Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 3. B was
Q96T75
(Down syndrome critical region protein 8) with a FATCAT P-Value: 1.44e-05 and RMSD of 1.28 angstrom. The sequence alignment identity is 28.7%.
Structural alignment shown in left. Query protein A6NIU2 colored as red in alignment, homolog Q96T75 colored as blue.
Query protein A6NIU2 is also shown in right top, homolog Q96T75 showed in right bottom. They are colored based on secondary structures.
A6NIU2 ME----RAQCLRKGILSFERSLEQRSLI-LSPRLEYSGAITAHCSLDL-----LDSTNPPASAFWV-VETT--DTEDEREKK----R-EITE-------- 74 Q96T75 MKEPGPNFVTVRKGLHSFKMAFVKHLLLFLSPRLECSGSITDHCSLHLPVQEIL-MSQPPEQ---LGLQTNLGNQESSGMMKLFMPRPKVLAQYESIQFM 96 A6NIU2 - 74 Q96T75 P 97
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0048706 | embryonic skeletal system development |
| 2. P | GO:0045597 | positive regulation of cell differentiation |
| 2. P | GO:0021766 | hippocampus development |
| 2. P | GO:0045746 | negative regulation of Notch signaling pathway |
| 2. P | GO:0003682 | chromatin binding |
| 2. P | GO:0071560 | cellular response to transforming growth factor beta stimulus |
| 2. P | GO:0021544 | subpallium development |
| 2. P | GO:0071773 | cellular response to BMP stimulus |
| 2. P | GO:0021893 | cerebral cortex GABAergic interneuron fate commitment |
| 2. P | GO:0009954 | proximal/distal pattern formation |
| 2. P | GO:0046533 | negative regulation of photoreceptor cell differentiation |
| 2. P | GO:0048715 | negative regulation of oligodendrocyte differentiation |
| 2. P | GO:1902871 | positive regulation of amacrine cell differentiation |
| 2. P | GO:1903845 | negative regulation of cellular response to transforming growth factor beta stimulus |
| 2. P | GO:0021879 | forebrain neuron differentiation |
| 2. P | GO:1990837 | sequence-specific double-stranded DNA binding |
| 2. P | GO:0043524 | negative regulation of neuron apoptotic process |
| 2. P | GO:0000977 | RNA polymerase II transcription regulatory region sequence-specific DNA binding |
| 2. P | GO:0021892 | cerebral cortex GABAergic interneuron differentiation |
| 2. P | GO:0030514 | negative regulation of BMP signaling pathway |
| 2. P | GO:0042475 | odontogenesis of dentin-containing tooth |
| 3. B | GO:0043014 | alpha-tubulin binding |
| 3. B | GO:0034613 | cellular protein localization |
| 3. B | GO:0016538 | cyclin-dependent protein serine/threonine kinase regulator activity |
| 3. B | GO:0034620 | cellular response to unfolded protein |
| 3. B | GO:0000307 | cyclin-dependent protein kinase holoenzyme complex |
| 3. B | GO:0060548 | negative regulation of cell death |
| 3. B | GO:0000185 | obsolete activation of MAPKKK activity |
| 3. B | GO:0021549 | cerebellum development |
| 3. B | GO:0046548 | retinal rod cell development |
| 3. B | GO:0004674 | protein serine/threonine kinase activity |
| 3. B | GO:0071501 | cellular response to sterol depletion |
| 3. B | GO:0031870 | thromboxane A2 receptor binding |
| 3. B | GO:0001650 | fibrillar center |
| 3. B | GO:0021532 | neural tube patterning |
| 3. B | GO:2001020 | regulation of response to DNA damage stimulus |
| 3. B | GO:0030544 | Hsp70 protein binding |
| 3. B | GO:0021670 | lateral ventricle development |
| 3. B | GO:0001889 | liver development |
| 3. B | GO:0008589 | regulation of smoothened signaling pathway |
| 3. B | GO:0044772 | mitotic cell cycle phase transition |
| 3. B | GO:0042157 | lipoprotein metabolic process |
| 3. B | GO:0021772 | olfactory bulb development |
| 3. B | GO:0032391 | photoreceptor connecting cilium |
| 3. B | GO:0006695 | cholesterol biosynthetic process |
| 3. B | GO:0005879 | axonemal microtubule |
| 3. B | GO:0000079 | regulation of cyclin-dependent protein serine/threonine kinase activity |
| 3. B | GO:0035116 | embryonic hindlimb morphogenesis |
| 3. B | GO:0007286 | spermatid development |
| 3. B | GO:0033365 | protein localization to organelle |
| 3. B | GO:0001736 | establishment of planar polarity |
| 3. B | GO:0097014 | ciliary plasm |
| 3. B | GO:0005813 | centrosome |
| 3. B | GO:0002177 | manchette |
| 3. B | GO:0010457 | centriole-centriole cohesion |
| 3. B | GO:0007368 | determination of left/right symmetry |
| 3. B | GO:0006468 | protein phosphorylation |
| 3. B | GO:0035115 | embryonic forelimb morphogenesis |
| 3. B | GO:0030299 | intestinal cholesterol absorption |
| 3. B | GO:0031489 | myosin V binding |
| 3. B | GO:0090102 | cochlea development |
| 3. B | GO:0045744 | negative regulation of G protein-coupled receptor signaling pathway |
| 3. B | GO:0036064 | ciliary basal body |
| 3. B | GO:0008349 | MAP kinase kinase kinase kinase activity |
| 3. B | GO:0007257 | obsolete activation of JUN kinase activity |
| 3. B | GO:1905515 | non-motile cilium assembly |
| 3. B | GO:0097225 | sperm midpiece |
| 3. B | GO:0043584 | nose development |
| 3. B | GO:0030301 | cholesterol transport |
| 3. B | GO:0035253 | ciliary rootlet |
| 3. B | GO:0044214 | spanning component of plasma membrane |
| 3. B | GO:0035869 | ciliary transition zone |
| 3. B | GO:0048487 | beta-tubulin binding |
| 3. B | GO:0022038 | corpus callosum development |
| 3. B | GO:1904628 | cellular response to phorbol 13-acetate 12-myristate |
| 3. B | GO:0051879 | Hsp90 protein binding |
| 3. B | GO:0007163 | establishment or maintenance of cell polarity |
| 3. B | GO:2000772 | regulation of cellular senescence |
| 3. B | GO:0060039 | pericardium development |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | A6NIU2 | Putative uncharacterized protein encoded by LINC01549 | 0 | 8.26e-145 | 5.13e-49 |
| 1. PB | A0A096LPI5 | Putative uncharacterized protein CCDC28A-AS1 | 1.41e-01 | 2.72e-03 | 7.18e-06 |
| 2. P | Q7Y618 | Uncharacterized 8.8 kDa protein in rps12-tRNA-Val intergenic region | 7.13e-04 | 1.77e-05 | NA |
| 2. P | Q64202 | Homeobox protein DLX-1 (Fragment) | 6.34e-03 | 1.41e-03 | NA |
| 3. B | Q68CZ1 | Protein fantom | 8.00e-01 | NA | 0.007 |
| 3. B | A6NJG6 | Arginine-fifty homeobox | 1.12e-01 | NA | 0.002 |
| 3. B | P51957 | Serine/threonine-protein kinase Nek4 | 7.71e-01 | NA | 1.03e-04 |
| 3. B | Q9UHC9 | NPC1-like intracellular cholesterol transporter 1 | 8.60e-01 | NA | 1.60e-06 |
| 3. B | Q8IV13 | Cyclin-J-like protein | 9.90e-02 | NA | 0.033 |
| 3. B | Q8N2A0 | Putative uncharacterized protein encoded by LINC00269 | 6.13e-01 | NA | 2.08e-05 |
| 3. B | Q9NXG0 | Centlein | 8.48e-01 | NA | 0.007 |
| 3. B | Q96MD7 | Uncharacterized protein C9orf85 | 3.21e-02 | NA | 0.011 |
| 3. B | Q8N9N2 | Activating signal cointegrator 1 complex subunit 1 | 4.17e-01 | NA | 1.11e-05 |
| 3. B | Q09FC8 | Zinc finger protein 415 | 9.61e-01 | NA | 0.001 |
| 3. B | Q96M98 | Parkin coregulated gene protein | 2.40e-01 | NA | 3.00e-06 |
| 3. B | F2Z398 | LMO7 downstream neighbor protein | 5.32e-02 | NA | 0.001 |
| 3. B | Q96T75 | Down syndrome critical region protein 8 | 1.44e-05 | NA | 4.93e-05 |
| 3. B | P78312 | Protein FAM193A | 6.09e-01 | NA | 0.002 |
| 3. B | Q5T7P6 | Transmembrane protein 78 | 1.22e-02 | NA | 3.52e-05 |
| 3. B | Q5H9K5 | Zinc finger matrin-type protein 1 | 5.07e-01 | NA | 1.88e-05 |
| 3. B | Q8WTZ3 | Zinc finger protein ENSP00000375192 | 1.59e-01 | NA | 0.002 |
| 3. B | Q92918 | Mitogen-activated protein kinase kinase kinase kinase 1 | 9.02e-01 | NA | 8.56e-04 |
| 3. B | Q9BUA6 | Myosin regulatory light chain 10 | 3.40e-01 | NA | 1.14e-05 |