Summary

A6NJG2

Homolog: Q7T2B9.
Function: Myotrophin.

Statistics

Total GO Annotation: 244
Unique PROST Go: 99
Unique BLAST Go: 131

Total Homologs: 125
Unique PROST Homologs: 47
Unique BLAST Homologs: 73

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q7T2B9 (Myotrophin) with a FATCAT P-Value: 3.86e-10 and RMSD of 1.83 angstrom. The sequence alignment identity is 13.5%.
Structural alignment shown in left. Query protein A6NJG2 colored as red in alignment, homolog Q7T2B9 colored as blue. Query protein A6NJG2 is also shown in right top, homolog Q7T2B9 showed in right bottom. They are colored based on secondary structures. 

  A6NJG2 MAQLGGAANRAPTASLAPTSQSLRCAPQPRPSRADTGSLGRYWGKAAAAASREHPFPGTLMHSAAGSGRRRGALRELLGLQRAAPAGWLSEERAEELGGP 100
  Q7T2B9 ---------------------------------------------------------------------------------------------------- 0

  A6NJG2 SGPGSSRLCLEPREHAWILAAAEGRYEVLRE-LLEAEPEL--LLRGDPITGYSVLHWLAKHGRHEELILVHDFALRRGLRLDVSAPGSGGLTPLHLAA-L 196
  Q7T2B9 --MGDKEL-------MWAL--KNGDLDEVKNILVKAE-DVNRTLEG----GRKPLHYAADCGQAEML----EFLLSKG--ADVNAPDKHGITPL-LSATY 77

  A6NJG2 QGHDMVIKVLVGALGADATRRDHSGHRACHYLRPDAPWRLRELSGAEEWEMESGSGCTNLNNNSSGTTAWRAASAVGATAVETSRRVAASRTKAKDTAGS 296
  Q7T2B9 EGHVTCVKILL-EKGADKNRKGPDGLSAFEAAESEA---IKAL--LE----------------------------------------------------- 118

  A6NJG2 RVAQMHSLFRHLFPSFQDR 315
  Q7T2B9 ------------------- 118

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0006511 ubiquitin-dependent protein catabolic process
1. PB GO:0016567 protein ubiquitination
1. PB GO:0039517 modulation by virus of host protein serine/threonine phosphatase activity
1. PB GO:0036371 protein localization to T-tubule
1. PB GO:0045732 positive regulation of protein catabolic process
1. PB GO:0035556 intracellular signal transduction
1. PB GO:0045893 positive regulation of transcription, DNA-templated
1. PB GO:0032088 negative regulation of NF-kappaB transcription factor activity
1. PB GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
1. PB GO:0055117 regulation of cardiac muscle contraction
1. PB GO:0005634 nucleus
1. PB GO:0007253 cytoplasmic sequestering of NF-kappaB
1. PB GO:0039513 suppression by virus of host catalytic activity
1. PB GO:0033209 tumor necrosis factor-mediated signaling pathway
2. P GO:0030198 extracellular matrix organization
2. P GO:0034142 toll-like receptor 4 signaling pathway
2. P GO:0036336 dendritic cell migration
2. P GO:0002455 humoral immune response mediated by circulating immunoglobulin
2. P GO:1901222 regulation of NIK/NF-kappaB signaling
2. P GO:0042771 intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
2. P GO:0000151 ubiquitin ligase complex
2. P GO:0042994 cytoplasmic sequestering of transcription factor
2. P GO:0032496 response to lipopolysaccharide
2. P GO:0032717 negative regulation of interleukin-8 production
2. P GO:0050729 positive regulation of inflammatory response
2. P GO:0032720 negative regulation of tumor necrosis factor production
2. P GO:0045859 regulation of protein kinase activity
2. P GO:0055007 cardiac muscle cell differentiation
2. P GO:0031625 ubiquitin protein ligase binding
2. P GO:0003713 transcription coactivator activity
2. P GO:0007249 I-kappaB kinase/NF-kappaB signaling
2. P GO:0071345 cellular response to cytokine stimulus
2. P GO:0045638 negative regulation of myeloid cell differentiation
2. P GO:0071931 positive regulation of transcription involved in G1/S transition of mitotic cell cycle
2. P GO:0042088 T-helper 1 type immune response
2. P GO:0008139 nuclear localization sequence binding
2. P GO:0051059 NF-kappaB binding
2. P GO:0032733 positive regulation of interleukin-10 production
2. P GO:0001947 heart looping
2. P GO:0003714 transcription corepressor activity
2. P GO:0010888 negative regulation of lipid storage
2. P GO:0044877 protein-containing complex binding
2. P GO:0030496 midbody
2. P GO:0032729 positive regulation of interferon-gamma production
2. P GO:0019887 protein kinase regulator activity
2. P GO:0042942 D-serine transport
2. P GO:0010468 regulation of gene expression
2. P GO:0085020 protein K6-linked ubiquitination
2. P GO:0042127 regulation of cell population proliferation
2. P GO:0140297 DNA-binding transcription factor binding
2. P GO:0030018 Z disc
2. P GO:0033309 SBF transcription complex
2. P GO:0002467 germinal center formation
2. P GO:0046426 negative regulation of receptor signaling pathway via JAK-STAT
2. P GO:1990756 ubiquitin ligase-substrate adaptor activity
2. P GO:0014732 skeletal muscle atrophy
2. P GO:0051101 regulation of DNA binding
2. P GO:0010745 negative regulation of macrophage derived foam cell differentiation
2. P GO:0002523 leukocyte migration involved in inflammatory response
2. P GO:0006878 cellular copper ion homeostasis
2. P GO:0019899 enzyme binding
2. P GO:0010875 positive regulation of cholesterol efflux
2. P GO:0055013 cardiac muscle cell development
2. P GO:0045746 negative regulation of Notch signaling pathway
2. P GO:0033257 Bcl3/NF-kappaB2 complex
2. P GO:0031466 Cul5-RING ubiquitin ligase complex
2. P GO:0070531 BRCA1-A complex
2. P GO:0043330 response to exogenous dsRNA
2. P GO:0031532 actin cytoskeleton reorganization
2. P GO:0061408 positive regulation of transcription from RNA polymerase II promoter in response to heat stress
2. P GO:0071356 cellular response to tumor necrosis factor
2. P GO:0031663 lipopolysaccharide-mediated signaling pathway
2. P GO:0010225 response to UV-C
2. P GO:0002315 marginal zone B cell differentiation
2. P GO:0030907 MBF transcription complex
2. P GO:0007283 spermatogenesis
2. P GO:0043392 negative regulation of DNA binding
2. P GO:0048536 spleen development
2. P GO:0035994 response to muscle stretch
2. P GO:2000031 regulation of salicylic acid mediated signaling pathway
2. P GO:0042981 regulation of apoptotic process
2. P GO:0042826 histone deacetylase binding
2. P GO:0045648 positive regulation of erythrocyte differentiation
2. P GO:0033256 I-kappaB/NF-kappaB complex
2. P GO:0032991 protein-containing complex
2. P GO:0032495 response to muramyl dipeptide
2. P GO:0005829 cytosol
2. P GO:0070427 nucleotide-binding oligomerization domain containing 1 signaling pathway
2. P GO:0006913 nucleocytoplasmic transport
2. P GO:0006606 protein import into nucleus
2. P GO:0030330 DNA damage response, signal transduction by p53 class mediator
2. P GO:2000022 regulation of jasmonic acid mediated signaling pathway
2. P GO:0070431 nucleotide-binding oligomerization domain containing 2 signaling pathway
2. P GO:0009615 response to virus
2. P GO:0002268 follicular dendritic cell differentiation
2. P GO:0042832 defense response to protozoan
2. P GO:0045064 T-helper 2 cell differentiation
2. P GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway
2. P GO:1902531 regulation of intracellular signal transduction
2. P GO:0031436 BRCA1-BARD1 complex
2. P GO:0045944 positive regulation of transcription by RNA polymerase II
2. P GO:0071407 cellular response to organic cyclic compound
2. P GO:0097602 cullin family protein binding
2. P GO:0035914 skeletal muscle cell differentiation
2. P GO:0039644 suppression by virus of host NF-kappaB cascade
2. P GO:0032996 Bcl3-Bcl10 complex
2. P GO:0071800 podosome assembly
2. P GO:0070417 cellular response to cold
2. P GO:0019730 antimicrobial humoral response
2. P GO:0010845 positive regulation of reciprocal meiotic recombination
2. P GO:0048145 regulation of fibroblast proliferation
2. P GO:0032270 positive regulation of cellular protein metabolic process
2. P GO:0030674 protein-macromolecule adaptor activity
3. B GO:0043491 protein kinase B signaling
3. B GO:0050772 positive regulation of axonogenesis
3. B GO:0043198 dendritic shaft
3. B GO:0019904 protein domain specific binding
3. B GO:0050775 positive regulation of dendrite morphogenesis
3. B GO:0031398 positive regulation of protein ubiquitination
3. B GO:0018345 protein palmitoylation
3. B GO:0032288 myelin assembly
3. B GO:0045111 intermediate filament cytoskeleton
3. B GO:0001934 positive regulation of protein phosphorylation
3. B GO:0048709 oligodendrocyte differentiation
3. B GO:0043034 costamere
3. B GO:0034703 cation channel complex
3. B GO:0032791 lead ion binding
3. B GO:0000079 regulation of cyclin-dependent protein serine/threonine kinase activity
3. B GO:0090263 positive regulation of canonical Wnt signaling pathway
3. B GO:1903779 regulation of cardiac conduction
3. B GO:0007638 mechanosensory behavior
3. B GO:0010218 response to far red light
3. B GO:0030334 regulation of cell migration
3. B GO:0000502 proteasome complex
3. B GO:0043052 thermotaxis
3. B GO:0031013 troponin I binding
3. B GO:0002091 negative regulation of receptor internalization
3. B GO:0005911 cell-cell junction
3. B GO:0006468 protein phosphorylation
3. B GO:0045663 positive regulation of myoblast differentiation
3. B GO:0018105 peptidyl-serine phosphorylation
3. B GO:0010761 fibroblast migration
3. B GO:0014044 Schwann cell development
3. B GO:0040040 thermosensory behavior
3. B GO:0106310 protein serine kinase activity
3. B GO:0007030 Golgi organization
3. B GO:0005929 cilium
3. B GO:0004842 ubiquitin-protein transferase activity
3. B GO:0048662 negative regulation of smooth muscle cell proliferation
3. B GO:0032956 regulation of actin cytoskeleton organization
3. B GO:0003208 cardiac ventricle morphogenesis
3. B GO:0043066 negative regulation of apoptotic process
3. B GO:2000812 regulation of barbed-end actin filament capping
3. B GO:0045669 positive regulation of osteoblast differentiation
3. B GO:0045737 positive regulation of cyclin-dependent protein serine/threonine kinase activity
3. B GO:0061630 ubiquitin protein ligase activity
3. B GO:0017124 SH3 domain binding
3. B GO:0097435 supramolecular fiber organization
3. B GO:0035304 regulation of protein dephosphorylation
3. B GO:0030308 negative regulation of cell growth
3. B GO:0019901 protein kinase binding
3. B GO:0001658 branching involved in ureteric bud morphogenesis
3. B GO:0050965 detection of temperature stimulus involved in sensory perception of pain
3. B GO:0005783 endoplasmic reticulum
3. B GO:0000902 cell morphogenesis
3. B GO:0140036 ubiquitin-dependent protein binding
3. B GO:0003190 atrioventricular valve formation
3. B GO:0030030 cell projection organization
3. B GO:0003151 outflow tract morphogenesis
3. B GO:0030950 establishment or maintenance of actin cytoskeleton polarity
3. B GO:0021675 nerve development
3. B GO:0050960 detection of temperature stimulus involved in thermoception
3. B GO:0007569 cell aging
3. B GO:0051897 positive regulation of protein kinase B signaling
3. B GO:0031286 negative regulation of sorocarp stalk cell differentiation
3. B GO:0043524 negative regulation of neuron apoptotic process
3. B GO:0080173 male-female gamete recognition during double fertilization forming a zygote and endosperm
3. B GO:0043195 terminal bouton
3. B GO:0032580 Golgi cisterna membrane
3. B GO:0061025 membrane fusion
3. B GO:0010564 regulation of cell cycle process
3. B GO:0050968 detection of chemical stimulus involved in sensory perception of pain
3. B GO:0000082 G1/S transition of mitotic cell cycle
3. B GO:0007160 cell-matrix adhesion
3. B GO:0007229 integrin-mediated signaling pathway
3. B GO:0031542 positive regulation of anthocyanin biosynthetic process
3. B GO:0043409 negative regulation of MAPK cascade
3. B GO:0009967 positive regulation of signal transduction
3. B GO:0022011 myelination in peripheral nervous system
3. B GO:0010378 temperature compensation of the circadian clock
3. B GO:0010313 phytochrome binding
3. B GO:0045197 establishment or maintenance of epithelial cell apical/basal polarity
3. B GO:0000209 protein polyubiquitination
3. B GO:0030027 lamellipodium
3. B GO:0090201 negative regulation of release of cytochrome c from mitochondria
3. B GO:0016601 Rac protein signal transduction
3. B GO:0005178 integrin binding
3. B GO:2000178 negative regulation of neural precursor cell proliferation
3. B GO:0010311 lateral root formation
3. B GO:0009567 double fertilization forming a zygote and endosperm
3. B GO:0006887 exocytosis
3. B GO:0010366 negative regulation of ethylene biosynthetic process
3. B GO:0016604 nuclear body
3. B GO:0086069 bundle of His cell to Purkinje myocyte communication
3. B GO:0034446 substrate adhesion-dependent cell spreading
3. B GO:0030335 positive regulation of cell migration
3. B GO:0001558 regulation of cell growth
3. B GO:0023041 neuronal signal transduction
3. B GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
3. B GO:0016409 palmitoyltransferase activity
3. B GO:0046957 negative phototaxis
3. B GO:0097604 temperature-gated cation channel activity
3. B GO:0043518 negative regulation of DNA damage response, signal transduction by p53 class mediator
3. B GO:0004672 protein kinase activity
3. B GO:0048812 neuron projection morphogenesis
3. B GO:0042327 positive regulation of phosphorylation
3. B GO:0070936 protein K48-linked ubiquitination
3. B GO:0070682 proteasome regulatory particle assembly
3. B GO:1901224 positive regulation of NIK/NF-kappaB signaling
3. B GO:0001725 stress fiber
3. B GO:0031267 small GTPase binding
3. B GO:0005925 focal adhesion
3. B GO:0008284 positive regulation of cell population proliferation
3. B GO:0030513 positive regulation of BMP signaling pathway
3. B GO:0106311
3. B GO:0004861 cyclin-dependent protein serine/threonine kinase inhibitor activity
3. B GO:0043406 positive regulation of MAP kinase activity
3. B GO:0009644 response to high light intensity
3. B GO:0001954 positive regulation of cell-matrix adhesion
3. B GO:0051726 regulation of cell cycle
3. B GO:0000062 fatty-acyl-CoA binding
3. B GO:0000139 Golgi membrane
3. B GO:0014912 negative regulation of smooth muscle cell migration
3. B GO:0006469 negative regulation of protein kinase activity
3. B GO:1904855 proteasome regulatory particle binding
3. B GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B GO:0042326 negative regulation of phosphorylation
3. B GO:0030307 positive regulation of cell growth
3. B GO:0010667 negative regulation of cardiac muscle cell apoptotic process
3. B GO:0019706 protein-cysteine S-palmitoyltransferase activity
3. B GO:1902412 regulation of mitotic cytokinesis
3. B GO:0045773 positive regulation of axon extension
3. B GO:0030017 sarcomere
3. B GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB O36972 IkB-like protein NA 2.38e-02 0.001
1. PB Q8BY98 Ankyrin repeat domain-containing protein SOWAHD 8.93e-07 1.10e-40 6.08e-102
1. PB A6NJG2 Ankyrin repeat domain-containing protein SOWAHD 0 4.04e-146 0.0
1. PB Q53LP3 Ankyrin repeat domain-containing protein SOWAHC 7.42e-06 5.53e-03 1.13e-30
1. PB Q8C0J6 Ankyrin repeat domain-containing protein SOWAHC 7.69e-05 8.31e-04 3.26e-32
2. P Q5I126 I-kappa-B like protein N2 NA 2.38e-02 NA
2. P Q91WK7 Ankyrin repeat domain-containing protein 54 2.52e-06 5.98e-08 NA
2. P Q9Z1E3 NF-kappa-B inhibitor alpha 1.39e-03 7.53e-07 NA
2. P Q6S5H5 POTE ankyrin domain family member G 1.05e-03 7.46e-03 NA
2. P Q5U2S6 Ankyrin repeat and SOCS box protein 2 4.71e-03 5.37e-04 NA
2. P Q91974 NF-kappa-B inhibitor alpha 1.28e-03 6.02e-07 NA
2. P Q5EA33 Ankyrin repeat domain-containing protein 49 1.64e-04 7.31e-03 NA
2. P Q810N6 Ankyrin repeat domain-containing protein 45 2.27e-03 1.10e-02 NA
2. P P25963 NF-kappa-B inhibitor alpha 1.55e-03 8.26e-08 NA
2. P P0C927 Ankyrin repeat and SOCS box protein 14 1.91e-04 1.39e-03 NA
2. P Q17QS6 Ankyrin repeat and SOCS box protein 5 5.17e-03 1.37e-02 NA
2. P B4E2M5 Ankyrin repeat domain-containing protein 66 1.41e-04 2.04e-11 NA
2. P Q5I160 I-Kappa-B like protein C1 NA 1.70e-02 NA
2. P Q08353 NF-kappa-B inhibitor alpha 7.09e-04 8.73e-07 NA
2. P Q9CQ31 Ankyrin repeat and SOCS box protein 11 6.47e-03 1.33e-02 NA
2. P Q8K0L0 Ankyrin repeat and SOCS box protein 2 2.98e-03 1.57e-03 NA
2. P P09959 Regulatory protein SWI6 1.84e-01 1.61e-03 NA
2. P Q862Z2 Ankyrin repeat and SOCS box protein 5 6.81e-03 1.73e-02 NA
2. P Q9D2X0 Ankyrin repeat domain-containing protein 39 5.77e-06 2.23e-02 NA
2. P Q9Z2F6 B-cell lymphoma 3 protein homolog 2.23e-04 2.00e-10 NA
2. P Q1LZC5 Ankyrin repeat domain-containing protein 54 7.61e-05 1.45e-08 NA
2. P Q6NXT1 Ankyrin repeat domain-containing protein 54 2.56e-04 1.75e-06 NA
2. P Q53RE8 Ankyrin repeat domain-containing protein 39 2.72e-07 1.39e-02 NA
2. P Q8WWX0 Ankyrin repeat and SOCS box protein 5 6.56e-03 8.07e-03 NA
2. P Q8WXH4 Ankyrin repeat and SOCS box protein 11 4.13e-03 1.80e-03 NA
2. P O54910 NF-kappa-B inhibitor epsilon 4.10e-04 1.91e-02 NA
2. P Q96BM1 Ankyrin repeat domain-containing protein 9 7.99e-04 1.20e-04 NA
2. P P0C965 IkB-like protein NA 2.89e-02 NA
2. P Q566C8 Ankyrin repeat domain-containing protein 54 6.17e-05 1.07e-09 NA
2. P Q4UKJ5 Putative ankyrin repeat protein RF_1081 3.29e-03 2.32e-06 NA
2. P O14593 DNA-binding protein RFXANK 6.06e-05 5.05e-03 NA
2. P Q5UPF3 Putative ankyrin repeat protein L81 NA 3.47e-03 NA
2. P Q5I149 I-Kappa-B like protein G1 NA 2.25e-02 NA
2. P Q91ZT7 Ankyrin repeat and SOCS box protein 10 1.97e-03 1.44e-02 NA
2. P Q9D1A4 Ankyrin repeat and SOCS box protein 5 4.49e-03 2.23e-02 NA
2. P Q6S545 POTE ankyrin domain family member H 1.35e-03 2.40e-03 NA
2. P Q8BH83 Ankyrin repeat domain-containing protein 9 1.05e-03 5.55e-04 NA
2. P P20749 B-cell lymphoma 3 protein 7.17e-03 2.11e-09 NA
2. P Q6DGX3 Ankyrin repeat domain-containing protein 54 2.72e-05 2.13e-08 NA
2. P Q63746 NF-kappa-B inhibitor alpha 5.64e-04 6.17e-07 NA
2. P Q96Q27 Ankyrin repeat and SOCS box protein 2 5.03e-03 5.75e-03 NA
2. P B2RU33 POTE ankyrin domain family member C 3.46e-03 6.55e-03 NA
2. P Q3SZE4 Ankyrin repeat and SOCS box protein 11 4.91e-03 1.54e-04 NA
2. P Q0JJ01 BTB/POZ domain and ankyrin repeat-containing protein NPR2 5.77e-02 3.97e-05 NA
2. P Q5RFS1 Ankyrin repeat and SOCS box protein 11 7.22e-03 4.85e-03 NA
2. P Q8WVL7 Ankyrin repeat domain-containing protein 49 1.57e-05 6.11e-03 NA
2. P Q8VE42 Ankyrin repeat domain-containing protein 49 1.36e-04 4.75e-03 NA
3. B Q6KAE5 Probable E3 ubiquitin-protein ligase XBOS32 1.27e-03 NA 0.008
3. B Q9BGT9 Ankyrin repeat and SOCS box protein 7 2.31e-04 NA 1.88e-04
3. B E1C656 E3 ubiquitin-protein ligase HACE1 1.84e-02 NA 2.15e-04
3. B Q8BZW2 Ankyrin repeat domain-containing protein SOWAHB 6.98e-05 NA 5.03e-20
3. B Q10311 Ankyrin repeat-containing protein C6C3.08 8.36e-07 NA 1.46e-04
3. B A9JR78 Tonsoku-like protein 2.09e-01 NA 0.012
3. B G0LXV8 Alpha-latrotoxin-Lh1a (Fragment) 2.18e-01 NA 1.98e-04
3. B Q9EP71 Ankycorbin 1.29e-02 NA 0.016
3. B Q6AWW5 Ankyrin repeat-containing protein At5g02620 1.41e-03 NA 8.16e-07
3. B Q8TC84 Fibronectin type 3 and ankyrin repeat domains protein 1 1.30e-03 NA 0.009
3. B Q6P9K8 Caskin-1 1.52e-01 NA 0.009
3. B A6NEL2 Ankyrin repeat domain-containing protein SOWAHB 1.32e-04 NA 1.06e-21
3. B O55222 Integrin-linked protein kinase 1.65e-03 NA 0.001
3. B Q94B55 Putative E3 ubiquitin-protein ligase XBAT31 1.75e-03 NA 0.003
3. B A3AYR1 Acyl-CoA-binding domain-containing protein 4 1.10e-03 NA 0.029
3. B Q86YJ7 Ankyrin repeat domain-containing protein 13B 1.09e-01 NA 0.017
3. B Q3SWY2 Integrin-linked protein kinase 1.02e-03 NA 0.001
3. B Q5ZLC6 Ankyrin repeat domain-containing protein 10 1.59e-03 NA 0.049
3. B Q9CZK6 Ankyrin repeat and SAM domain-containing protein 3 7.33e-03 NA 0.005
3. B Q5F259 Ankyrin repeat domain-containing protein 13B 9.82e-02 NA 0.019
3. B Q5RCK5 Ankyrin repeat and SOCS box protein 7 2.28e-04 NA 0.001
3. B Q9Z2X2 26S proteasome non-ATPase regulatory subunit 10 1.25e-05 NA 0.020
3. B Q9C7A2 Ankyrin repeat-containing protein ITN1 8.09e-02 NA 0.002
3. B Q8VHK2 Caskin-1 2.16e-01 NA 0.010
3. B Q7Z020 Transient receptor potential cation channel subfamily A member 1 1.40e-01 NA 0.015
3. B Q99J82 Integrin-linked protein kinase 7.32e-04 NA 0.001
3. B O15084 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A 4.73e-02 NA 7.02e-04
3. B Q7T2B9 Myotrophin 3.86e-10 NA 0.008
3. B Q60772 Cyclin-dependent kinase 4 inhibitor C 2.21e-07 NA 0.021
3. B Q91ZU0 Ankyrin repeat and SOCS box protein 7 2.00e-04 NA 1.75e-04
3. B Q8BTI7 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C 8.27e-02 NA 4.27e-04
3. B Q2M3V2 Ankyrin repeat domain-containing protein SOWAHA 4.38e-05 NA 7.26e-22
3. B Q8IYU2 E3 ubiquitin-protein ligase HACE1 1.55e-02 NA 5.83e-05
3. B Q8GYH5 Ankyrin repeat-containing protein BDA1 8.97e-05 NA 8.59e-05
3. B Q9HLN1 Putative ankyrin repeat protein Ta0196 2.89e-05 NA 0.024
3. B Q8NB46 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C 3.66e-02 NA 3.58e-04
3. B Q54F46 Homeobox protein Wariai 3.63e-02 NA 0.009
3. B Q9H672 Ankyrin repeat and SOCS box protein 7 2.19e-04 NA 1.78e-04
3. B Q7TQP6 Serine/threonine-protein kinase TNNI3K 6.59e-03 NA 0.025
3. B P42773 Cyclin-dependent kinase 4 inhibitor C 4.02e-06 NA 1.60e-05
3. B Q5ZIJ9 E3 ubiquitin-protein ligase MIB2 2.24e-02 NA 8.16e-04
3. B Q8BZ25 Ankyrin repeat and protein kinase domain-containing protein 1 1.76e-02 NA 0.030
3. B Q28BK1 E3 ubiquitin-protein ligase HACE1 1.35e-02 NA 8.31e-04
3. B D3ZBM7 E3 ubiquitin-protein ligase HACE1 1.33e-02 NA 2.03e-04
3. B P57044 Integrin-linked protein kinase 1.55e-03 NA 0.001
3. B P50086 Probable 26S proteasome regulatory subunit p28 1.15e-05 NA 0.007
3. B Q9XZC0 Alpha-latrocrustotoxin-Lt1a (Fragment) 2.70e-01 NA 0.009
3. B Q12013 Probable palmitoyltransferase AKR2 7.68e-03 NA 0.002
3. B P23631 Alpha-latrotoxin-Lt1a 6.80e-02 NA 0.001
3. B Q3U0D9 E3 ubiquitin-protein ligase HACE1 2.84e-02 NA 8.15e-05
3. B Q8WXD9 Caskin-1 1.44e-01 NA 0.015
3. B Q9Z2X3 26S proteasome non-ATPase regulatory subunit 10 1.19e-05 NA 0.002
3. B Q5ZLC8 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C 3.81e-02 NA 1.52e-04
3. B Q505D1 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A 5.14e-02 NA 7.67e-04
3. B O75832 26S proteasome non-ATPase regulatory subunit 10 4.92e-08 NA 5.88e-04
3. B F1N6G5 E3 ubiquitin-protein ligase HACE1 1.37e-02 NA 6.31e-05
3. B Q755Y0 Palmitoyltransferase AKR1 2.81e-02 NA 0.018
3. B Q8NFD2 Ankyrin repeat and protein kinase domain-containing protein 1 6.09e-03 NA 0.022
3. B Q9NXR5 Ankyrin repeat domain-containing protein 10 1.32e-03 NA 0.034
3. B Q9DF58 Integrin-linked protein kinase 3.26e-03 NA 7.23e-05
3. B F8W2M1 E3 ubiquitin-protein ligase HACE1 1.39e-02 NA 0.001
3. B Q6NLQ8 E3 ubiquitin-protein ligase XBAT32 2.76e-04 NA 0.048
3. B Q3V0J4 Ankyrin repeat domain-containing protein 53 4.79e-03 NA 0.004
3. B Q8BLS7 Ankyrin repeat domain-containing protein SOWAHA 7.61e-06 NA 5.49e-21
3. B Q6NRK3 Ankyrin repeat domain-containing protein SOWAHB 6.83e-04 NA 4.28e-22
3. B Q6DCL5 E3 ubiquitin-protein ligase HACE1 1.77e-02 NA 8.36e-04
3. B Q5R5V4 Integrin-linked protein kinase 1.67e-03 NA 0.001
3. B Q13418 Integrin-linked protein kinase 8.54e-04 NA 0.001
3. B Q9FNP4 Phytochrome-interacting ankyrin-repeat protein 2 2.26e-04 NA 0.003
3. B Q5M9H0 Ankyrin repeat and SAM domain-containing protein 3 2.06e-02 NA 0.045
3. B Q9STP8 Acyl-CoA-binding domain-containing protein 2 9.65e-04 NA 0.032
3. B Q04749 Target of rapamycin complex 2 subunit AVO2 1.82e-03 NA 2.23e-04
3. B Q9FF09 Phytochrome-interacting ankyrin-repeat protein 1 5.06e-05 NA 4.65e-04