B	Q13045	Protein flightless-1 homolog	7.60e-05	NA	2.12e-10
3. B	Q5BJ41	CCR4-NOT transcription complex subunit 6	4.37e-03	NA	9.47e-07
3. B	P0CP23	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	3.07e-02	NA	3.30e-11
3. B	Q9DBY4	TLR4 interactor with leucine rich repeats	8.22e-05	NA	6.14e-06
3. B	P50608	Fibromodulin	1.16e-11	NA	8.22e-07
3. B	Q54Q39	Protein phosphatase 1 regulatory subunit pprA	1.50e-10	NA	1.17e-06
3. B	Q9ULM6	CCR4-NOT transcription complex subunit 6	2.18e-03	NA	8.65e-08
3. B	Q9V780	Protein lap1	5.06e-06	NA	6.20e-23
3. B	Q7KRY7	Protein lap4	1.18e-02	NA	3.09e-24
3. B	Q01631	Adenylate cyclase	2.38e-02	NA	3.18e-10
3. B	Q965M2	Leucine-rich repeats and immunoglobulin-like domains protein sma-10	3.69e-04	NA	0.009
3. B	Q9SSD1	Protein TOO MANY MOUTHS	6.98e-06	NA	0.025
3. B	Q84MA9	Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630	7.84e-03	NA	1.68e-05
3. B	Q9LS79	Receptor-like protein 38	5.07e-05	NA	0.006
3. B	P21809	Biglycan	1.26e-11	NA	0.011
3. B	Q9GKN8	Prolargin	2.17e-09	NA	3.45e-06
3. B	Q5RAC4	SLIT and NTRK-like protein 1	1.16e-04	NA	0.001
3. B	Q9HBX8	Leucine-rich repeat-containing G-protein coupled receptor 6	6.94e-07	NA	5.62e-12
3. B	F4I9S3	Receptor-like protein 9a	2.63e-06	NA	0.020
3. B	Q8VYG9	Plant intracellular Ras-group-related LRR protein 9	8.30e-09	NA	1.64e-22
3. B	Q5RI43	Keratocan	7.01e-10	NA	0.008
3. B	B4LXW1	Leucine-rich repeat protein soc-2 homolog	2.61e-11	NA	5.23e-18
3. B	Q8CHE4	PH domain leucine-rich repeat-containing protein phosphatase 1	2.48e-03	NA	3.20e-12
3. B	Q7KIN0	Toll-like receptor 7	4.38e-03	NA	8.98e-06
3. B	Q9NR99	Matrix-remodeling-associated protein 5	NA	NA	2.90e-06
3. B	Q9NR97	Toll-like receptor 8	2.78e-06	NA	0.017
3. B	Q9ZUK3	Receptor-like protein 19	2.20e-04	NA	2.43e-08
3. B	Q9VEK6	Leucine-rich repeat protein soc-2 homolog	5.58e-11	NA	1.12e-17
3. B	Q6NWG1	Leucine-rich repeat-containing protein 59	9.40e-07	NA	0.002
3. B	A7SFP1	Leucine-rich repeat protein soc-2 homolog	8.41e-12	NA	1.42e-15
3. B	Q8VZG8	MDIS1-interacting receptor like kinase 2	1.03e-03	NA	2.55e-06
3. B	Q05443	Lumican	4.65e-12	NA	0.003
3. B	O60346	PH domain leucine-rich repeat-containing protein phosphatase 1	7.84e-05	NA	8.04e-11
3. B	Q0WVM4	Probable LRR receptor-like serine/threonine-protein kinase At2g23950	1.61e-02	NA	0.016
3. B	Q96NI6	Leucine-rich repeat and fibronectin type-III domain-containing protein 5	8.20e-05	NA	0.019
3. B	A2Q9L0	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	5.19e-03	NA	3.51e-09
3. B	Q9C7T7	Receptor protein-tyrosine kinase CEPR2	1.13e-03	NA	6.92e-08
3. B	G7JIK2	Leucine-rich repeat receptor-like kinase protein SUNN	1.40e-04	NA	3.10e-07
3. B	Q80ZI6	E3 ubiquitin-protein ligase LRSAM1	6.10e-05	NA	8.77e-10
3. B	O46378	Fibromodulin (Fragment)	1.45e-12	NA	1.88e-04
3. B	C4B7M7	Disease resistance protein RPS4	7.16e-03	NA	0.033
3. B	Q9SN38	Receptor-like protein 51	3.33e-05	NA	0.046
3. B	Q9C6A6	Receptor-like protein 13	7.87e-03	NA	0.003
3. B	Q3ZBN5	Asporin	4.29e-12	NA	0.017
3. B	Q9FZ59	Leucine-rich repeat receptor-like protein kinase PEPR2	3.52e-04	NA	9.39e-09
3. B	Q9BY71	Leucine-rich repeat-containing protein 3	4.65e-04	NA	0.018
3. B	Q80U72	Protein scribble homolog	1.81e-03	NA	5.31e-23
3. B	Q8S7M7	Plant intracellular Ras-group-related LRR protein 5	8.35e-09	NA	2.29e-17
3. B	P28653	Biglycan	1.32e-11	NA	0.007
3. B	Q96PX8	SLIT and NTRK-like protein 1	1.68e-05	NA	0.002
3. B	W8DXL4	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3	1.74e-03	NA	0.003
3. B	B0M0P8	Ras guanine nucleotide exchange factor L	1.03e-02	NA	3.59e-19
3. B	Q6XHA6	Probable inactive serine/threonine-protein kinase roco10	7.36e-02	NA	6.49e-10
3. B	Q9SJH6	Receptor like protein 29	3.25e-06	NA	2.41e-06
3. B	Q4WQG5	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	8.26e-03	NA	8.11e-10
3. B	O94813	Slit homolog 2 protein	2.20e-02	NA	6.17e-04
3. B	Q9HBX9	Relaxin receptor 1	1.49e-07	NA	1.03e-04
3. B	Q7TNJ4	Amphoterin-induced protein 2	2.74e-04	NA	7.77e-04
3. B	Q7G768	Brassinosteroid LRR receptor kinase BRL2	1.70e-05	NA	1.81e-04
3. B	C0LGQ9	LRR receptor-like serine/threonine-protein kinase GHR1	4.58e-03	NA	0.002
3. B	P43298	Receptor protein kinase TMK1	8.11e-04	NA	0.006
3. B	Q8IWT6	Volume-regulated anion channel subunit LRRC8A	1.06e-05	NA	6.24e-13
3. B	Q5RAV5	Leucine-rich repeat protein SHOC-2	8.90e-12	NA	7.79e-20
3. B	Q7L1W4	Volume-regulated anion channel subunit LRRC8D	1.82e-06	NA	1.40e-17
3. B	Q9LH52	Leucine-rich repeat protein FLOR 1	5.59e-08	NA	6.37e-04
3. B	Q8BGT1	Leucine-rich repeat transmembrane protein FLRT3	4.64e-06	NA	7.47e-08
3. B	P02750	Leucine-rich alpha-2-glycoprotein	4.95e-08	NA	6.10e-07
3. B	O22938	Leucine-rich repeat receptor-like tyrosine-protein kinase PXC3	9.69e-05	NA	5.90e-06
3. B	Q5G5E0	Plant intracellular Ras-group-related LRR protein 5	3.05e-09	NA	2.42e-16
3. B	Q9FKZ1	Probable disease resistance protein At5g66900	1.12e-04	NA	0.017
3. B	Q9UQ13	Leucine-rich repeat protein SHOC-2	9.75e-12	NA	7.79e-20
3. B	P51884	Lumican	1.66e-08	NA	0.004
3. B	Q9P244	Leucine-rich repeat and fibronectin type III domain-containing protein 1	2.62e-04	NA	0.010
3. B	V9M398	Disease resistance protein RUN1	1.28e-02	NA	7.08e-10
3. B	Q6AYI5	Leucine-rich repeat protein SHOC-2	9.77e-12	NA	2.80e-19
3. B	Q80ZD9	Amphoterin-induced protein 2	9.73e-05	NA	1.01e-04
3. B	B1H234	Leucine-rich repeat transmembrane protein FLRT3	1.10e-05	NA	6.88e-08
3. B	Q9SRL7	Receptor-like protein 35	1.29e-04	NA	1.01e-06
3. B	Q5RFS7	Protein phosphatase 1 regulatory subunit 7	7.72e-10	NA	3.44e-05
3. B	Q5FW85	Extracellular matrix protein 2	9.27e-09	NA	4.33e-05
3. B	O82318	Leucine-rich repeat receptor-like serine/threonine-protein kinase SKM1	1.16e-03	NA	6.71e-08
3. B	Q9ZUI0	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130	4.61e-04	NA	0.005
3. B	Q9ZU46	Receptor protein kinase-like protein ZAR1	2.01e-03	NA	0.009
3. B	Q9FL63	Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At5g24100	5.00e-03	NA	1.56e-08
3. B	Q40235	Receptor-like protein Cf-9	8.10e-04	NA	5.53e-04
3. B	Q8RZV7	Leucine-rich repeat receptor protein kinase MSP1	1.04e-03	NA	4.44e-04
3. B	O61967	Protein lap1	1.05e-05	NA	2.05e-19
3. B	Q5MR23	Receptor-like protein 9DC3	1.17e-03	NA	3.51e-04
3. B	Q0U7W4	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	3.19e-03	NA	1.55e-06
3. B	Q960C5	Leucine-rich repeat and calponin homology domain-containing protein	9.74e-06	NA	3.01e-11
3. B	V9M2S5	Disease resistance protein RPV1	7.52e-03	NA	2.70e-05
3. B	Q2R8L1	Disease resistance protein RGA5	1.69e-02	NA	0.012
3. B	G9LZD7	Probable inactive leucine-rich repeat receptor kinase XIAO	1.76e-03	NA	1.44e-08
3. B	Q9Y2L9	Leucine-rich repeat and calponin homology domain-containing protein 1	6.73e-06	NA	1.49e-13
3. B	P35334	Polygalacturonase inhibitor 1	4.70e-10	NA	0.004
3. B	Q9C9H6	Receptor-like protein 11	2.92e-05	NA	1.78e-09
3. B	O75473	Leucine-rich repeat-containing G-protein coupled receptor 5	1.22e-04	NA	4.45e-11
3. B	O46403	Biglycan	1.57e-11	NA	0.010
3. B	P12024	Chaoptin	4.22e-03	NA	7.77e-04
3. B	Q9CRC8	Leucine-rich repeat-containing protein 40	6.58e-13	NA	4.21e-18
3. B	P31384	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.88e-02	NA	1.06e-10
3. B	Q9SLI6	Putative receptor-like protein 8	3.33e-03	NA	0.016
3. B	O49545	Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1	2.42e-06	NA	6.38e-04
3. B	Q3SXY7	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3	2.21e-03	NA	0.017
3. B	Q9H5Y7	SLIT and NTRK-like protein 6	4.13e-04	NA	0.002
3. B	Q940E8	Leucine-rich repeat receptor-like protein FASCIATED EAR2	2.08e-04	NA	5.04e-08
3. B	A1CIJ6	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	5.76e-03	NA	1.65e-10
3. B	B3LWU3	Leucine-rich repeat protein soc-2 homolog	4.98e-11	NA	2.41e-17
3. B	Q5S006	Leucine-rich repeat serine/threonine-protein kinase 2	5.77e-02	NA	3.04e-05
3. B	Q9SZ67	Probable WRKY transcription factor 19	3.98e-02	NA	0.002
3. B	Q1L8Y7	Leucine-rich repeat protein SHOC-2	7.13e-12	NA	2.89e-18
3. B	Q9SRL2	Receptor-like protein 34	1.35e-06	NA	7.07e-11
3. B	Q05C16	Leucine-rich repeat-containing protein 63	3.31e-04	NA	6.63e-13
3. B	Q9S9U3	Receptor-like protein 53	9.27e-05	NA	1.73e-07
3. B	Q4PSE6	Leucine-rich repeat extensin-like protein 7	1.81e-06	NA	0.002
3. B	Q39214	Disease resistance protein RPM1	3.29e-04	NA	0.003
3. B	Q8N1G4	Leucine-rich repeat-containing protein 47	2.20e-06	NA	4.96e-10
3. B	Q28256	Platelet glycoprotein Ib alpha chain	7.94e-06	NA	4.15e-04
3. B	Q86SJ2	Amphoterin-induced protein 2	7.96e-04	NA	2.23e-04
3. B	Q80TE7	Leucine-rich repeat-containing protein 7	7.61e-04	NA	1.03e-25
3. B	P0DQD3	Internalin B	7.11e-04	NA	0.009
3. B	Q01513	Adenylate cyclase	3.75e-02	NA	7.81e-12
3. B	Q9ZPS9	Serine/threonine-protein kinase BRI1-like 2	7.66e-03	NA	0.002
3. B	Q810C0	SLIT and NTRK-like protein 2	5.68e-04	NA	9.25e-07
3. B	P47735	Receptor-like protein kinase 5	1.74e-04	NA	1.90e-07
3. B	Q80TH2	Erbin	1.55e-03	NA	2.77e-24
3. B	P0DO06	Receptor-like protein 9DC2	8.08e-04	NA	3.39e-04
3. B	Q54WS5	Probable serine/threonine-protein kinase roco6	5.40e-02	NA	1.30e-04
3. B	Q9FGL5	Receptor protein-tyrosine kinase CEPR1	3.43e-03	NA	3.53e-06
3. B	Q9C637	Receptor-like protein 6	2.23e-04	NA	0.034
3. B	E9Q7T7	Chondroadherin-like protein	2.31e-05	NA	4.16e-07
3. B	Q7XBQ9	Disease resistance protein RGA2	3.12e-05	NA	2.05e-04
3. B	Q3U3V8	X-ray radiation resistance-associated protein 1	2.69e-04	NA	0.004
3. B	Q9LYN8	Leucine-rich repeat receptor protein kinase EMS1	4.80e-04	NA	8.35e-05
3. B	Q8MVR1	Cyclic GMP-binding protein C	5.09e-01	NA	2.10e-09
3. B	Q6CJU4	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.57e-02	NA	2.01e-10
3. B	Q9C2R2	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	7.49e-03	NA	5.19e-09
3. B	Q9NT99	Leucine-rich repeat-containing protein 4B	3.24e-04	NA	0.001
3. B	Q9FIZ3	LRR receptor-like serine/threonine-protein kinase GSO2	8.45e-03	NA	3.14e-10
3. B	A6QLV3	Leucine-rich repeat protein SHOC-2	8.98e-12	NA	8.64e-20
3. B	Q6ZCZ2	Brassinosteroid LRR receptor kinase BRL3	1.21e-03	NA	4.81e-04
3. B	Q5M7S9	Tsukushi	8.29e-07	NA	0.034
3. B	Q6AXU9	CCR4-NOT transcription complex subunit 6	3.92e-03	NA	1.05e-06
3. B	C4V7I7	Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	5.24e-04	NA	1.41e-05
3. B	C0LGP9	Probable leucine-rich repeat receptor-like protein kinase IMK3	6.83e-04	NA	6.75e-11
3. B	Q9LP24	Probable leucine-rich repeat receptor-like protein kinase At1g35710	5.25e-03	NA	3.68e-05
3. B	Q9LFG1	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At3g53590	5.89e-04	NA	5.09e-04
3. B	Q8IW52	SLIT and NTRK-like protein 4	2.11e-04	NA	2.81e-05
3. B	Q0CT27	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.33e-02	NA	5.24e-11
3. B	Q3UVD5	Leucine-rich repeat-containing G-protein coupled receptor 6	6.12e-07	NA	4.89e-12
3. B	Q6GU68	Immunoglobulin superfamily containing leucine-rich repeat protein	6.93e-05	NA	0.030
3. B	Q6DF55	Vasorin	5.04e-06	NA	0.002
3. B	Q01129	Decorin	1.85e-12	NA	6.24e-04
3. B	Q1ZXD6	Probable serine/threonine-protein kinase roco5	NA	NA	5.36e-15
3. B	Q09564	Protein phosphatase PHLPP-like protein	1.14e-04	NA	2.83e-08
3. B	Q70CT4	Receptor-like protein 8	2.88e-03	NA	0.023
3. B	D4AC13	Leucine-rich repeat-containing G-protein coupled receptor 5	5.16e-05	NA	3.40e-10
3. B	A0A290U7C4	Disease resistance protein Roq1	3.12e-03	NA	3.35e-04
3. B	Q00874	DNA damage-repair/toleration protein DRT100	8.01e-08	NA	2.57e-05
3. B	Q6P3Y9	Podocan-like protein 1	1.30e-05	NA	5.72e-06
3. B	O46390	Biglycan	2.57e-11	NA	0.011
3. B	Q8R502	Volume-regulated anion channel subunit LRRC8C	2.77e-08	NA	3.45e-13
3. B	Q9H156	SLIT and NTRK-like protein 2	2.52e-04	NA	4.74e-06
3. B	Q96JA1	Leucine-rich repeats and immunoglobulin-like domains protein 1	8.93e-04	NA	0.001
3. B	Q96II8	DISP complex protein LRCH3	1.99e-05	NA	7.84e-15
3. B	Q6P2D8	X-ray radiation resistance-associated protein 1	3.66e-03	NA	0.013
3. B	Q9M0G7	MDIS1-interacting receptor like kinase 1	3.27e-06	NA	9.62e-07
3. B	F4J339	Probable disease resistance protein RPP1	1.12e-02	NA	0.008
3. B	Q86VH4	Leucine-rich repeat transmembrane neuronal protein 4	1.09e-05	NA	1.86e-06
3. B	Q6ZH85	Plant intracellular Ras-group-related LRR protein 2	9.41e-08	NA	3.67e-16
3. B	Q8VDB8	Leucine-rich repeat-containing protein 2	2.53e-09	NA	3.85e-16
3. B	O64973	Disease resistance protein RPS5	1.59e-04	NA	0.013
3. B	Q6UXM1	Leucine-rich repeats and immunoglobulin-like domains protein 3	1.05e-03	NA	1.96e-06
3. B	Q54XZ5	Probable serine/threonine-protein kinase DDB_G0278509	1.09e-03	NA	2.34e-12
3. B	Q6PEZ8	Podocan-like protein 1	8.29e-06	NA	3.11e-04
3. B	Q810C1	SLIT and NTRK-like protein 1	2.36e-04	NA	0.002
3. B	Q9FII5	Leucine-rich repeat receptor-like protein kinase TDR	2.24e-04	NA	1.03e-04
3. B	P0CP22	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	2.96e-02	NA	3.30e-11
3. B	Q52KR2	Leucine-rich repeats and immunoglobulin-like domains protein 2	6.50e-04	NA	0.011
3. B	Q8VEG6	CCR4-NOT transcription complex subunit 6-like	2.65e-03	NA	1.08e-08
3. B	Q9SIT1	Receptor-like kinase TMK3	2.15e-04	NA	0.026
3. B	Q75BI3	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	3.45e-02	NA	1.54e-08
3. B	Q24020	Protein flightless-1	4.34e-04	NA	1.30e-13
3. B	I1Z695	LRR receptor-like serine/threonine-protein kinase ER2	2.55e-03	NA	6.53e-06
3. B	B4IBI9	Leucine-rich repeat protein soc-2 homolog	1.99e-06	NA	4.28e-18
3. B	Q9C8T9	Putative disease resistance protein At1g63350	1.91e-04	NA	0.033
3. B	Q2UUI3	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.29e-02	NA	4.03e-10
3. B	Q7XK44	Plant intracellular Ras-group-related LRR protein 3	2.03e-09	NA	4.78e-17
3. B	Q5E9X4	Leucine-rich repeat-containing protein 59	7.94e-04	NA	1.99e-07
3. B	Q3UQ28	Peroxidasin homolog	1.25e-01	NA	1.51e-05
3. B	Q6P1C6	Leucine-rich repeats and immunoglobulin-like domains protein 3	9.32e-04	NA	2.67e-05
3. B	B5UBC1	Disease resistance protein Pikm1-TS	3.22e-03	NA	4.18e-13
3. B	Q9LRV8	Plant intracellular Ras-group-related LRR protein 2	2.57e-09	NA	7.07e-17
3. B	Q9TTB4	Fibromodulin (Fragment)	1.42e-12	NA	2.84e-04
3. B	O75427	Leucine-rich repeat and calponin homology domain-containing protein 4	1.71e-06	NA	2.61e-16
3. B	Q7SXW3	Leucine-rich repeat-containing protein 40	5.05e-12	NA	7.55e-23
3. B	C0LGP4	Probable LRR receptor-like serine/threonine-protein kinase At3g47570	5.83e-04	NA	4.17e-05
3. B	O88520	Leucine-rich repeat protein SHOC-2	8.69e-12	NA	4.05e-19
3. B	Q6K7R2	Plant intracellular Ras-group-related LRR protein 6	4.68e-08	NA	2.02e-11
3. B	Q4UWF4	Uridine 5'-monophosphate transferase	1.33e-05	NA	1.37e-07
3. B	B0BLW3	Leucine-rich repeat-containing G-protein coupled receptor 4	2.33e-04	NA	2.84e-15
3. B	Q8N967	Leucine-rich repeat and transmembrane domain-containing protein 2	3.92e-06	NA	0.001
3. B	C0LGH2	Probable LRR receptor-like serine/threonine-protein kinase At1g56130	2.30e-04	NA	0.023
3. B	Q96L50	Leucine-rich repeat protein 1	2.50e-05	NA	4.46e-13
3. B	O35930	Platelet glycoprotein Ib alpha chain	2.18e-04	NA	0.003
3. B	Q4P9T3	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	2.21e-02	NA	8.81e-08
3. B	P14605	Adenylate cyclase	1.36e-02	NA	8.56e-04
3. B	Q9Z1P4	Leucine-rich repeat-containing G-protein coupled receptor 5	3.59e-04	NA	2.07e-10
3. B	A4IGL7	Peroxidasin	7.80e-02	NA	2.10e-05
3. B	C0LGT6	LRR receptor-like serine/threonine-protein kinase EFR	5.24e-03	NA	5.09e-04
3. B	Q55CS7	MAP kinase phosphatase with leucine-rich repeats protein 1	1.32e-05	NA	8.94e-13
3. B	Q42371	LRR receptor-like serine/threonine-protein kinase ERECTA	1.30e-03	NA	4.95e-05
3. B	Q9RBS2	Protein PopC	4.18e-05	NA	2.15e-16
3. B	Q9HB75	p53-induced death domain-containing protein 1	3.34e-04	NA	4.81e-15
3. B	C0LGW6	LRR receptor-like serine/threonine-protein kinase ERL1	1.93e-03	NA	9.38e-05
3. B	F4JT82	Probable disease resistance protein At4g19520	6.86e-02	NA	7.18e-05
3. B	B4N9T4	Leucine-rich repeat protein soc-2 homolog	5.23e-11	NA	6.38e-17
3. B	A1CW67	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.03e-02	NA	5.31e-10
3. B	Q5XH73	CCR4-NOT transcription complex subunit 6-like-B	1.20e-03	NA	0.003
3. B	Q3UV48	Leucine-rich repeat-containing protein 30	9.13e-12	NA	4.31e-16
3. B	B3P3E8	Leucine-rich repeat protein soc-2 homolog	1.07e-10	NA	9.94e-18
3. B	F1MCA7	Leucine-rich repeat-containing protein 7	2.95e-03	NA	6.43e-25
3. B	P0DL10	Leucine-rich repeat receptor-like kinase protein THICK TASSEL DWARF1	1.04e-03	NA	1.84e-08
3. B	Q9LY03	Probable LRR receptor-like serine/threonine-protein kinase IRK	2.76e-04	NA	5.53e-06
3. B	P0C7J6	Leucine-rich repeat and fibronectin type III domain-containing protein 1	1.23e-04	NA	0.018
3. B	Q7TQ62	Podocan	7.26e-06	NA	4.47e-06
3. B	Q9FHF0	Disease resistance protein RPS4B	1.63e-02	NA	6.94e-04
3. B	P21810	Biglycan	1.37e-11	NA	0.016
3. B	Q9LRW9	Receptor-like protein 40	7.53e-05	NA	3.79e-04
3. B	Q80TM9	Nischarin	4.16e-02	NA	0.003
3. B	A8JAM0	Dynein regulatory complex subunit 7 (Fragment)	7.58e-05	NA	7.81e-18
3. B	Q4R6F0	Leucine-rich repeat and death domain-containing protein 1	1.56e-09	NA	3.00e-24
3. B	Q96NW7	Leucine-rich repeat-containing protein 7	8.19e-04	NA	2.38e-25
3. B	Q6UWE0	E3 ubiquitin-protein ligase LRSAM1	4.48e-04	NA	9.63e-12
3. B	Q6NX28	Leucine-rich repeat-containing protein 59	1.24e-06	NA	4.61e-06
3. B	Q5R5V8	Relaxin receptor 1	8.88e-08	NA	4.44e-05
3. B	Q6DIQ3	Protein phosphatase 1 regulatory subunit 7	3.42e-10	NA	1.66e-06
3. B	Q27972	Chondroadherin	NA	NA	8.70e-07
3. B	F4HX15	Phospholipase A I	3.83e-02	NA	3.03e-06
3. B	Q8BVU0	DISP complex protein LRCH3	6.29e-06	NA	2.99e-14
3. B	Q8RXS5	Probable disease resistance protein At5g63020	1.98e-04	NA	0.018
3. B	Q8TDW0	Volume-regulated anion channel subunit LRRC8C	3.10e-08	NA	8.69e-12
3. B	Q38SD2	Leucine-rich repeat serine/threonine-protein kinase 1	2.48e-02	NA	1.00e-08
3. B	Q9SGP2	Receptor-like protein kinase HSL1	1.73e-04	NA	2.38e-04
3. B	Q55FD8	Ras guanine nucleotide exchange factor V	1.72e-03	NA	1.02e-14
3. B	A6NM62	Leucine-rich repeat-containing protein 53	2.91e-03	NA	0.007
3. B	C0LGG9	Probable LRR receptor-like serine/threonine-protein kinase At1g53440	3.50e-04	NA	1.44e-04
3. B	Q9BXB1	Leucine-rich repeat-containing G-protein coupled receptor 4	8.45e-04	NA	2.21e-14
3. B	E5DHB5	Leucine-rich repeat-containing G-protein coupled receptor 5A	1.06e-04	NA	2.02e-11
3. B	Q55CS8	MAP kinase phosphatase with leucine-rich repeats protein 2	6.89e-07	NA	2.89e-15
3. B	Q505F5	Leucine-rich repeat-containing protein 47	1.03e-05	NA	2.49e-09
3. B	O49328	Receptor like protein 26	7.50e-05	NA	0.014
3. B	Q9LJS0	Receptor-like protein 42	8.98e-05	NA	2.44e-04
3. B	Q96AG4	Leucine-rich repeat-containing protein 59	1.01e-03	NA	4.56e-07
3. B	Q8AVS8	Leucine-rich repeat-containing protein 59	1.51e-06	NA	1.73e-06
3. B	Q1PEN0	Receptor-like protein 36	8.43e-06	NA	6.45e-06
3. B	Q55E58	Probable serine/threonine-protein kinase pats1	NA	NA	3.21e-15
3. B	Q9LNV9	Receptor-like protein 1	1.88e-06	NA	0.001
3. B	Q54Y32	MAP kinase phosphatase with leucine-rich repeats protein 3	2.00e-05	NA	4.63e-15
3. B	A2ARI4	Leucine-rich repeat-containing G-protein coupled receptor 4	5.41e-04	NA	3.20e-14
3. B	Q6NU09	Volume-regulated anion channel subunit LRRC8E	5.93e-07	NA	1.28e-12
3. B	F4I2N7	Receptor-like protein kinase 7	3.75e-03	NA	4.73e-07
3. B	Q9C0I9	Leucine-rich repeat-containing protein 27	7.15e-04	NA	0.022
3. B	B7XK66	Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	4.17e-04	NA	4.62e-08
3. B	P07359	Platelet glycoprotein Ib alpha chain	1.69e-05	NA	0.004
3. B	P70587	Leucine-rich repeat-containing protein 7	5.60e-04	NA	9.90e-26
3. B	B4PU77	Leucine-rich repeat protein soc-2 homolog	5.13e-11	NA	1.10e-17
3. B	F4KHA2	Receptor-like protein 54	5.30e-05	NA	0.001
3. B	Q7XA40	Putative disease resistance protein RGA3	5.21e-04	NA	5.93e-04
3. B	Q96LI5	CCR4-NOT transcription complex subunit 6-like	3.41e-03	NA	0.005
3. B	Q4G017	Nischarin	2.77e-02	NA	0.003
3. B	Q7L0X0	TLR4 interactor with leucine rich repeats	4.80e-04	NA	2.48e-06
3. B	Q9EQP5	Prolargin	2.39e-09	NA	0.034
3. B	Q8L3R3	Disease resistance protein RFL1	1.50e-03	NA	1.14e-04
3. B	Q9FI14	Disease resistance protein TAO1	2.19e-05	NA	3.00e-04
3. B	C0LGF5	LRR receptor-like serine/threonine-protein kinase RGI5	5.71e-03	NA	1.52e-04
3. B	P0CC10	Leucine-rich repeat-containing protein 4B	1.28e-04	NA	0.002
3. B	A6H694	Leucine-rich repeat-containing protein 63	6.73e-05	NA	3.21e-12
3. B	Q9M9S4	Probable LRR receptor-like serine/threonine-protein kinase At1g14390	6.33e-05	NA	5.17e-06
3. B	P35859	Insulin-like growth factor-binding protein complex acid labile subunit	1.79e-05	NA	1.65e-06
3. B	Q9BGY6	Leucine-rich repeat-containing protein 53	3.11e-06	NA	8.74e-04
3. B	Q8K3P5	CCR4-NOT transcription complex subunit 6	4.50e-03	NA	1.05e-06
3. B	P51890	Lumican	7.45e-09	NA	2.35e-05
3. B	Q9SH22	Probable disease resistance protein At1g63360	1.29e-03	NA	0.023
3. B	Q9ERV7	p53-induced death domain-containing protein 1	1.27e-04	NA	1.02e-15
3. B	O48573	Disease resistance protein LAZ5	1.37e-02	NA	1.26e-05
3. B	D4A1J9	Leucine-rich repeat and fibronectin type-III domain-containing protein 5	7.09e-05	NA	0.015
3. B	P50609	Fibromodulin	1.19e-11	NA	1.28e-06
3. B	O74473	Septation initiation network scaffold protein cdc11	8.78e-04	NA	0.010
3. B	O94294	Leucine-rich repeat-containing protein sog2	1.83e-03	NA	1.58e-10
3. B	Q54M77	Probable serine/threonine-protein kinase roco8	1.83e-02	NA	1.54e-06
3. B	Q5Z9N5	Leucine-rich repeat receptor-like kinase protein FLORAL ORGAN NUMBER1	1.16e-03	NA	0.001
3. B	Q810B9	SLIT and NTRK-like protein 3	9.32e-04	NA	0.012
3. B	Q9Y4C4	Malignant fibrous histiocytoma-amplified sequence 1	9.53e-05	NA	9.83e-25
3. B	Q9C7S5	Tyrosine-sulfated glycopeptide receptor 1	3.69e-03	NA	2.04e-06
3. B	Q66JT1	Volume-regulated anion channel subunit LRRC8E	8.28e-07	NA	1.77e-14
3. B	Q9LHP4	LRR receptor-like serine/threonine-protein kinase RGI1	5.27e-03	NA	9.84e-06
3. B	Q14160	Protein scribble homolog	1.51e-03	NA	5.63e-23
3. B	Q6XHA7	Probable serine/threonine-protein kinase roco9	NA	NA	1.17e-13
3. B	P0DO09	Disease resistance protein Piks-1	3.95e-03	NA	4.14e-13
3. B	Q9SVW8	Plant intracellular Ras-group-related LRR protein 4	3.84e-09	NA	3.22e-18
3. B	F7D3V9	Leucine-rich repeat-containing G-protein coupled receptor 5	3.70e-05	NA	4.28e-11
3. B	A6H6A4	Leucine-rich repeat and IQ domain-containing protein 4	2.20e-12	NA	9.40e-21
3. B	Q6NUI6	Chondroadherin-like protein	4.24e-05	NA	1.15e-04
3. B	Q9SVN2	Receptor-like protein 47	1.99e-03	NA	3.91e-07
3. B	P17778	Outer membrane protein YopM	7.15e-11	NA	0.002
3. B	Q5RJR8	Leucine-rich repeat-containing protein 59	1.19e-03	NA	7.70e-07
3. B	Q1EA11	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.25e-02	NA	1.95e-09
3. B	P49606	Adenylate cyclase	8.56e-02	NA	1.26e-15
3. B	O81825	Probable disease resistance protein At4g27220	3.62e-04	NA	3.73e-08
3. B	O88280	Slit homolog 3 protein	4.36e-02	NA	3.07e-05
3. B	Q9FFJ3	Plant intracellular Ras-group-related LRR protein 1	1.10e-08	NA	7.54e-16
3. B	Q9M2Z1	Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2	2.21e-06	NA	3.76e-07
3. B	Q9WVB4	Slit homolog 3 protein	2.69e-02	NA	1.07e-05
3. B	Q9Z2H4	Leucine-rich repeat-containing G-protein coupled receptor 4	9.71e-04	NA	6.47e-14
3. B	Q6CEJ6	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.34e-02	NA	5.81e-06
3. B	P0DM44	Leucine-rich repeat-containing G-protein coupled receptor 6	3.46e-05	NA	5.10e-10
3. B	Q9VUN0	Toll-like receptor 6	6.31e-03	NA	4.34e-06
3. B	A0A0R0HPY5	Leucine-rich repeat receptor-like kinase protein CLV1a	1.96e-06	NA	3.45e-06
3. B	O82484	Putative disease resistance protein At4g10780	7.06e-04	NA	0.010
3. B	P35858	Insulin-like growth factor-binding protein complex acid labile subunit	1.40e-05	NA	1.23e-06
3. B	Q8BXA0	Leucine-rich repeat and fibronectin type-III domain-containing protein 5	2.56e-04	NA	0.016
3. B	O65440	Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3	3.24e-03	NA	1.47e-06
3. B	Q69SP5	LRR receptor-like serine/threonine-protein kinase ER1	3.94e-04	NA	4.09e-06
3. B	Q28888	Decorin	8.50e-12	NA	0.028
3. B	Q6WRH9	Immunoglobulin superfamily member 10	2.67e-01	NA	2.99e-06
3. B	F2VYU4	Disease resistance protein Pik-1	5.21e-03	NA	5.12e-13
3. B	P58823	Polygalacturonase inhibitor 3	4.03e-10	NA	0.004
3. B	D0ZVG2	E3 ubiquitin-protein ligase SspH1	1.21e-03	NA	0.002
3. B	A2BHJ4	CCR4-NOT transcription complex subunit 6-like	1.85e-03	NA	3.14e-08
3. B	D0ZPH9	E3 ubiquitin-protein ligase SspH2	1.81e-03	NA	3.76e-07
3. B	Q9M6A7	Leucine-rich repeat receptor-like kinase protein CLV1B	1.11e-03	NA	0.007
3. B	Q9FL51	Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940	9.48e-04	NA	0.016
3. B	Q9LK43	Receptor-like kinase TMK4	3.20e-03	NA	2.45e-04
3. B	P82963	Chaoptin (Fragment)	1.78e-05	NA	1.72e-05
3. B	F4J8G2	Receptor-like protein 33	1.20e-04	NA	7.70e-05
3. B	Q69JN6	Brassinosteroid LRR receptor kinase BRL1	1.12e-03	NA	8.71e-04
3. B	C0LGK9	Probable LRR receptor-like serine/threonine-protein kinase At2g24230	3.79e-07	NA	1.22e-05
3. B	O94991	SLIT and NTRK-like protein 5	4.41e-03	NA	1.76e-04
3. B	Q9SD62	Putative receptor-like protein kinase At3g47110	2.08e-03	NA	1.12e-05
3. B	Q9VPF0	Protein artichoke	1.21e-02	NA	4.07e-04
3. B	Q9FRS6	Leucine-rich repeat receptor-like protein kinase PXL1	2.55e-04	NA	1.31e-06
3. B	P08678	Adenylate cyclase	3.63e-04	NA	1.24e-12
3. B	Q9ZUK7	Receptor-like protein 18	2.80e-04	NA	4.80e-04
3. B	Q6PJG9	Leucine-rich repeat and fibronectin type-III domain-containing protein 4	1.74e-05	NA	0.038
3. B	P34268	Protein flightless-1 homolog	1.90e-04	NA	7.83e-13
3. B	P51887	Fibromodulin	1.60e-11	NA	1.31e-08
3. B	P0DO05	Receptor-like protein 9DC1	7.79e-04	NA	3.39e-04
3. B	P90920	Leucine-rich repeat-containing protein egg-6	1.17e-06	NA	0.027
3. B	Q8W4Q3	Plant intracellular Ras-group-related LRR protein 3	5.93e-08	NA	1.54e-15
3. B	P70389	Insulin-like growth factor-binding protein complex acid labile subunit	1.49e-05	NA	0.031
3. B	Q9SYQ8	Receptor protein kinase CLAVATA1	1.76e-04	NA	1.58e-05
3. B	Q9M9X0	Receptor-like protein 32	1.11e-03	NA	7.68e-04
3. B	O94769	Extracellular matrix protein 2	1.53e-08	NA	0.003
3. B	Q9IB75	Biglycan	9.54e-12	NA	2.11e-05
3. B	Q7XA42	Putative disease resistance protein RGA1	8.04e-04	NA	0.002
3. B	P36047	Protein phosphatase 1 regulatory subunit SDS22	3.13e-14	NA	4.46e-05
3. B	Q68F79	Volume-regulated anion channel subunit LRRC8E	4.87e-07	NA	6.30e-12
3. B	B4JTV9	Leucine-rich repeat protein soc-2 homolog	2.58e-11	NA	2.49e-17
3. B	Q6IR85	CCR4-NOT transcription complex subunit 6-like-A	1.10e-03	NA	0.004
3. B	Q9JJ28	Protein flightless-1 homolog	6.96e-04	NA	4.03e-10
3. B	V5NAL9	Toll-like receptor 4	8.77e-04	NA	8.20e-07
3. B	Q9FN37	Phytosulfokine receptor 2	2.71e-03	NA	4.42e-07
3. B	B0W6M9	Leucine-rich repeat protein soc-2 homolog	6.53e-11	NA	3.19e-17
3. B	Q6R6I6	Relaxin receptor 1	1.97e-07	NA	6.52e-05
3. B	Q2QZF2	Disease resistance protein PIK5-NP	2.68e-04	NA	5.03e-11
3. B	Q810B7	SLIT and NTRK-like protein 5	1.33e-03	NA	2.51e-04
3. B	Q9LRT1	Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040	3.27e-03	NA	0.002
3. B	O02833	Insulin-like growth factor-binding protein complex acid labile subunit	1.53e-05	NA	2.58e-06
3. B	O49325	Receptor like protein 28	2.99e-03	NA	0.027
3. B	Q922Q8	Leucine-rich repeat-containing protein 59	1.15e-03	NA	6.77e-07
3. B	Q5R7M3	Amphoterin-induced protein 2	2.91e-04	NA	2.27e-04
3. B	P58822	Polygalacturonase inhibitor 2	2.21e-10	NA	0.001
3. B	Q6JN46	Receptor-like protein EIX2	4.68e-04	NA	2.93e-06
3. B	O22476	Protein BRASSINOSTEROID INSENSITIVE 1	5.80e-03	NA	0.001
3. B	O14498	Immunoglobulin superfamily containing leucine-rich repeat protein	1.34e-05	NA	0.018
3. B	P0CB16	Putative disease resistance protein At4g19050	4.54e-04	NA	0.012
3. B	P0C192	Leucine-rich repeat-containing protein 4B	1.35e-04	NA	0.002
3. B	A4IIK1	Malignant fibrous histiocytoma-amplified sequence 1 homolog	1.56e-08	NA	3.83e-25
3. B	Q5DU41	Volume-regulated anion channel subunit LRRC8B	9.34e-09	NA	4.75e-09
3. B	Q5PP26	Piriformospora indica-insensitive protein 2	9.09e-08	NA	9.28e-07
3. B	Q9FK63	Calmodulin-binding receptor kinase CaMRLK	3.88e-05	NA	8.56e-04
3. B	O74874	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.37e-03	NA	8.74e-07
3. B	Q8SU52	Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	2.61e-03	NA	4.43e-05
3. B	Q9TZM3	Leucine-rich repeat serine/threonine-protein kinase 1	1.14e-01	NA	0.004
3. B	P58681	Toll-like receptor 7	2.87e-04	NA	3.51e-04
3. B	Q9LS80	Receptor-like protein 37	2.26e-04	NA	6.09e-07
3. B	P0CE12	E3 ubiquitin-protein ligase SspH2	1.80e-03	NA	3.76e-07
3. B	Q9V477	Toll-like receptor Tollo	3.10e-03	NA	6.43e-07
3. B	Q6ZVD8	PH domain leucine-rich repeat-containing protein phosphatase 2	3.94e-06	NA	7.47e-10
3. B	C0LGH3	Probable LRR receptor-like serine/threonine-protein kinase At1g56140	3.01e-04	NA	8.43e-04
3. B	Q9T048	Disease resistance protein At4g27190	1.02e-05	NA	7.06e-08
3. B	Q8C110	SLIT and NTRK-like protein 6	5.07e-04	NA	0.004
3. B	Q7XA39	Putative disease resistance protein RGA4	6.95e-04	NA	1.21e-04
3. B	B4QVR7	Leucine-rich repeat protein soc-2 homolog	1.80e-06	NA	1.63e-17
3. B	Q5A761	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	7.05e-03	NA	3.74e-10
3. B	Q6P9F7	Volume-regulated anion channel subunit LRRC8B	1.31e-08	NA	1.65e-09
3. B	Q9LRR4	Putative disease resistance RPP13-like protein 1	1.43e-03	NA	6.67e-05
3. B	Q6XHB2	Probable serine/threonine-protein kinase roco4	6.66e-01	NA	1.62e-05
3. B	Q8GUQ5	Brassinosteroid LRR receptor kinase	1.23e-02	NA	0.001
3. B	P24014	Protein slit	7.39e-02	NA	0.002
3. B	Q9LJW7	Receptor-like protein 43	8.18e-06	NA	0.012
3. B	P62046	Leucine-rich repeat and calponin homology domain-containing protein 1	1.29e-06	NA	2.57e-13
3. B	Q498T9	Volume-regulated anion channel subunit LRRC8C	2.24e-08	NA	4.07e-13
3. B	Q7FZR1	Receptor-like protein 52	7.27e-07	NA	0.010
3. B	Q9LT96	Probable leucine-rich repeat receptor-like protein kinase At5g49770	2.31e-03	NA	7.02e-04
3. B	Q4V8G0	Leucine-rich repeat-containing protein 63	7.12e-05	NA	5.51e-12
3. B	Q9S7I6	LRR receptor-like serine/threonine-protein kinase RPK2	1.50e-03	NA	5.02e-10
3. B	C0LGV1	LRR receptor-like serine/threonine-protein kinase RGI2	8.07e-03	NA	2.44e-05
3. B	Q8C0R9	Leucine-rich repeat and death domain-containing protein 1	1.26e-09	NA	2.71e-22
3. B	A4IFA6	Immunoglobulin superfamily containing leucine-rich repeat protein	1.73e-04	NA	0.001
3. B	C0LGU7	Protein MALE DISCOVERER 1	7.91e-02	NA	0.038
3. B	Q3KRC6	Volume-regulated anion channel subunit LRRC8E	5.71e-09	NA	3.76e-17
3. B	Q7XDQ7	Plant intracellular Ras-group-related LRR protein 8	1.58e-09	NA	2.31e-12
3. B	P51886	Lumican	6.40e-12	NA	7.39e-05
3. B	O94933	SLIT and NTRK-like protein 3	4.75e-04	NA	0.008
3. B	Q06828	Fibromodulin	1.29e-11	NA	2.44e-06
3. B	Q9VZZ4	Peroxidasin	4.57e-02	NA	0.003
3. B	Q921G6	Leucine-rich repeat and calponin homology domain-containing protein 4	1.11e-06	NA	2.54e-16
3. B	Q84WJ9	Protein phosphatase 1 regulatory inhibitor subunit PPP1R7 homolog	5.13e-10	NA	6.55e-07
3. B	Q0JA29	LRR receptor-like serine/threonine-protein kinase FLS2	7.37e-04	NA	2.25e-05
3. B	Q4V8I7	Volume-regulated anion channel subunit LRRC8A	1.34e-06	NA	5.14e-13
3. B	E7FE13	Leucine-rich repeat-containing G-protein coupled receptor 4	2.39e-04	NA	6.39e-13
3. B	C0LGJ1	Probable LRR receptor-like serine/threonine-protein kinase At1g74360	3.50e-04	NA	5.92e-04
3. B	Q9NYK1	Toll-like receptor 7	2.52e-04	NA	0.002
3. B	P23515	Oligodendrocyte-myelin glycoprotein	1.10e-07	NA	4.35e-05
3. B	F4J9A8	Receptor-like protein 45	2.48e-03	NA	0.026
3. B	A5PK13	Volume-regulated anion channel subunit LRRC8C	2.84e-08	NA	8.93e-12
3. B	C0LGQ5	LRR receptor-like serine/threonine-protein kinase GSO1	5.24e-03	NA	1.12e-08
3. B	Q5U308	Volume-regulated anion channel subunit LRRC8D	1.56e-06	NA	3.48e-18
3. B	Q496Z2	TLR4 interactor with leucine rich repeats	2.08e-04	NA	6.90e-06
3. B	Q8BXA7	PH domain leucine-rich repeat-containing protein phosphatase 2	4.43e-06	NA	7.61e-11
3. B	Q5B778	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	7.40e-03	NA	2.13e-09
3. B	Q3MHH9	Extracellular matrix protein 2	1.48e-08	NA	8.53e-04
3. B	P28675	Decorin	4.03e-12	NA	0.012
3. B	A4D1F6	Leucine-rich repeat and death domain-containing protein 1	1.92e-09	NA	2.11e-22
3. B	Q9SCX6	Disease resistance protein RPS4	4.35e-03	NA	0.032
3. B	P23466	Adenylate cyclase	1.41e-04	NA	3.76e-11
3. B	Q6XHA5	Probable serine/threonine-protein kinase roco11	4.26e-01	NA	0.002
3. B	Q5F4C4	Leucine-rich repeat protein SHOC-2	2.58e-12	NA	1.29e-18
3. B	O49318	Probable leucine-rich repeat receptor-like protein kinase At2g33170	7.83e-03	NA	1.18e-07
3. B	Q54TM7	Probable serine/threonine-protein kinase drkD	1.24e-02	NA	1.92e-12
3. B	F4JGB6	Receptor-like protein 46	2.91e-07	NA	2.90e-04
3. B	C0LGS2	Probable LRR receptor-like serine/threonine-protein kinase At4g36180	3.61e-04	NA	7.46e-08
3. B	Q9DE67	Lumican	8.13e-12	NA	2.39e-05
3. B	Q80WG5	Volume-regulated anion channel subunit LRRC8A	3.05e-06	NA	4.77e-13