Summary

A6NJI9

Homolog: A6H759.
Function: Leucine-rich repeat-containing protein 72.

Statistics

Total GO Annotation: 252
Unique PROST Go: 120
Unique BLAST Go: 77

Total Homologs: 246
Unique PROST Homologs: 137
Unique BLAST Homologs: 70

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was A6H759 (Leucine-rich repeat-containing protein 72) with a FATCAT P-Value: 2.1e-13 and RMSD of 2.70 angstrom. The sequence alignment identity is 83.9%.
Structural alignment shown in left. Query protein A6NJI9 colored as red in alignment, homolog A6H759 colored as blue. Query protein A6NJI9 is also shown in right top, homolog A6H759 showed in right bottom. They are colored based on secondary structures. 

  A6NJI9 MSWDPNPVPRTLRCWR-----LRRASETALQSSRRAVEDQLKICGHRRDADVFELFLSKKELTEVIDLSRFKKLKYLWLHHNKLHGITFLTRNYCLTELY 95
  A6H759 MARDPSHLPRA--C-RPPAIPVRVA-EAALEISRTAIEEQLKICGHKKDADVFELFLSQKELTEVIDLSRFKKLKYLWLHHNKLHGITFLTRNYCLAELY 96

  A6NJI9 LNNNAIFEIEGLHYLPSLHILLLHHNELTNIDATVKELKGMLNLKILSLYQNPLCQYNLYRLYIIYHLPGVELLDRNQVTEKERRSMITIFNHKKAHIVQ 195
  A6H759 LNNNAIFDIEGLHYLPSLHILLLHHNELINLDATVKELKGMLNLKTLTLYQNPLCQYNLYRLYIIYHLPGVELLDRNQVTEKERRSMITLFNHKKAHIVQ 196

  A6NJI9 SIAFGGKVDASWDPKSPFKQKPAQRVPSDFAFANNVDKTVLDDPEDAVFVRSMKRSVMTLTSMNWDTVPTREERYLEEEGTETAQMLTVTLR 287
  A6H759 SIAFRGKVDASWDPRSPFKQKPAQRVPSDFAFANNVDKTMFDDPEDAVFVRSMKRSAMAITSLNWDTVPTREEKYLEEKDTGPAQMLTITLR 288

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0043014 alpha-tubulin binding
1. PB GO:0005815 microtubule organizing center
1. PB GO:0030318 melanocyte differentiation
1. PB GO:0005874 microtubule
1. PB GO:0000398 mRNA splicing, via spliceosome
1. PB GO:0001750 photoreceptor outer segment
1. PB GO:0005686 U2 snRNP
1. PB GO:0003341 cilium movement
1. PB GO:0003305 cell migration involved in heart jogging
1. PB GO:0036157 outer dynein arm
1. PB GO:0042995 cell projection
1. PB GO:0070286 axonemal dynein complex assembly
1. PB GO:0071910 determination of liver left/right asymmetry
1. PB GO:0007023 post-chaperonin tubulin folding pathway
1. PB GO:0036158 outer dynein arm assembly
1. PB GO:0003314 heart rudiment morphogenesis
1. PB GO:0010921 regulation of phosphatase activity
1. PB GO:0003143 embryonic heart tube morphogenesis
1. PB GO:0030324 lung development
1. PB GO:0042769 obsolete DNA damage response, detection of DNA damage
1. PB GO:0071014 post-mRNA release spliceosomal complex
1. PB GO:0032391 photoreceptor connecting cilium
1. PB GO:0060271 cilium assembly
1. PB GO:0001947 heart looping
1. PB GO:2000155 positive regulation of cilium-dependent cell motility
1. PB GO:0070840 dynein complex binding
1. PB GO:0030532 small nuclear ribonucleoprotein complex
1. PB GO:0071007 U2-type catalytic step 2 spliceosome
1. PB GO:0060972 left/right pattern formation
1. PB GO:0000389 mRNA 3'-splice site recognition
1. PB GO:0071005 U2-type precatalytic spliceosome
1. PB GO:0003356 regulation of cilium beat frequency
1. PB GO:0005813 centrosome
1. PB GO:0002177 manchette
1. PB GO:0015630 microtubule cytoskeleton
1. PB GO:0036159 inner dynein arm assembly
1. PB GO:0071907 determination of digestive tract left/right asymmetry
1. PB GO:0006913 nucleocytoplasmic transport
1. PB GO:0097733 photoreceptor cell cilium
1. PB GO:0044458 motile cilium assembly
1. PB GO:0003779 actin binding
1. PB GO:0071013 catalytic step 2 spliceosome
1. PB GO:0040022 feminization of hermaphroditic germ-line
1. PB GO:0036064 ciliary basal body
1. PB GO:0007224 smoothened signaling pathway
1. PB GO:0005929 cilium
1. PB GO:0005930 axoneme
1. PB GO:0035469 determination of pancreatic left/right asymmetry
1. PB GO:0015631 tubulin binding
1. PB GO:0007010 cytoskeleton organization
1. PB GO:0030620 U2 snRNA binding
1. PB GO:0003146 heart jogging
1. PB GO:0051729 germline cell cycle switching, mitotic to meiotic cell cycle
1. PB GO:0045504 dynein heavy chain binding
1. PB GO:0005681 spliceosomal complex
2. P GO:0021540 corpus callosum morphogenesis
2. P GO:0014889 muscle atrophy
2. P GO:0043198 dendritic shaft
2. P GO:0038131 neuregulin receptor activity
2. P GO:0045121 membrane raft
2. P GO:0048874 host-mediated regulation of intestinal microbiota composition
2. P GO:0007626 locomotory behavior
2. P GO:0030424 axon
2. P GO:0007409 axonogenesis
2. P GO:0042043 neurexin family protein binding
2. P GO:0030517 negative regulation of axon extension
2. P GO:0015459 potassium channel regulator activity
2. P GO:0002091 negative regulation of receptor internalization
2. P GO:0030426 growth cone
2. P GO:0048589 developmental growth
2. P GO:0007021 tubulin complex assembly
2. P GO:0099054 presynapse assembly
2. P GO:0003431 growth plate cartilage chondrocyte development
2. P GO:0007052 mitotic spindle organization
2. P GO:0008344 adult locomotory behavior
2. P GO:0035025 positive regulation of Rho protein signal transduction
2. P GO:0048495 Roundabout binding
2. P GO:0099060 integral component of postsynaptic specialization membrane
2. P GO:0060076 excitatory synapse
2. P GO:0005615 extracellular space
2. P GO:0009986 cell surface
2. P GO:0009897 external side of plasma membrane
2. P GO:0099061 integral component of postsynaptic density membrane
2. P GO:0050896 response to stimulus
2. P GO:0050919 negative chemotaxis
2. P GO:0050808 synapse organization
2. P GO:0098978 glutamatergic synapse
2. P GO:0048936 peripheral nervous system neuron axonogenesis
2. P GO:0055013 cardiac muscle cell development
2. P GO:0052083 suppression by symbiont of host cell-mediated immune response
2. P GO:0010977 negative regulation of neuron projection development
2. P GO:0043005 neuron projection
2. P GO:0070062 extracellular exosome
2. P GO:0008076 voltage-gated potassium channel complex
2. P GO:0097113 AMPA glutamate receptor clustering
2. P GO:0071805 potassium ion transmembrane transport
2. P GO:0021670 lateral ventricle development
2. P GO:0098793 presynapse
2. P GO:0042635 positive regulation of hair cycle
2. P GO:0038023 signaling receptor activity
2. P GO:1905573 ganglioside GM1 binding
2. P GO:0005783 endoplasmic reticulum
2. P GO:0035418 protein localization to synapse
2. P GO:0061073 ciliary body morphogenesis
2. P GO:0030030 cell projection organization
2. P GO:1905606 regulation of presynapse assembly
2. P GO:1905576 ganglioside GT1b binding
2. P GO:0009791 post-embryonic development
2. P GO:0005856 cytoskeleton
2. P GO:0032911 negative regulation of transforming growth factor beta1 production
2. P GO:1990727 tubulin folding cofactor complex
2. P GO:0022038 corpus callosum development
2. P GO:0044074 negative regulation by symbiont of host translation
2. P GO:0099104 potassium channel activator activity
2. P GO:0043547 positive regulation of GTPase activity
2. P GO:0007411 axon guidance
2. P GO:0060291 long-term synaptic potentiation
2. P GO:0021960 anterior commissure morphogenesis
2. P GO:1902004 positive regulation of amyloid-beta formation
2. P GO:0060760 positive regulation of response to cytokine stimulus
2. P GO:0044295 axonal growth cone
2. P GO:0043486 histone exchange
2. P GO:1903818 positive regulation of voltage-gated potassium channel activity
2. P GO:0032281 AMPA glutamate receptor complex
2. P GO:0010165 response to X-ray
2. P GO:1904761 negative regulation of myofibroblast differentiation
2. P GO:0002224 toll-like receptor signaling pathway
2. P GO:0044325 transmembrane transporter binding
2. P GO:0031012 extracellular matrix
2. P GO:0008201 heparin binding
2. P GO:0031103 axon regeneration
2. P GO:0007166 cell surface receptor signaling pathway
2. P GO:0000226 microtubule cytoskeleton organization
2. P GO:0072578 neurotransmitter-gated ion channel clustering
2. P GO:0099055 integral component of postsynaptic membrane
2. P GO:0016604 nuclear body
2. P GO:0098685 Schaffer collateral - CA1 synapse
2. P GO:0031410 cytoplasmic vesicle
2. P GO:0019212 phosphatase inhibitor activity
2. P GO:0043395 heparan sulfate proteoglycan binding
2. P GO:0043204 perikaryon
2. P GO:0001817 regulation of cytokine production
2. P GO:0071004 U2-type prespliceosome
2. P GO:0023041 neuronal signal transduction
2. P GO:0022414 reproductive process
2. P GO:0038008 TRAF-mediated signal transduction
2. P GO:0031362 anchored component of external side of plasma membrane
2. P GO:0042393 histone binding
2. P GO:0048471 perinuclear region of cytoplasm
2. P GO:0090009 primitive streak formation
2. P GO:0051963 regulation of synapse assembly
2. P GO:0097009 energy homeostasis
2. P GO:0052170 suppression by symbiont of host innate immune response
2. P GO:0098982 GABA-ergic synapse
2. P GO:0048681 negative regulation of axon regeneration
2. P GO:0042981 regulation of apoptotic process
2. P GO:0051393 alpha-actinin binding
2. P GO:0051965 positive regulation of synapse assembly
2. P GO:0098868 bone growth
2. P GO:1901629 regulation of presynaptic membrane organization
2. P GO:0000812 Swr1 complex
2. P GO:0031102 neuron projection regeneration
2. P GO:0033644 host cell membrane
2. P GO:0099151 regulation of postsynaptic density assembly
2. P GO:0010811 positive regulation of cell-substrate adhesion
2. P GO:0048683 regulation of collateral sprouting of intact axon in response to injury
2. P GO:0050727 regulation of inflammatory response
2. P GO:0046658 anchored component of plasma membrane
2. P GO:0098686 hippocampal mossy fiber to CA3 synapse
2. P GO:0005249 voltage-gated potassium channel activity
2. P GO:0035374 chondroitin sulfate binding
2. P GO:0045211 postsynaptic membrane
2. P GO:0035640 exploration behavior
2. P GO:0030017 sarcomere
2. P GO:1901224 positive regulation of NIK/NF-kappaB signaling
3. B GO:0035082 axoneme assembly
3. B GO:1901970 positive regulation of mitotic sister chromatid separation
3. B GO:0018344 protein geranylgeranylation
3. B GO:0035904 aorta development
3. B GO:0044409 entry into host
3. B GO:0003351 epithelial cilium movement involved in extracellular fluid movement
3. B GO:0035307 positive regulation of protein dephosphorylation
3. B GO:0034451 centriolar satellite
3. B GO:0019903 protein phosphatase binding
3. B GO:0072542 protein phosphatase activator activity
3. B GO:0009553 embryo sac development
3. B GO:0090543 Flemming body
3. B GO:0120103 centriolar subdistal appendage
3. B GO:0120293 dynein axonemal particle
3. B GO:0004663 Rab geranylgeranyltransferase activity
3. B GO:0097431 mitotic spindle pole
3. B GO:0033566 gamma-tubulin complex localization
3. B GO:0007165 signal transduction
3. B GO:0048132 female germ-line stem cell asymmetric division
3. B GO:0048226 Casparian strip
3. B GO:0005524 ATP binding
3. B GO:0070433 negative regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway
3. B GO:0048793 pronephros development
3. B GO:0001822 kidney development
3. B GO:0007283 spermatogenesis
3. B GO:0072687 meiotic spindle
3. B GO:0004385 guanylate kinase activity
3. B GO:0060287 epithelial cilium movement involved in determination of left/right asymmetry
3. B GO:0060285 cilium-dependent cell motility
3. B GO:0120229 protein localization to motile cilium
3. B GO:0045433 male courtship behavior, veined wing generated song production
3. B GO:0090619 meiotic spindle pole
3. B GO:0051649 establishment of localization in cell
3. B GO:0071638 negative regulation of monocyte chemotactic protein-1 production
3. B GO:0099072 regulation of postsynaptic membrane neurotransmitter receptor levels
3. B GO:0060976 coronary vasculature development
3. B GO:0005176 ErbB-2 class receptor binding
3. B GO:0090651 apical cytoplasm
3. B GO:0042659 regulation of cell fate specification
3. B GO:0061512 protein localization to cilium
3. B GO:0072357 PTW/PP1 phosphatase complex
3. B GO:0010378 temperature compensation of the circadian clock
3. B GO:0090660 cerebrospinal fluid circulation
3. B GO:0045175 basal protein localization
3. B GO:0030056 hemidesmosome
3. B GO:0033365 protein localization to organelle
3. B GO:2000067 regulation of root morphogenesis
3. B GO:0005634 nucleus
3. B GO:0007099 centriole replication
3. B GO:0019888 protein phosphatase regulator activity
3. B GO:0008092 cytoskeletal protein binding
3. B GO:0008157 protein phosphatase 1 binding
3. B GO:0003281 ventricular septum development
3. B GO:0060294 cilium movement involved in cell motility
3. B GO:0043393 regulation of protein binding
3. B GO:0007051 spindle organization
3. B GO:0090708 specification of plant organ axis polarity
3. B GO:0008584 male gonad development
3. B GO:0060027 convergent extension involved in gastrulation
3. B GO:0005618 cell wall
3. B GO:0003279 cardiac septum development
3. B GO:0061458 reproductive system development
3. B GO:0031267 small GTPase binding
3. B GO:0046579 positive regulation of Ras protein signal transduction
3. B GO:0030317 flagellated sperm motility
3. B GO:0031514 motile cilium
3. B GO:0007368 determination of left/right symmetry
3. B GO:0032495 response to muramyl dipeptide
3. B GO:0005829 cytosol
3. B GO:0061371 determination of heart left/right asymmetry
3. B GO:0051493 regulation of cytoskeleton organization
3. B GO:0005968 Rab-protein geranylgeranyltransferase complex
3. B GO:0001669 acrosomal vesicle
3. B GO:0016607 nuclear speck
3. B GO:0000164 protein phosphatase type 1 complex
3. B GO:1904779 regulation of protein localization to centrosome
3. B GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q5EAD8 Leucine-rich repeat-containing protein 51 6.91e-07 6.17e-04 0.039
1. PB Q5BGW9 U2 small nuclear ribonucleoprotein A' 2.39e-05 5.31e-11 5.49e-05
1. PB Q6AXZ2 Leucine-rich repeat-containing protein 46 1.18e-06 1.29e-18 0.009
1. PB Q9XHH2 Dynein axonemal light chain 1 2.01e-11 4.15e-02 2.60e-04
1. PB Q9H2I8 Leucine-rich melanocyte differentiation-associated protein 1.55e-05 4.74e-11 3.72e-06
1. PB P43333 U2 small nuclear ribonucleoprotein A' 1.16e-07 5.03e-23 3.14e-08
1. PB Q8GRL7 Tubulin-folding cofactor E 2.18e-03 3.29e-03 0.013
1. PB Q8ILI6 Acidic leucine-rich nuclear phosphoprotein 32-related protein 2.82e-04 4.04e-06 0.006
1. PB Q7Z4L9 Protein phosphatase 1 regulatory subunit 42 2.80e-06 1.16e-18 0.003
1. PB Q91YK0 Leucine-rich repeat-containing protein 49 1.19e-03 5.50e-04 1.22e-04
1. PB Q8R1Z4 Protein phosphatase 1 regulatory subunit 42 8.59e-06 1.07e-23 0.015
1. PB Q6C417 U2 small nuclear ribonucleoprotein A' 4.27e-06 4.18e-09 1.52e-05
1. PB B6D5P6 Dynein axonemal assembly factor 1 3.89e-04 2.35e-05 3.25e-04
1. PB Q09JZ4 Leucine-rich repeat-containing protein ODA7 2.33e-04 4.60e-04 2.32e-05
1. PB O43822 Cilia- and flagella-associated protein 410 1.71e-04 2.64e-06 3.01e-04
1. PB Q9D9B4 Leucine-rich melanocyte differentiation-associated protein 4.76e-07 1.43e-21 5.11e-06
1. PB A6H759 Leucine-rich repeat-containing protein 72 2.10e-13 2.21e-91 0.0
1. PB Q6GQN5 Protein phosphatase 1 regulatory subunit 42 1.55e-09 3.31e-24 3.21e-04
1. PB P09661 U2 small nuclear ribonucleoprotein A' 1.77e-06 8.14e-30 2.79e-11
1. PB Q6BT60 U2 small nuclear ribonucleoprotein A' 3.03e-07 3.04e-20 5.40e-04
1. PB Q9USX8 U2 small nuclear ribonucleoprotein A' 4.54e-07 4.07e-28 4.08e-04
1. PB B6D5P1 Dynein axonemal assembly factor 1 2.77e-04 1.27e-05 1.44e-04
1. PB Q9BLB6 Probable U2 small nuclear ribonucleoprotein A' 1.04e-07 9.93e-29 3.65e-06
1. PB A6NJI9 Leucine-rich repeat-containing protein 72 0 2.12e-143 0.0
1. PB Q4P5F9 U2 small nuclear ribonucleoprotein A' 4.64e-07 7.58e-27 0.002
1. PB Q7ZV84 Dynein axonemal assembly factor 1 1.20e-03 6.08e-06 0.001
1. PB Q6AYH9 Dynein axonemal assembly factor 1 7.20e-04 3.28e-04 1.62e-04
1. PB Q4R8Y8 U2 small nuclear ribonucleoprotein A' 1.24e-06 8.14e-30 2.79e-11
1. PB Q4WV66 U2 small nuclear ribonucleoprotein A' 5.59e-07 1.11e-20 1.21e-04
1. PB Q9D2H9 Dynein axonemal assembly factor 1 7.36e-04 5.90e-03 8.27e-05
1. PB Q5PPX0 Protein phosphatase 1 regulatory subunit 42 5.00e-05 4.89e-30 7.31e-04
1. PB Q4R803 Protein phosphatase 1 regulatory subunit 42 2.20e-05 2.15e-27 0.010
1. PB P57784 U2 small nuclear ribonucleoprotein A' 3.91e-06 1.48e-30 1.49e-10
1. PB Q8C6G1 Cilia- and flagella-associated protein 410 8.26e-06 5.38e-11 0.013
1. PB Q9V4Q8 Probable U2 small nuclear ribonucleoprotein A' 1.31e-07 3.24e-25 3.68e-06
1. PB Q8IUZ0 Leucine-rich repeat-containing protein 49 1.26e-03 1.75e-02 3.28e-05
1. PB B6D5P3 Dynein axonemal assembly factor 1 5.26e-04 4.80e-04 1.36e-04
1. PB Q3SYS4 Dynein axonemal assembly factor 1 3.33e-04 1.54e-03 6.24e-04
1. PB Q9V895 Acidic leucine-rich nuclear phosphoprotein 32 family member A 1.83e-05 1.95e-02 0.007
2. P A4IHG1 Leucine-rich repeat-containing protein 58 2.03e-03 1.20e-04 NA
2. P Q8IYG6 Leucine-rich repeat-containing protein 56 1.32e-03 1.36e-02 NA
2. P Q9BY71 Leucine-rich repeat-containing protein 3 1.15e-03 8.63e-03 NA
2. P Q65YW8 Tsukushi-A 4.49e-03 7.90e-03 NA
2. P P83503 Nyctalopin 9.00e-03 9.74e-04 NA
2. P Q9H756 Leucine-rich repeat-containing protein 19 7.95e-03 1.20e-10 NA
2. P Q6FV04 U2 small nuclear ribonucleoprotein A' 1.44e-05 4.15e-21 NA
2. P Q32NT4 Leucine-rich repeat-containing protein 58 1.79e-03 1.50e-03 NA
2. P O01615 Acidic leucine-rich nuclear phosphoprotein 32-related protein 2 9.41e-05 3.41e-11 NA
2. P Q5F4A3 Acidic leucine-rich nuclear phosphoprotein 32 family member E 3.58e-06 1.11e-03 NA
2. P Q8N309 Leucine-rich repeat-containing protein 43 1.06e-03 6.64e-04 NA
2. P Q8BGA3 Leucine-rich repeat transmembrane neuronal protein 2 1.60e-02 8.43e-04 NA
2. P O43423 Acidic leucine-rich nuclear phosphoprotein 32 family member C 1.89e-08 3.32e-02 NA
2. P Q8N456 Leucine-rich repeat-containing protein 18 1.62e-03 8.48e-14 NA
2. P Q99PI8 Reticulon-4 receptor 1.83e-02 1.36e-06 NA
2. P Q387Y5 Leucine-rich repeat-containing protein 56 homolog 3.34e-03 7.00e-05 NA
2. P Q7ZUP0 Acidic leucine-rich nuclear phosphoprotein 32 family member A 2.85e-05 1.60e-02 NA
2. P Q5FVQ9 Tubulin-specific chaperone E 9.13e-04 1.52e-02 NA
2. P Q32KS0 Tubulin-specific chaperone E 1.68e-03 1.34e-02 NA
2. P Q99M75 Reticulon-4 receptor 1.45e-03 1.26e-06 NA
2. P P49911 Acidic leucine-rich nuclear phosphoprotein 32 family member A 2.16e-05 8.97e-04 NA
2. P O62220 Acidic leucine-rich nuclear phosphoprotein 32-related protein 1 8.18e-05 1.62e-09 NA
2. P Q4R747 Leucine-rich repeat-containing protein 46 2.44e-06 1.10e-21 NA
2. P Q5QJ74 Tubulin-specific chaperone cofactor E-like protein 6.81e-04 3.29e-09 NA
2. P Q5G5D8 Plant intracellular Ras-group-related LRR protein 7 1.22e-02 6.57e-03 NA
2. P Q86UN2 Reticulon-4 receptor-like 1 1.12e-02 6.85e-05 NA
2. P A1A4H9 Leucine-rich repeat transmembrane neuronal protein 1 1.12e-02 2.57e-04 NA
2. P Q8K375 Leucine-rich repeat-containing protein 56 1.97e-04 1.10e-03 NA
2. P Q8R2R5 Leucine-rich repeat-containing protein 61 3.72e-06 1.53e-25 NA
2. P Q8N967 Leucine-rich repeat and transmembrane domain-containing protein 2 1.10e-03 7.24e-03 NA
2. P P55456 Probable E3 ubiquitin-protein ligase NGR_a03640 1.43e-02 4.55e-02 NA
2. P Q5E9C0 Ras suppressor protein 1 1.67e-04 5.67e-03 NA
2. P Q9BV99 Leucine-rich repeat-containing protein 61 1.12e-06 4.95e-27 NA
2. P Q86UN3 Reticulon-4 receptor-like 2 1.33e-02 4.35e-02 NA
2. P O43300 Leucine-rich repeat transmembrane neuronal protein 2 9.11e-04 3.46e-04 NA
2. P Q9CQ07 Leucine-rich repeat-containing protein 18 5.53e-04 5.33e-14 NA
2. P Q6P7C4 Leucine-rich repeat-containing protein 26 8.19e-04 1.89e-05 NA
2. P P59034 Leucine-rich repeat-containing protein 3 7.17e-04 1.13e-02 NA
2. P Q7M6Z0 Reticulon-4 receptor-like 2 8.98e-03 2.12e-02 NA
2. P Q86UE6 Leucine-rich repeat transmembrane neuronal protein 1 2.03e-02 7.47e-05 NA
2. P D3ZAL8 Leucine-rich repeat transmembrane neuronal protein 3 3.24e-02 1.52e-04 NA
2. P Q8C5W3 Tubulin-specific chaperone cofactor E-like protein 7.05e-04 8.98e-08 NA
2. P Q8HY67 Acidic leucine-rich nuclear phosphoprotein 32 family member A NA 2.86e-03 NA
2. P Q24K06 Leucine-rich repeat-containing protein 10 3.54e-04 1.67e-04 NA
2. P B6CZ45 Leucine-rich repeat-containing protein 51 2.69e-09 1.61e-03 NA
2. P Q5R6B1 Leucine-rich repeat transmembrane neuronal protein 1 7.51e-03 6.41e-05 NA
2. P Q9N0E3 Reticulon-4 receptor 1.61e-02 2.32e-07 NA
2. P D4A7P2 Leucine-rich repeat transmembrane neuronal protein 2 1.08e-02 1.09e-03 NA
2. P P59035 Leucine-rich repeat-containing protein 3 1.11e-03 4.61e-03 NA
2. P Q08963 U2 small nuclear ribonucleoprotein A' 1.92e-07 1.94e-23 NA
2. P Q7ZY40 Acidic leucine-rich nuclear phosphoprotein 32 family member E 3.86e-07 8.53e-05 NA
2. P P97822 Acidic leucine-rich nuclear phosphoprotein 32 family member E 3.48e-05 5.14e-03 NA
2. P P39687 Acidic leucine-rich nuclear phosphoprotein 32 family member A 8.97e-09 4.13e-03 NA
2. P A8WHP9 Leucine-rich repeat-containing protein 3 1.22e-03 2.27e-03 NA
2. P D4A6D8 Leucine-rich repeat transmembrane neuronal protein 1 7.44e-03 4.60e-04 NA
2. P Q8BXQ3 Leucine-rich repeat and transmembrane domain-containing protein 1 5.33e-03 1.37e-03 NA
2. P Q86VH5 Leucine-rich repeat transmembrane neuronal protein 3 1.89e-02 1.37e-03 NA
2. P B6CZ54 Leucine-rich repeat-containing protein 51 2.26e-06 1.61e-03 NA
2. P Q8BZT5 Leucine-rich repeat-containing protein 19 5.52e-03 4.41e-08 NA
2. P P34390 Uncharacterized protein F09G8.5 4.52e-04 2.24e-04 NA
2. P Q15404 Ras suppressor protein 1 1.60e-04 1.34e-03 NA
2. P Q7Z2Q7 Leucine-rich repeat-containing protein 70 2.11e-03 3.97e-04 NA
2. P O75864 Protein phosphatase 1 regulatory subunit 37 2.44e-02 3.75e-02 NA
2. P Q6NUW5 Acidic leucine-rich nuclear phosphoprotein 32 family member E 9.71e-07 2.32e-06 NA
2. P Q4LDG9 Dynein axonemal light chain 1 3.03e-10 1.64e-02 NA
2. P P18009 Probable E3 ubiquitin-protein ligase ipaH4.5 3.83e-02 2.31e-02 NA
2. P O88186 Platelet glycoprotein IX 2.48e-02 2.49e-02 NA
2. P Q63912 Oligodendrocyte-myelin glycoprotein 3.70e-03 1.05e-03 NA
2. P Q7XNY1 Plant intracellular Ras-group-related LRR protein 1 6.05e-04 8.31e-06 NA
2. P P0CAE6 Transmembrane protein I329L NA 2.29e-03 NA
2. P Q9DAP0 Leucine-rich repeat-containing protein 46 1.48e-06 1.05e-16 NA
2. P Q01730 Ras suppressor protein 1 1.03e-03 1.22e-02 NA
2. P Q6PAF6 Acidic leucine-rich nuclear phosphoprotein 32 family member A 4.56e-05 4.99e-03 NA
2. P Q7S9P4 U2 small nuclear ribonucleoprotein A' 7.09e-07 2.41e-25 NA
2. P Q8N7C0 Leucine-rich repeat-containing protein 52 1.38e-03 1.03e-06 NA
2. P Q5RBD9 Tubulin-specific chaperone E 3.40e-03 1.16e-02 NA
2. P Q8BZ81 Leucine-rich repeat transmembrane neuronal protein 3 2.24e-02 2.46e-04 NA
2. P A6NIK2 Leucine-rich repeat-containing protein 10B 3.48e-03 4.28e-06 NA
2. P Q9BTT0 Acidic leucine-rich nuclear phosphoprotein 32 family member E 8.79e-08 2.63e-02 NA
2. P Q8K377 Leucine-rich repeat transmembrane neuronal protein 1 1.77e-02 4.90e-04 NA
2. P Q5M8M9 Leucine-rich repeat-containing protein 52 2.18e-03 1.97e-07 NA
2. P Q8K3W2 Leucine-rich repeat-containing protein 10 6.13e-04 5.16e-04 NA
2. P Q9GZU5 Nyctalopin 6.80e-03 2.71e-04 NA
2. P Q9BZR6 Reticulon-4 receptor 2.22e-02 1.95e-07 NA
2. P Q80XG9 Leucine-rich repeat transmembrane neuronal protein 4 1.57e-02 9.41e-05 NA
2. P Q6A1I3 Acidic leucine-rich nuclear phosphoprotein 32 family member B 2.28e-08 1.21e-02 NA
2. P P0CAE5 Transmembrane protein I329L NA 2.64e-03 NA
2. P Q6P1U7 Acidic leucine-rich nuclear phosphoprotein 32 family member B 4.86e-06 9.69e-03 NA
2. P Q66HD6 Leucine-rich repeat-containing protein 18 1.97e-04 9.76e-12 NA
2. P Q3U3V8 X-ray radiation resistance-associated protein 1 4.97e-02 3.40e-05 NA
2. P Q80WD0 Reticulon-4 receptor-like 1 1.95e-02 5.86e-04 NA
2. P Q2I0M4 Leucine-rich repeat-containing protein 26 4.25e-03 4.05e-03 NA
2. P Q91W20 Leucine-rich repeat-containing protein 26 2.43e-03 1.46e-06 NA
2. P Q5XIE0 Acidic leucine-rich nuclear phosphoprotein 32 family member E 4.49e-06 6.96e-03 NA
2. P Q8RWE5 Plant intracellular Ras-group-related LRR protein 8 2.61e-03 2.19e-05 NA
2. P P23515 Oligodendrocyte-myelin glycoprotein 5.09e-03 7.17e-03 NA
2. P Q05A62 Dynein axonemal light chain 1 1.84e-08 1.07e-02 NA
2. P Q4V8C9 Leucine-rich repeat-containing protein 56 9.29e-04 1.34e-03 NA
2. P P51122 Acidic leucine-rich nuclear phosphoprotein 32 family member A 1.03e-08 5.34e-03 NA
2. P Q86X40 Leucine-rich repeat-containing protein 28 2.64e-03 6.08e-06 NA
2. P Q5BKY1 Leucine-rich repeat-containing protein 10 5.73e-04 8.17e-04 NA
2. P Q2T9T5 Leucine-rich repeat-containing protein 61 3.58e-06 6.58e-32 NA
2. P Q3TX51 Leucine-rich repeat-containing protein 28 2.20e-03 1.97e-04 NA
2. P Q96FV0 Leucine-rich repeat-containing protein 46 1.01e-06 2.86e-19 NA
2. P A6H793 Leucine-rich repeat-containing protein 3 1.42e-03 2.61e-02 NA
2. P Q96E66 Leucine-rich repeat-containing protein 51 1.57e-09 4.72e-02 NA
2. P Q95JT3 Leucine-rich repeat-containing protein 43 1.16e-03 1.14e-02 NA
2. P Q755D2 U2 small nuclear ribonucleoprotein A' 4.82e-06 1.12e-18 NA
2. P Q65Z91 Tsukushi 1.31e-02 7.15e-06 NA
2. P Q8K0S5 Reticulon-4 receptor-like 1 2.03e-02 3.98e-05 NA
2. P Q3UGP9 Leucine-rich repeat-containing protein 58 5.30e-04 8.70e-06 NA
2. P Q15813 Tubulin-specific chaperone E 1.66e-03 1.38e-02 NA
2. P Q8AVC1 Acidic leucine-rich nuclear phosphoprotein 32 family member B 9.80e-13 1.74e-02 NA
2. P P27945 Transmembrane protein I329L NA 8.60e-04 NA
2. P Q5U508 Tubulin-specific chaperone E 1.59e-04 2.94e-02 NA
2. P Q8BGX3 Leucine-rich repeat and transmembrane domain-containing protein 2 9.04e-04 8.88e-03 NA
2. P Q10303 Cell polarity protein alp21 8.12e-04 9.59e-03 NA
2. P Q6GLE8 Leucine-rich repeat-containing protein 28 6.44e-03 4.60e-05 NA
2. P P0CAE4 Transmembrane protein I329L NA 1.68e-03 NA
2. P Q5UQX3 Putative leucine-rich repeat protein R380 NA 4.15e-02 NA
2. P Q5A449 U2 small nuclear ribonucleoprotein A' 2.03e-05 1.26e-27 NA
2. P Q5PQJ7 Tubulin-specific chaperone cofactor E-like protein 2.79e-04 1.18e-08 NA
2. P P39937 Protein PAC2 4.70e-03 1.89e-02 NA
2. P B4F7C5 Leucine-rich repeat transmembrane neuronal protein 4 1.59e-02 2.38e-04 NA
2. P Q9HBL6 Leucine-rich repeat and transmembrane domain-containing protein 1 2.35e-03 6.17e-04 NA
2. P Q80WD1 Reticulon-4 receptor-like 2 9.49e-03 1.22e-02 NA
2. P Q0V9Y8 Leucine-rich repeat-containing protein 42 1.52e-02 4.55e-02 NA
2. P Q96CX6 Leucine-rich repeat-containing protein 58 9.50e-04 5.16e-06 NA
2. P Q5U378 Tubulin-specific chaperone E 9.63e-04 1.63e-03 NA
2. P Q9BGP6 Leucine-rich repeat transmembrane neuronal protein 3 2.52e-02 1.37e-03 NA
2. P Q6P2D8 X-ray radiation resistance-associated protein 1 1.69e-01 1.31e-02 NA
2. P P14770 Platelet glycoprotein IX 2.33e-02 1.95e-03 NA
2. P B6CZ40 Leucine-rich repeat-containing protein 51 3.75e-05 4.23e-02 NA
2. P Q86QS6 Acidic leucine-rich nuclear phosphoprotein 32-related protein 3.69e-09 1.48e-02 NA
2. P Q86VH4 Leucine-rich repeat transmembrane neuronal protein 4 1.84e-02 2.86e-04 NA
2. P C3YZ59 Leucine-rich repeat-containing protein Bf66946 6.30e-03 1.54e-02 NA
2. P Q32KX5 Leucine-rich repeat-containing protein 28 4.82e-03 1.90e-06 NA
3. B Q6PEZ8 Podocan-like protein 1 2.39e-04 NA 0.001
3. B Q3UM45 Protein phosphatase 1 regulatory subunit 7 1.22e-09 NA 2.24e-06
3. B Q723X5 Internalin I 5.03e-01 NA 0.003
3. B A4IGL7 Peroxidasin 3.12e-01 NA 0.010
3. B Q9NJE9 Dynein axonemal assembly factor 11 6.34e-07 NA 2.62e-04
3. B Q1RMR5 Dynein axonemal assembly factor 11 3.51e-06 NA 1.03e-05
3. B B3DH20 Dynein axonemal assembly factor 11 5.43e-06 NA 1.04e-06
3. B Q8YA32 Internalin I 5.83e-02 NA 0.001
3. B A2AL36 Centriolin 2.72e-01 NA 0.001
3. B Q54Q39 Protein phosphatase 1 regulatory subunit pprA 3.35e-08 NA 3.45e-04
3. B Q9D3R3 Centrosomal protein of 72 kDa 4.47e-03 NA 2.64e-05
3. B Q9P209 Centrosomal protein of 72 kDa 2.57e-04 NA 2.78e-04
3. B B4GT53 Dynein axonemal assembly factor 1 homolog 1.20e-01 NA 0.001
3. B Q28CU0 Leucine-rich repeat-containing protein 23 3.98e-09 NA 0.023
3. B Q84WJ9 Protein phosphatase 1 regulatory inhibitor subunit PPP1R7 homolog 2.16e-09 NA 2.34e-04
3. B P71451 Internalin C 1.65e-03 NA 0.013
3. B G2K3G6 Internalin A 4.76e-03 NA 0.049
3. B Q1X8D7 Leucine-rich repeat-containing protein 36 1.85e-03 NA 7.13e-06
3. B Q5NVK5 Geranylgeranyl transferase type-2 subunit alpha 1.12e-06 NA 6.45e-06
3. B P0DJM0 Internalin A 5.11e-03 NA 0.039
3. B Q9FIZ3 LRR receptor-like serine/threonine-protein kinase GSO2 3.33e-01 NA 0.012
3. B P22194 Protein phosphatase 1 regulatory subunit SDS22 2.62e-08 NA 0.029
3. B Q3V0M2 Leucine-rich repeat-containing protein 36 1.64e-02 NA 9.94e-07
3. B A8IVX2 Dynein regulatory complex subunit 3 5.48e-05 NA 3.57e-10
3. B Q29KL8 Dynein axonemal assembly factor 1 homolog 6.44e-02 NA 0.001
3. B O88978 Dynein axonemal assembly factor 11 9.39e-08 NA 0.007
3. B A6QLV3 Leucine-rich repeat protein SHOC-2 2.42e-03 NA 0.018
3. B A0JM56 Leucine-rich repeat-containing protein 9 2.06e-02 NA 7.89e-08
3. B Q6ZRR7 Leucine-rich repeat-containing protein 9 1.33e-02 NA 3.34e-07
3. B Q32PL1 Protein phosphatase 1 regulatory subunit 7 7.99e-10 NA 0.037
3. B Q8T888 Dynein axonemal light chain 1 2.13e-08 NA 0.038
3. B Q9JHK4 Geranylgeranyl transferase type-2 subunit alpha 2.74e-07 NA 1.99e-05
3. B Q28XE2 Acidic leucine-rich nuclear phosphoprotein 32 family member A 6.60e-07 NA 0.014
3. B Q08602 Geranylgeranyl transferase type-2 subunit alpha 4.04e-07 NA 3.79e-06
3. B Q3V0L5 Leucine-rich repeat-containing protein 43 4.79e-03 NA 0.025
3. B A5A779 Geranylgeranyl transferase type-2 subunit alpha 2.88e-07 NA 7.33e-07
3. B Q5RAV5 Leucine-rich repeat protein SHOC-2 1.91e-03 NA 0.019
3. B Q16RY9 Dynein axonemal assembly factor 1 homolog 1.52e-02 NA 0.002
3. B Q96JM4 Leucine-rich repeat and IQ domain-containing protein 1 1.12e-01 NA 0.016
3. B Q8CDN9 Leucine-rich repeat-containing protein 9 6.37e-03 NA 1.76e-07
3. B Q5HZV9 Protein phosphatase 1 regulatory subunit 7 1.21e-09 NA 6.96e-06
3. B Q5RFS7 Protein phosphatase 1 regulatory subunit 7 1.10e-09 NA 1.03e-05
3. B Q4R6X9 Dynein regulatory complex subunit 3 5.98e-07 NA 3.54e-04
3. B Q15435 Protein phosphatase 1 regulatory subunit 7 1.12e-09 NA 1.96e-05
3. B A0A1L8G016 Dynein axonemal assembly factor 11 1.96e-06 NA 3.78e-06
3. B Q5EA80 Geranylgeranyl transferase type-2 subunit alpha 2.91e-07 NA 4.75e-07
3. B Q9D5E4 Dynein regulatory complex subunit 3 3.81e-07 NA 5.17e-05
3. B Q6NRC9 Leucine-rich repeat and coiled-coil domain-containing protein 1 2.68e-02 NA 0.001
3. B Q86X45 Dynein axonemal assembly factor 11 2.37e-06 NA 0.002
3. B Q7Z7A1 Centriolin 1.26e-02 NA 0.007
3. B Q6DIQ3 Protein phosphatase 1 regulatory subunit 7 6.90e-10 NA 6.81e-06
3. B P0DQD3 Internalin B 2.18e-02 NA 2.27e-04
3. B Q9H069 Dynein regulatory complex subunit 3 4.03e-07 NA 1.98e-04
3. B Q3T0W4 Protein phosphatase 1 regulatory subunit 7 1.18e-09 NA 5.70e-06
3. B Q501X2 Centrosomal protein of 72 kDa 1.25e-03 NA 1.07e-04
3. B Q9UQ13 Leucine-rich repeat protein SHOC-2 2.53e-03 NA 0.019
3. B Q723K6 Internalin A 4.23e-03 NA 0.024
3. B Q92696 Geranylgeranyl transferase type-2 subunit alpha 2.71e-07 NA 6.34e-06
3. B Q96RT1 Erbin 2.92e-01 NA 0.031
3. B Q96M69 Leucine-rich repeat and guanylate kinase domain-containing protein 1.08e-03 NA 2.72e-04
3. B O88520 Leucine-rich repeat protein SHOC-2 1.83e-03 NA 0.001
3. B Q4R3F0 Protein tilB homolog 2.43e-06 NA 0.007
3. B Q9D5S7 Leucine-rich repeat and guanylate kinase domain-containing protein 1.08e-03 NA 4.72e-04
3. B Q7PK92 Dynein axonemal assembly factor 1 homolog 3.56e-03 NA 5.86e-04
3. B Q6AYI5 Leucine-rich repeat protein SHOC-2 1.67e-03 NA 0.003
3. B Q28FY0 Dynein axonemal assembly factor 11 7.17e-06 NA 1.92e-05
3. B Q9VR52 Protein tilB 3.14e-08 NA 6.44e-04
3. B Q8NEP3 Dynein axonemal assembly factor 1 1.53e-03 NA 3.91e-04
3. B Q5XI54 Dynein regulatory complex subunit 3 4.49e-07 NA 1.27e-04
3. B P0DQD2 Internalin B 2.41e-02 NA 2.71e-04