Summary

A6NK44

Homolog: Q54L71.
Function: Glyoxalase domain-containing protein 5 homolog.

Statistics

Total GO Annotation: 30
Unique PROST Go: 22
Unique BLAST Go: 8

Total Homologs: 43
Unique PROST Homologs: 31
Unique BLAST Homologs: 3

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q54L71 (Glyoxalase domain-containing protein 5 homolog) with a FATCAT P-Value: 0.0 and RMSD of 0.52 angstrom. The sequence alignment identity is 45.8%.
Structural alignment shown in left. Query protein A6NK44 colored as red in alignment, homolog Q54L71 colored as blue. Query protein A6NK44 is also shown in right top, homolog Q54L71 showed in right bottom. They are colored based on secondary structures. 

  A6NK44 MLRHLPSRLPVKMWGRTLEKQSWRDSSQTPPPCLIRRLDHIVMTVKSIKDTTMFYSKILGMEVMTF-KE-DRKALCFGDQKFNLHEVGKEFEPKAAHPVP 98
  Q54L71 --------------------------------MFIDRLDHLVLTVSDIEKTCNFYENILGMKVITFGKDNERKALTFGNQKINLHKKGAEFEPKALLPTA 68

  A6NK44 GSLDICLITEVPLEEMIQHL--KACDVPIEEGPVPRTGA--KGPIMSIYFRDPDRNLIEVSNYISS 160
  Q54L71 GSADLCFITITPLHEVITELFQK--NITIEEGPCERTGALSK-PILSVYIRDPDYNLIEISNYK-- 129

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0046491 L-methylmalonyl-CoA metabolic process
2. P GO:0030316 osteoclast differentiation
2. P GO:0004462 lactoylglutathione lyase activity
2. P GO:0008270 zinc ion binding
2. P GO:0005739 mitochondrion
2. P GO:0046872 metal ion binding
2. P GO:0009438 methylglyoxal metabolic process
2. P GO:0006357 regulation of transcription by RNA polymerase II
2. P GO:0009651 response to salt stress
2. P GO:0019626 short-chain fatty acid catabolic process
2. P GO:0005975 carbohydrate metabolic process
2. P GO:0004493 methylmalonyl-CoA epimerase activity
2. P GO:0009579 thylakoid
2. P GO:0006749 glutathione metabolic process
2. P GO:0010319 stromule
2. P GO:0043177 organic acid binding
2. P GO:0005740 mitochondrial envelope
2. P GO:0031977 thylakoid lumen
2. P GO:0019243 methylglyoxal catabolic process to D-lactate via S-lactoyl-glutathione
2. P GO:0043066 negative regulation of apoptotic process
2. P GO:0009414 response to water deprivation
2. P GO:0005654 nucleoplasm
3. B GO:0030149 sphingolipid catabolic process
3. B GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
3. B GO:0019752 carboxylic acid metabolic process
3. B GO:0008117 sphinganine-1-phosphate aldolase activity
3. B GO:0019439 aromatic compound catabolic process
3. B GO:0018583 biphenyl-2,3-diol 1,2-dioxygenase activity
3. B GO:0008198 ferrous iron binding
3. B GO:0046677 response to antibiotic

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q28CR0 Glyoxalase domain-containing protein 5 0.00e+00 3.34e-57 1.57e-61
1. PB A0A0U2WCB2 Glyoxalase domain-containing protein RDO1 6.49e-13 1.65e-38 4.68e-41
1. PB P0C5H0 Glyoxalase domain-containing protein 5 0.00e+00 1.71e-30 5.38e-97
1. PB Q9D8I3 Glyoxalase domain-containing protein 5 0.00e+00 6.44e-28 1.38e-85
1. PB Q4KLB0 Glyoxalase domain-containing protein 5 8.88e-16 5.01e-51 1.82e-60
1. PB Q54L71 Glyoxalase domain-containing protein 5 homolog 0.00e+00 8.13e-09 7.12e-45
1. PB Q502D1 Glyoxalase domain-containing protein 5 3.33e-16 3.61e-56 5.03e-62
1. PB A6NK44 Glyoxalase domain-containing protein 5 0 6.21e-141 4.83e-118
1. PB Q8ZM36 Virulence protein STM3117 0.00e+00 6.48e-20 1.20e-46
2. P Q42891 Lactoylglutathione lyase 6.99e-06 1.24e-10 NA
2. P Q55595 Probable lactoylglutathione lyase 1.37e-07 3.79e-02 NA
2. P P52096 Uncharacterized protein YaeR 3.79e-08 7.14e-05 NA
2. P Q96PE7 Methylmalonyl-CoA epimerase, mitochondrial 4.77e-05 2.12e-20 NA
2. P O04885 Lactoylglutathione lyase 7.20e-06 4.51e-12 NA
2. P Q6P7Q4 Lactoylglutathione lyase 5.35e-06 6.04e-13 NA
2. P P37479 Uncharacterized protein YycE 9.03e-06 2.85e-06 NA
2. P Q9D1I5 Methylmalonyl-CoA epimerase, mitochondrial 5.14e-05 2.58e-20 NA
2. P P39586 Uncharacterized protein YwbC 1.17e-07 5.07e-03 NA
2. P Q9HU72 Lactoylglutathione lyase 4.84e-06 3.84e-11 NA
2. P Q06524 Protein SUE1, mitochondrial 6.32e-01 3.18e-02 NA
2. P Q553V2 Methylmalonyl-CoA epimerase, mitochondrial 3.10e-05 9.95e-19 NA
2. P P46235 Probable lactoylglutathione lyase 1.70e-07 2.72e-02 NA
2. P P9WKQ2 Uncharacterized protein MT0910 1.07e-06 1.89e-03 NA
2. P Q04760 Lactoylglutathione lyase 7.45e-06 2.37e-10 NA
2. P Q8W593 Probable lactoylglutathione lyase, chloroplastic 4.11e-04 9.87e-03 NA
2. P Q0D1P8 Lactoylglutathione lyase-like protein terB 1.53e-04 1.73e-14 NA
2. P Q9KT93 Probable lactoylglutathione lyase 2.06e-07 4.19e-02 NA
2. P P9WKQ3 Uncharacterized protein Rv0887c 1.47e-06 1.89e-03 NA
2. P Q8H0V3 Lactoylglutathione lyase 5.90e-06 1.63e-12 NA
2. P A0R6Q0 Uncharacterized protein MSMEG_6630 4.20e-06 1.29e-02 NA
2. P O49818 Lactoylglutathione lyase 3.09e-04 2.74e-11 NA
2. P A0A5C1RFE1 Glyoxylase-like domain-containing protein 2.37e-07 8.31e-03 NA
2. P Q9ZS21 Lactoylglutathione lyase 7.22e-06 1.08e-10 NA
2. P Q9CPU0 Lactoylglutathione lyase 1.83e-04 5.37e-12 NA
2. P P45871 Uncharacterized protein YwkD 5.33e-08 8.47e-03 NA
2. P Q8GPH6 Phenazine antibiotic resistance protein EhpR 5.87e-04 2.75e-08 NA
2. P Q9LV66 Uncharacterized protein At5g48480 4.75e-05 1.04e-07 NA
2. P Q2KIZ3 Methylmalonyl-CoA epimerase, mitochondrial 1.43e-05 3.72e-19 NA
2. P Q4R5F2 Lactoylglutathione lyase 6.97e-06 3.34e-10 NA
2. P P16635 Lactoylglutathione lyase 3.02e-06 4.20e-12 NA
3. B Q8CXK5 Metallothiol transferase FosB 1.02e-07 NA 3.29e-05
3. B Q52RG7 Sphingosine-1-phosphate lyase 8.10e-01 NA 0.006
3. B P47233 Biphenyl-2,3-diol 1,2-dioxygenase 3 2.56e-06 NA 0.005