Results | PROST

Summary

A6NKC9

Homolog: Q8BI17.
Function: SH2 domain-containing protein 7.

Statistics

Total GO Annotation: 603
Unique PROST Go: 105
Unique BLAST Go: 473

Total Homologs: 171
Unique PROST Homologs: 55
Unique BLAST Homologs: 110

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q8BI17 (SH2 domain-containing protein 7) with a FATCAT P-Value: 6.18e-06 and RMSD of 7.54 angstrom. The sequence alignment identity is 65.7%.
Structural alignment shown in left. Query protein A6NKC9 colored as red in alignment, homolog Q8BI17 colored as blue. Query protein A6NKC9 is also shown in right top, homolog Q8BI17 showed in right bottom. They are colored based on secondary structures.

  A6NKC9 MEDSLKQLSLGRDPEGAGDSQALAELQELALKWFMETQAPFILQNGALPPWFHGFITRKQTEQLLRDKALGSFLIRLSDRATGYILSYRGSDRCRHFVIN 100
  Q8BI17 MEGGPEQLHLGKALEEAGGGRALAEIQELALKWFMETQAPSILQNGVLPPWFHGFITRKQTEQLLRDKALGSFLIRLSDRAVGYILSYRGSDRCRHFVIN 100

  A6NKC9 QLRNRRYIISGDTQSHSTLAELVHHYQEAQLEPFKEMLTAACPRPEDNDLYDAITRGLHQTIVDPENPPATAFLTVVPDKAASPRSSPKPQVSFLHAQKS 200
  Q8BI17 QLRNRRYLVSGDTLSHSTLDELLRHYQEVQLEPFGETLAAACPRLEENDLYDAINTGLQHTNLS-LKIPATEFPSMLPDKATSPRLPAKPQVSFLH-KKA 198

  A6NKC9 LDVSPRNLSQEESMEAPIRVSPLPEKSSSLLEESFGGPSDIIYADLRRMNQARLGLGTE--GSGRHGPVPAGSQAYSPGREAQRRLSDGEQNRPDGLGPV 298
  Q8BI17 LDMSSRSVSDEVSAEVPTRVPPIPRRSPSLLDESPAGPSDVIYTDLRKINRAQLGLGTEVWGTLR--PASAGSLACSPGREPSGKLSDEDQNKPNSLGPA 296

  A6NKC9 LSGVSPDQGPTESP-TSWG-----CSDAMGSLGATWRQEFPKLSQEAQPCSQGSSADIYEFIGTEGLLQEARDTPDQEGSTYEQIPACWGGPARAPHPGA 392
  Q8BI17 PSGMKPDQGST-MPYTSLGFSLPPSSETLGSQATTWRQGFLKLSHEAQSSSEASSTDTYHLVETPGLQQEARDRPDQRGSPYEQIPTCWHGTAKLSYPGV 395

  A6NKC9 SPTYS----PWVHGYKRISGTPELSEPGNTYEQIPATKSKETGRTHKPDKLRRLFFTYRKHKF 451
  Q8BI17 SPTYSQQSGPMDYGYEKISGTSKLPEPGNTYEQIPAAKNKDTGRVHKPDKFRRLFFTDKKHKF 458

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0098978	glutamatergic synapse
1. PB	GO:0005159	insulin-like growth factor receptor binding
1. PB	GO:0030154	cell differentiation
1. PB	GO:0005158	insulin receptor binding
1. PB	GO:0008283	cell population proliferation
1. PB	GO:0008286	insulin receptor signaling pathway
1. PB	GO:0019901	protein kinase binding
1. PB	GO:0098962	regulation of postsynaptic neurotransmitter receptor activity
1. PB	GO:0048009	insulin-like growth factor receptor signaling pathway
1. PB	GO:0007409	axonogenesis
1. PB	GO:0045296	cadherin binding
1. PB	GO:0070372	regulation of ERK1 and ERK2 cascade
1. PB	GO:0051902	negative regulation of mitochondrial depolarization
1. PB	GO:0045793	positive regulation of cell size
1. PB	GO:0005068	transmembrane receptor protein tyrosine kinase adaptor activity
1. PB	GO:0008543	fibroblast growth factor receptor signaling pathway
1. PB	GO:0034332	adherens junction organization
1. PB	GO:0042169	SH2 domain binding
1. PB	GO:0005168	neurotrophin TRKA receptor binding
1. PB	GO:0030900	forebrain development
1. PB	GO:0030335	positive regulation of cell migration
1. PB	GO:0008355	olfactory learning
1. PB	GO:0007165	signal transduction
1. PB	GO:0043548	phosphatidylinositol 3-kinase binding
1. PB	GO:0003677	DNA binding
2. P	GO:0048653	anther development
2. P	GO:0035883	enteroendocrine cell differentiation
2. P	GO:0031087	deadenylation-independent decapping of nuclear-transcribed mRNA
2. P	GO:0050775	positive regulation of dendrite morphogenesis
2. P	GO:0045177	apical part of cell
2. P	GO:1903688	positive regulation of border follicle cell migration
2. P	GO:0045178	basal part of cell
2. P	GO:0007285	primary spermatocyte growth
2. P	GO:0010008	endosome membrane
2. P	GO:0045035	sensory organ precursor cell division
2. P	GO:0060250	germ-line stem-cell niche homeostasis
2. P	GO:0007399	nervous system development
2. P	GO:0007406	negative regulation of neuroblast proliferation
2. P	GO:0050778	positive regulation of immune response
2. P	GO:0014019	neuroblast development
2. P	GO:0019221	cytokine-mediated signaling pathway
2. P	GO:0000905	sporocarp development involved in asexual reproduction
2. P	GO:0050678	regulation of epithelial cell proliferation
2. P	GO:0035159	regulation of tube length, open tracheal system
2. P	GO:0019887	protein kinase regulator activity
2. P	GO:0120095	vacuole-isolation membrane contact site
2. P	GO:0061382	Malpighian tubule tip cell differentiation
2. P	GO:0019897	extrinsic component of plasma membrane
2. P	GO:0070795	positive regulation of conidiophore development
2. P	GO:0055059	asymmetric neuroblast division
2. P	GO:0005905	clathrin-coated pit
2. P	GO:0007405	neuroblast proliferation
2. P	GO:0050769	positive regulation of neurogenesis
2. P	GO:0048235	pollen sperm cell differentiation
2. P	GO:0007296	vitellogenesis
2. P	GO:0080090	regulation of primary metabolic process
2. P	GO:0009740	gibberellic acid mediated signaling pathway
2. P	GO:0046619	lens placode formation involved in camera-type eye formation
2. P	GO:0046622	positive regulation of organ growth
2. P	GO:0007185	transmembrane receptor protein tyrosine phosphatase signaling pathway
2. P	GO:0000290	deadenylation-dependent decapping of nuclear-transcribed mRNA
2. P	GO:1990019	protein storage vacuole organization
2. P	GO:0016323	basolateral plasma membrane
2. P	GO:0021670	lateral ventricle development
2. P	GO:0008595	anterior/posterior axis specification, embryo
2. P	GO:0000407	phagophore assembly site
2. P	GO:0061098	positive regulation of protein tyrosine kinase activity
2. P	GO:0015031	protein transport
2. P	GO:0009555	pollen development
2. P	GO:0010259	multicellular organism aging
2. P	GO:0034498	early endosome to Golgi transport
2. P	GO:0048655	anther wall tapetum morphogenesis
2. P	GO:0099150	regulation of postsynaptic specialization assembly
2. P	GO:0048133	male germ-line stem cell asymmetric division
2. P	GO:0005912	adherens junction
2. P	GO:0075307	positive regulation of conidium formation
2. P	GO:0008347	glial cell migration
2. P	GO:0002903	negative regulation of B cell apoptotic process
2. P	GO:0045294	alpha-catenin binding
2. P	GO:0030136	clathrin-coated vesicle
2. P	GO:0060527	prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis
2. P	GO:0051960	regulation of nervous system development
2. P	GO:0000750	pheromone-dependent signal transduction involved in conjugation with cellular fusion
2. P	GO:0045927	positive regulation of growth
2. P	GO:0045664	regulation of neuron differentiation
2. P	GO:0019211	phosphatase activator activity
2. P	GO:0030125	clathrin vesicle coat
2. P	GO:0071211	protein targeting to vacuole involved in autophagy
2. P	GO:0061964	negative regulation of entry into reproductive diapause
2. P	GO:0019538	protein metabolic process
2. P	GO:0042694	muscle cell fate specification
2. P	GO:0005634	nucleus
2. P	GO:0043068	positive regulation of programmed cell death
2. P	GO:0071255	Cvt vesicle assembly
2. P	GO:0030435	sporulation resulting in formation of a cellular spore
2. P	GO:0021849	neuroblast division in subventricular zone
2. P	GO:0006895	Golgi to endosome transport
2. P	GO:1902692	regulation of neuroblast proliferation
2. P	GO:0009786	regulation of asymmetric cell division
2. P	GO:0000045	autophagosome assembly
2. P	GO:0003281	ventricular septum development
2. P	GO:1990316	Atg1/ULK1 kinase complex
2. P	GO:0098817	evoked excitatory postsynaptic potential
2. P	GO:0045746	negative regulation of Notch signaling pathway
2. P	GO:0099149	regulation of postsynaptic neurotransmitter receptor internalization
2. P	GO:0001759	organ induction
2. P	GO:0043410	positive regulation of MAPK cascade
2. P	GO:0033132	negative regulation of glucokinase activity
2. P	GO:0005769	early endosome
2. P	GO:0005104	fibroblast growth factor receptor binding
2. P	GO:2000726	negative regulation of cardiac muscle cell differentiation
2. P	GO:0007295	growth of a germarium-derived egg chamber
2. P	GO:0061320	pericardial nephrocyte differentiation
2. P	GO:0001702	gastrulation with mouth forming second
2. P	GO:0042981	regulation of apoptotic process
2. P	GO:1903077	negative regulation of protein localization to plasma membrane
2. P	GO:0048315	conidium formation
2. P	GO:0035050	embryonic heart tube development
2. P	GO:0070787	conidiophore development
2. P	GO:0016360	sensory organ precursor cell fate determination
2. P	GO:0060487	lung epithelial cell differentiation
2. P	GO:0031588	nucleotide-activated protein kinase complex
2. P	GO:0071985	multivesicular body sorting pathway
2. P	GO:0001920	negative regulation of receptor recycling
2. P	GO:0030862	positive regulation of polarized epithelial cell differentiation
2. P	GO:0070307	lens fiber cell development
2. P	GO:0034059	response to anoxia
2. P	GO:0010897	negative regulation of triglyceride catabolic process
2. P	GO:0005938	cell cortex
2. P	GO:0008013	beta-catenin binding
3. B	GO:0036120	cellular response to platelet-derived growth factor stimulus
3. B	GO:1904531	positive regulation of actin filament binding
3. B	GO:0001570	vasculogenesis
3. B	GO:0043313	regulation of neutrophil degranulation
3. B	GO:0019904	protein domain specific binding
3. B	GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway
3. B	GO:0048709	oligodendrocyte differentiation
3. B	GO:0035254	glutamate receptor binding
3. B	GO:1903676	positive regulation of cap-dependent translational initiation
3. B	GO:0005080	protein kinase C binding
3. B	GO:0045314	regulation of compound eye photoreceptor development
3. B	GO:0006641	triglyceride metabolic process
3. B	GO:0002685	regulation of leukocyte migration
3. B	GO:0048659	smooth muscle cell proliferation
3. B	GO:1990782	protein tyrosine kinase binding
3. B	GO:0033120	positive regulation of RNA splicing
3. B	GO:0010459	negative regulation of heart rate
3. B	GO:1904393	regulation of skeletal muscle acetylcholine-gated channel clustering
3. B	GO:0038189	neuropilin signaling pathway
3. B	GO:0030010	establishment of cell polarity
3. B	GO:2000278	regulation of DNA biosynthetic process
3. B	GO:0002250	adaptive immune response
3. B	GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage
3. B	GO:0032743	positive regulation of interleukin-2 production
3. B	GO:2001237	negative regulation of extrinsic apoptotic signaling pathway
3. B	GO:0008180	COP9 signalosome
3. B	GO:0046638	positive regulation of alpha-beta T cell differentiation
3. B	GO:0048514	blood vessel morphogenesis
3. B	GO:0004725	protein tyrosine phosphatase activity
3. B	GO:2000573	positive regulation of DNA biosynthetic process
3. B	GO:0071498	cellular response to fluid shear stress
3. B	GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity
3. B	GO:0043149	stress fiber assembly
3. B	GO:0018105	peptidyl-serine phosphorylation
3. B	GO:0006468	protein phosphorylation
3. B	GO:0019903	protein phosphatase binding
3. B	GO:0060020	Bergmann glial cell differentiation
3. B	GO:0030168	platelet activation
3. B	GO:0032959	inositol trisphosphate biosynthetic process
3. B	GO:0045580	regulation of T cell differentiation
3. B	GO:0048008	platelet-derived growth factor receptor signaling pathway
3. B	GO:0043559	insulin binding
3. B	GO:0007172	signal complex assembly
3. B	GO:0050847	progesterone receptor signaling pathway
3. B	GO:0095500	acetylcholine receptor signaling pathway
3. B	GO:0002283	neutrophil activation involved in immune response
3. B	GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation
3. B	GO:0042110	T cell activation
3. B	GO:0016170	interleukin-15 receptor binding
3. B	GO:0042997	negative regulation of Golgi to plasma membrane protein transport
3. B	GO:0035264	multicellular organism growth
3. B	GO:0001726	ruffle
3. B	GO:0050885	neuromuscular process controlling balance
3. B	GO:0046488	phosphatidylinositol metabolic process
3. B	GO:0071074	eukaryotic initiation factor eIF2 binding
3. B	GO:2000588	positive regulation of platelet-derived growth factor receptor-beta signaling pathway
3. B	GO:0002333	transitional one stage B cell differentiation
3. B	GO:0046676	negative regulation of insulin secretion
3. B	GO:0010907	positive regulation of glucose metabolic process
3. B	GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity
3. B	GO:0051463	negative regulation of cortisol secretion
3. B	GO:0007416	synapse assembly
3. B	GO:0005154	epidermal growth factor receptor binding
3. B	GO:1902237	positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
3. B	GO:0005524	ATP binding
3. B	GO:0071803	positive regulation of podosome assembly
3. B	GO:0031748	D1 dopamine receptor binding
3. B	GO:0070555	response to interleukin-1
3. B	GO:0043542	endothelial cell migration
3. B	GO:0043254	regulation of protein-containing complex assembly
3. B	GO:0060338	regulation of type I interferon-mediated signaling pathway
3. B	GO:0050798	activated T cell proliferation
3. B	GO:0032753	positive regulation of interleukin-4 production
3. B	GO:0071398	cellular response to fatty acid
3. B	GO:0001775	cell activation
3. B	GO:0001878	response to yeast
3. B	GO:0033629	negative regulation of cell adhesion mediated by integrin
3. B	GO:0000405	bubble DNA binding
3. B	GO:0019722	calcium-mediated signaling
3. B	GO:0071404	cellular response to low-density lipoprotein particle stimulus
3. B	GO:0010863	positive regulation of phospholipase C activity
3. B	GO:0070064	proline-rich region binding
3. B	GO:0035091	phosphatidylinositol binding
3. B	GO:0034976	response to endoplasmic reticulum stress
3. B	GO:1903428	positive regulation of reactive oxygen species biosynthetic process
3. B	GO:0009395	phospholipid catabolic process
3. B	GO:0038083	peptidyl-tyrosine autophosphorylation
3. B	GO:0032725	positive regulation of granulocyte macrophage colony-stimulating factor production
3. B	GO:0032728	positive regulation of interferon-beta production
3. B	GO:0032211	negative regulation of telomere maintenance via telomerase
3. B	GO:0070102	interleukin-6-mediated signaling pathway
3. B	GO:0001922	B-1 B cell homeostasis
3. B	GO:0050429	calcium-dependent phospholipase C activity
3. B	GO:2000251	positive regulation of actin cytoskeleton reorganization
3. B	GO:0010506	regulation of autophagy
3. B	GO:0003151	outflow tract morphogenesis
3. B	GO:0007173	epidermal growth factor receptor signaling pathway
3. B	GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis
3. B	GO:0043366	beta selection
3. B	GO:0060907	positive regulation of macrophage cytokine production
3. B	GO:0031234	extrinsic component of cytoplasmic side of plasma membrane
3. B	GO:0045060	negative thymic T cell selection
3. B	GO:0002322	B cell proliferation involved in immune response
3. B	GO:0000400	four-way junction DNA binding
3. B	GO:0046632	alpha-beta T cell differentiation
3. B	GO:0014911	positive regulation of smooth muscle cell migration
3. B	GO:0071226	cellular response to molecule of fungal origin
3. B	GO:0032752	positive regulation of interleukin-3 production
3. B	GO:0051895	negative regulation of focal adhesion assembly
3. B	GO:0051385	response to mineralocorticoid
3. B	GO:0033673	negative regulation of kinase activity
3. B	GO:0005161	platelet-derived growth factor receptor binding
3. B	GO:0120183	positive regulation of focal adhesion disassembly
3. B	GO:0086098	angiotensin-activated signaling pathway involved in heart process
3. B	GO:0004713	protein tyrosine kinase activity
3. B	GO:0050765	negative regulation of phagocytosis
3. B	GO:0051492	regulation of stress fiber assembly
3. B	GO:0008069	dorsal/ventral axis specification, ovarian follicular epithelium
3. B	GO:0048839	inner ear development
3. B	GO:0002223	stimulatory C-type lectin receptor signaling pathway
3. B	GO:0048041	focal adhesion assembly
3. B	GO:0042307	positive regulation of protein import into nucleus
3. B	GO:0043409	negative regulation of MAPK cascade
3. B	GO:0051057	positive regulation of small GTPase mediated signal transduction
3. B	GO:0016477	cell migration
3. B	GO:0043274	phospholipase binding
3. B	GO:0016358	dendrite development
3. B	GO:0032331	negative regulation of chondrocyte differentiation
3. B	GO:0010632	regulation of epithelial cell migration
3. B	GO:0010447	response to acidic pH
3. B	GO:0042445	hormone metabolic process
3. B	GO:0043536	positive regulation of blood vessel endothelial cell migration
3. B	GO:0030331	estrogen receptor binding
3. B	GO:0007476	imaginal disc-derived wing morphogenesis
3. B	GO:0071901	negative regulation of protein serine/threonine kinase activity
3. B	GO:0001784	phosphotyrosine residue binding
3. B	GO:0051428	peptide hormone receptor binding
3. B	GO:0008022	protein C-terminus binding
3. B	GO:0070700	BMP receptor binding
3. B	GO:0010634	positive regulation of epithelial cell migration
3. B	GO:0038156	interleukin-3-mediated signaling pathway
3. B	GO:0070301	cellular response to hydrogen peroxide
3. B	GO:0005118	sevenless binding
3. B	GO:0060396	growth hormone receptor signaling pathway
3. B	GO:0090051	negative regulation of cell migration involved in sprouting angiogenesis
3. B	GO:0001945	lymph vessel development
3. B	GO:0051209	release of sequestered calcium ion into cytosol
3. B	GO:0051974	negative regulation of telomerase activity
3. B	GO:1900227	positive regulation of NLRP3 inflammasome complex assembly
3. B	GO:0002224	toll-like receptor signaling pathway
3. B	GO:0005178	integrin binding
3. B	GO:0004435	phosphatidylinositol phospholipase C activity
3. B	GO:0032735	positive regulation of interleukin-12 production
3. B	GO:0006661	phosphatidylinositol biosynthetic process
3. B	GO:0034644	cellular response to UV
3. B	GO:0044325	transmembrane transporter binding
3. B	GO:0070374	positive regulation of ERK1 and ERK2 cascade
3. B	GO:0016004	phospholipase activator activity
3. B	GO:2000145	regulation of cell motility
3. B	GO:0001843	neural tube closure
3. B	GO:2000811	negative regulation of anoikis
3. B	GO:0090330	regulation of platelet aggregation
3. B	GO:0032481	positive regulation of type I interferon production
3. B	GO:0002281	macrophage activation involved in immune response
3. B	GO:1901339	regulation of store-operated calcium channel activity
3. B	GO:0032148	activation of protein kinase B activity
3. B	GO:0071639	positive regulation of monocyte chemotactic protein-1 production
3. B	GO:0051281	positive regulation of release of sequestered calcium ion into cytosol
3. B	GO:2000096	positive regulation of Wnt signaling pathway, planar cell polarity pathway
3. B	GO:0050850	positive regulation of calcium-mediated signaling
3. B	GO:0046875	ephrin receptor binding
3. B	GO:0001953	negative regulation of cell-matrix adhesion
3. B	GO:1902808	positive regulation of cell cycle G1/S phase transition
3. B	GO:0003401	axis elongation
3. B	GO:0071902	positive regulation of protein serine/threonine kinase activity
3. B	GO:0038191	neuropilin binding
3. B	GO:0031333	negative regulation of protein-containing complex assembly
3. B	GO:0005942	phosphatidylinositol 3-kinase complex
3. B	GO:0071364	cellular response to epidermal growth factor stimulus
3. B	GO:0045579	positive regulation of B cell differentiation
3. B	GO:1900272	negative regulation of long-term synaptic potentiation
3. B	GO:0071103	DNA conformation change
3. B	GO:0045588	positive regulation of gamma-delta T cell differentiation
3. B	GO:0060017	parathyroid gland development
3. B	GO:0030183	B cell differentiation
3. B	GO:0060563	neuroepithelial cell differentiation
3. B	GO:0001558	regulation of cell growth
3. B	GO:0010803	regulation of tumor necrosis factor-mediated signaling pathway
3. B	GO:1901075	negative regulation of engulfment of apoptotic cell
3. B	GO:1900026	positive regulation of substrate adhesion-dependent cell spreading
3. B	GO:1903898	negative regulation of PERK-mediated unfolded protein response
3. B	GO:0001568	blood vessel development
3. B	GO:0033198	response to ATP
3. B	GO:0001764	neuron migration
3. B	GO:0030971	receptor tyrosine kinase binding
3. B	GO:0070373	negative regulation of ERK1 and ERK2 cascade
3. B	GO:1990314	cellular response to insulin-like growth factor stimulus
3. B	GO:0043393	regulation of protein binding
3. B	GO:0051491	positive regulation of filopodium assembly
3. B	GO:0051222	positive regulation of protein transport
3. B	GO:0021587	cerebellum morphogenesis
3. B	GO:2000394	positive regulation of lamellipodium morphogenesis
3. B	GO:0004672	protein kinase activity
3. B	GO:0098749	cerebellar neuron development
3. B	GO:0010923	negative regulation of phosphatase activity
3. B	GO:0099091	postsynaptic specialization, intracellular component
3. B	GO:0051602	response to electrical stimulus
3. B	GO:0050839	cell adhesion molecule binding
3. B	GO:2000386	positive regulation of ovarian follicle development
3. B	GO:0071253	connexin binding
3. B	GO:0033628	regulation of cell adhesion mediated by integrin
3. B	GO:2001286	regulation of caveolin-mediated endocytosis
3. B	GO:0005840	ribosome
3. B	GO:0061760	antifungal innate immune response
3. B	GO:0022408	negative regulation of cell-cell adhesion
3. B	GO:0038026	reelin-mediated signaling pathway
3. B	GO:0045931	positive regulation of mitotic cell cycle
3. B	GO:0021987	cerebral cortex development
3. B	GO:0090237	regulation of arachidonic acid secretion
3. B	GO:0045747	positive regulation of Notch signaling pathway
3. B	GO:0032747	positive regulation of interleukin-23 production
3. B	GO:0045061	thymic T cell selection
3. B	GO:0007162	negative regulation of cell adhesion
3. B	GO:0004726	non-membrane spanning protein tyrosine phosphatase activity
3. B	GO:0032528	microvillus organization
3. B	GO:0006606	protein import into nucleus
3. B	GO:0043406	positive regulation of MAP kinase activity
3. B	GO:0007362	terminal region determination
3. B	GO:0007167	enzyme linked receptor protein signaling pathway
3. B	GO:0005801	cis-Golgi network
3. B	GO:0035791	platelet-derived growth factor receptor-beta signaling pathway
3. B	GO:0032869	cellular response to insulin stimulus
3. B	GO:0086100	endothelin receptor signaling pathway
3. B	GO:1905555	positive regulation of blood vessel branching
3. B	GO:2000773	negative regulation of cellular senescence
3. B	GO:0000077	DNA damage checkpoint signaling
3. B	GO:0045453	bone resorption
3. B	GO:0045779	negative regulation of bone resorption
3. B	GO:0030516	regulation of axon extension
3. B	GO:0010976	positive regulation of neuron projection development
3. B	GO:0034236	protein kinase A catalytic subunit binding
3. B	GO:0021766	hippocampus development
3. B	GO:0044853	plasma membrane raft
3. B	GO:0034063	stress granule assembly
3. B	GO:0001545	primary ovarian follicle growth
3. B	GO:0048873	homeostasis of number of cells within a tissue
3. B	GO:0048011	neurotrophin TRK receptor signaling pathway
3. B	GO:0070851	growth factor receptor binding
3. B	GO:0014065	phosphatidylinositol 3-kinase signaling
3. B	GO:0036493	positive regulation of translation in response to endoplasmic reticulum stress
3. B	GO:0036312	phosphatidylinositol 3-kinase regulatory subunit binding
3. B	GO:0140031	phosphorylation-dependent protein binding
3. B	GO:0001934	positive regulation of protein phosphorylation
3. B	GO:0030220	platelet formation
3. B	GO:0032755	positive regulation of interleukin-6 production
3. B	GO:0035014	phosphatidylinositol 3-kinase regulator activity
3. B	GO:0007204	positive regulation of cytosolic calcium ion concentration
3. B	GO:0043125	ErbB-3 class receptor binding
3. B	GO:0001819	positive regulation of cytokine production
3. B	GO:0010641	positive regulation of platelet-derived growth factor receptor signaling pathway
3. B	GO:0018108	peptidyl-tyrosine phosphorylation
3. B	GO:0046887	positive regulation of hormone secretion
3. B	GO:0019815	B cell receptor complex
3. B	GO:0070884	regulation of calcineurin-NFAT signaling cascade
3. B	GO:0031623	receptor internalization
3. B	GO:2000641	regulation of early endosome to late endosome transport
3. B	GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
3. B	GO:0007265	Ras protein signal transduction
3. B	GO:0046935	1-phosphatidylinositol-3-kinase regulator activity
3. B	GO:1990441	negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
3. B	GO:0032587	ruffle membrane
3. B	GO:0002554	serotonin secretion by platelet
3. B	GO:0032733	positive regulation of interleukin-10 production
3. B	GO:0043069	negative regulation of programmed cell death
3. B	GO:0030032	lamellipodium assembly
3. B	GO:0005911	cell-cell junction
3. B	GO:0038127	ERBB signaling pathway
3. B	GO:0048668	collateral sprouting
3. B	GO:0002366	leukocyte activation involved in immune response
3. B	GO:0032026	response to magnesium ion
3. B	GO:0071396	cellular response to lipid
3. B	GO:0051707	response to other organism
3. B	GO:0002732	positive regulation of dendritic cell cytokine production
3. B	GO:0007338	single fertilization
3. B	GO:0004715	non-membrane spanning protein tyrosine kinase activity
3. B	GO:0010954	positive regulation of protein processing
3. B	GO:0033277	abortive mitotic cell cycle
3. B	GO:0046777	protein autophosphorylation
3. B	GO:0010592	positive regulation of lamellipodium assembly
3. B	GO:2000249	regulation of actin cytoskeleton reorganization
3. B	GO:0019370	leukotriene biosynthetic process
3. B	GO:0050764	regulation of phagocytosis
3. B	GO:0045785	positive regulation of cell adhesion
3. B	GO:0043066	negative regulation of apoptotic process
3. B	GO:0009612	response to mechanical stimulus
3. B	GO:0016303	1-phosphatidylinositol-3-kinase activity
3. B	GO:1904528	positive regulation of microtubule binding
3. B	GO:0098890	extrinsic component of postsynaptic membrane
3. B	GO:0032489	regulation of Cdc42 protein signal transduction
3. B	GO:0071393	cellular response to progesterone stimulus
3. B	GO:1990578	perinuclear endoplasmic reticulum membrane
3. B	GO:0005737	cytoplasm
3. B	GO:0090630	activation of GTPase activity
3. B	GO:0071560	cellular response to transforming growth factor beta stimulus
3. B	GO:0043306	positive regulation of mast cell degranulation
3. B	GO:0048384	retinoic acid receptor signaling pathway
3. B	GO:0007420	brain development
3. B	GO:0071375	cellular response to peptide hormone stimulus
3. B	GO:0098761	cellular response to interleukin-7
3. B	GO:0038128	ERBB2 signaling pathway
3. B	GO:0045780	positive regulation of bone resorption
3. B	GO:1904385	cellular response to angiotensin
3. B	GO:0038095	Fc-epsilon receptor signaling pathway
3. B	GO:0042995	cell projection
3. B	GO:0033146	regulation of intracellular estrogen receptor signaling pathway
3. B	GO:0002316	follicular B cell differentiation
3. B	GO:0051882	mitochondrial depolarization
3. B	GO:0030593	neutrophil chemotaxis
3. B	GO:0070489	T cell aggregation
3. B	GO:0043560	insulin receptor substrate binding
3. B	GO:0045624	positive regulation of T-helper cell differentiation
3. B	GO:0042101	T cell receptor complex
3. B	GO:0002862	negative regulation of inflammatory response to antigenic stimulus
3. B	GO:1903679	positive regulation of cap-independent translational initiation
3. B	GO:0002042	cell migration involved in sprouting angiogenesis
3. B	GO:0035265	organ growth
3. B	GO:0045671	negative regulation of osteoclast differentiation
3. B	GO:0009755	hormone-mediated signaling pathway
3. B	GO:0045087	innate immune response
3. B	GO:0035335	peptidyl-tyrosine dephosphorylation
3. B	GO:0051353	positive regulation of oxidoreductase activity
3. B	GO:0031954	positive regulation of protein autophosphorylation
3. B	GO:1905564	positive regulation of vascular endothelial cell proliferation
3. B	GO:0071222	cellular response to lipopolysaccharide
3. B	GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors
3. B	GO:0060576	intestinal epithelial cell development
3. B	GO:0051219	phosphoprotein binding
3. B	GO:1903076	regulation of protein localization to plasma membrane
3. B	GO:0097110	scaffold protein binding
3. B	GO:1904888	cranial skeletal system development
3. B	GO:0021697	cerebellar cortex formation
3. B	GO:0060325	face morphogenesis
3. B	GO:0051444	negative regulation of ubiquitin-protein transferase activity
3. B	GO:0070262	peptidyl-serine dephosphorylation
3. B	GO:0060368	regulation of Fc receptor mediated stimulatory signaling pathway
3. B	GO:2000352	negative regulation of endothelial cell apoptotic process
3. B	GO:0051497	negative regulation of stress fiber assembly
3. B	GO:1903912	negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation
3. B	GO:0010543	regulation of platelet activation
3. B	GO:2001243	negative regulation of intrinsic apoptotic signaling pathway
3. B	GO:0042476	odontogenesis
3. B	GO:0030159	signaling receptor complex adaptor activity
3. B	GO:0007229	integrin-mediated signaling pathway
3. B	GO:0032760	positive regulation of tumor necrosis factor production
3. B	GO:0045056	transcytosis
3. B	GO:1902533	positive regulation of intracellular signal transduction
3. B	GO:2000404	regulation of T cell migration
3. B	GO:0051020	GTPase binding
3. B	GO:0007465	R7 cell fate commitment
3. B	GO:0036035	osteoclast development
3. B	GO:0046641	positive regulation of alpha-beta T cell proliferation
3. B	GO:0009967	positive regulation of signal transduction
3. B	GO:0061582	intestinal epithelial cell migration
3. B	GO:0071774	response to fibroblast growth factor
3. B	GO:0060065	uterus development
3. B	GO:0048013	ephrin receptor signaling pathway
3. B	GO:0035325	Toll-like receptor binding
3. B	GO:0045059	positive thymic T cell selection
3. B	GO:0001678	cellular glucose homeostasis
3. B	GO:0031295	T cell costimulation
3. B	GO:0008293	torso signaling pathway
3. B	GO:0031625	ubiquitin protein ligase binding
3. B	GO:0005102	signaling receptor binding
3. B	GO:0035024	negative regulation of Rho protein signal transduction
3. B	GO:0007614	short-term memory
3. B	GO:1903977	positive regulation of glial cell migration
3. B	GO:2001020	regulation of response to DNA damage stimulus
3. B	GO:0009966	regulation of signal transduction
3. B	GO:0033690	positive regulation of osteoblast proliferation
3. B	GO:0032237	activation of store-operated calcium channel activity
3. B	GO:0006629	lipid metabolic process
3. B	GO:0032868	response to insulin
3. B	GO:0033137	negative regulation of peptidyl-serine phosphorylation
3. B	GO:0030027	lamellipodium
3. B	GO:1990051	activation of protein kinase C activity
3. B	GO:0043551	regulation of phosphatidylinositol 3-kinase activity
3. B	GO:0050773	regulation of dendrite development
3. B	GO:0033630	positive regulation of cell adhesion mediated by integrin
3. B	GO:0000287	magnesium ion binding
3. B	GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
3. B	GO:1990858	cellular response to lectin
3. B	GO:0051090	regulation of DNA-binding transcription factor activity
3. B	GO:0050852	T cell receptor signaling pathway
3. B	GO:0032715	negative regulation of interleukin-6 production
3. B	GO:0060125	negative regulation of growth hormone secretion
3. B	GO:0090050	positive regulation of cell migration involved in sprouting angiogenesis
3. B	GO:0032930	positive regulation of superoxide anion generation
3. B	GO:0006930	substrate-dependent cell migration, cell extension
3. B	GO:0007427	epithelial cell migration, open tracheal system
3. B	GO:0050853	B cell receptor signaling pathway
3. B	GO:0035635	entry of bacterium into host cell
3. B	GO:0032757	positive regulation of interleukin-8 production
3. B	GO:0060465	pharynx development
3. B	GO:0034446	substrate adhesion-dependent cell spreading
3. B	GO:0001655	urogenital system development
3. B	GO:0030707	ovarian follicle cell development
3. B	GO:1900103	positive regulation of endoplasmic reticulum unfolded protein response
3. B	GO:0010989	negative regulation of low-density lipoprotein particle clearance
3. B	GO:0060444	branching involved in mammary gland duct morphogenesis
3. B	GO:2000353	positive regulation of endothelial cell apoptotic process
3. B	GO:0022407	regulation of cell-cell adhesion
3. B	GO:0048609	multicellular organismal reproductive process
3. B	GO:0072359	circulatory system development
3. B	GO:1900275	negative regulation of phospholipase C activity
3. B	GO:0045500	sevenless signaling pathway
3. B	GO:0046854	phosphatidylinositol phosphate biosynthetic process
3. B	GO:0035306	positive regulation of dephosphorylation
3. B	GO:0097708	intracellular vesicle
3. B	GO:0001525	angiogenesis
3. B	GO:0051712	positive regulation of killing of cells of another organism
3. B	GO:0046628	positive regulation of insulin receptor signaling pathway
3. B	GO:0030833	regulation of actin filament polymerization
3. B	GO:0051894	positive regulation of focal adhesion assembly
3. B	GO:0007159	leukocyte cell-cell adhesion
3. B	GO:0038063	collagen-activated tyrosine kinase receptor signaling pathway
3. B	GO:0031113	regulation of microtubule polymerization
3. B	GO:0048538	thymus development
3. B	GO:0031334	positive regulation of protein-containing complex assembly
3. B	GO:0032009	early phagosome
3. B	GO:0035855	megakaryocyte development
3. B	GO:0046326	positive regulation of glucose import
3. B	GO:0048010	vascular endothelial growth factor receptor signaling pathway
3. B	GO:0007426	tracheal outgrowth, open tracheal system
3. B	GO:0001783	B cell apoptotic process
3. B	GO:0005925	focal adhesion
3. B	GO:1900182	positive regulation of protein localization to nucleus
3. B	GO:0004629	phospholipase C activity
3. B	GO:1903721	positive regulation of I-kappaB phosphorylation
3. B	GO:0010656	negative regulation of muscle cell apoptotic process
3. B	GO:0019902	phosphatase binding
3. B	GO:0046888	negative regulation of hormone secretion
3. B	GO:0048806	genitalia development
3. B	GO:0010628	positive regulation of gene expression
3. B	GO:0150078	positive regulation of neuroinflammatory response
3. B	GO:0032991	protein-containing complex
3. B	GO:0005829	cytosol
3. B	GO:0005943	phosphatidylinositol 3-kinase complex, class IA
3. B	GO:0046872	metal ion binding
3. B	GO:0045582	positive regulation of T cell differentiation
3. B	GO:0006975	DNA damage induced protein phosphorylation
3. B	GO:0045778	positive regulation of ossification
3. B	GO:0004714	transmembrane receptor protein tyrosine kinase activity
3. B	GO:0032928	regulation of superoxide anion generation
3. B	GO:0046825	regulation of protein export from nucleus
3. B	GO:0002102	podosome
3. B	GO:0001820	serotonin secretion
3. B	GO:1903997	positive regulation of non-membrane spanning protein tyrosine kinase activity
3. B	GO:0035685	helper T cell diapedesis
3. B	GO:0035556	intracellular signal transduction
3. B	GO:0030035	microspike assembly
3. B	GO:0042770	signal transduction in response to DNA damage
3. B	GO:0036302	atrioventricular canal development
3. B	GO:0031648	protein destabilization
3. B	GO:0000164	protein phosphatase type 1 complex
3. B	GO:0090135	actin filament branching
3. B	GO:0046580	negative regulation of Ras protein signal transduction
3. B	GO:1905244	regulation of modification of synaptic structure
3. B	GO:0035640	exploration behavior
3. B	GO:0046626	regulation of insulin receptor signaling pathway
3. B	GO:0060100	positive regulation of phagocytosis, engulfment
3. B	GO:0002092	positive regulation of receptor internalization
3. B	GO:1903053	regulation of extracellular matrix organization
3. B	GO:0060491	regulation of cell projection assembly

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q9NP31	SH2 domain-containing protein 2A	4.23e-04	5.17e-04	3.92e-28
1. PB	Q56A36	Hematopoietic SH2 domain-containing protein homolog	1.74e-04	4.72e-31	1.43e-29
1. PB	Q96JZ2	Hematopoietic SH2 domain-containing protein	2.89e-05	5.92e-26	1.69e-22
1. PB	Q6VYH9	Hematopoietic SH2 domain-containing protein	3.23e-05	2.57e-19	5.51e-23
1. PB	A6NKC9	SH2 domain-containing protein 7	0	1.81e-144	0.0
1. PB	Q8BI17	SH2 domain-containing protein 7	6.18e-06	7.06e-66	0.0
2. P	Q9FR97	Transcription factor MYB65	8.36e-02	1.00e-02	NA
2. P	Q1K6U0	Cell pattern formation-associated protein asm-1	1.62e-01	7.51e-03	NA
2. P	Q8WU20	Fibroblast growth factor receptor substrate 2	3.83e-02	6.92e-05	NA
2. P	B3LSR0	Cruciform DNA-recognizing protein 1	2.18e-01	3.07e-02	NA
2. P	E7LVH4	Cruciform DNA-recognizing protein 1	NA	4.22e-02	NA
2. P	W1QCN1	Autophagy-related protein 13	3.79e-01	2.71e-02	NA
2. P	A0A0K0QSV4	Cell pattern formation-associated protein stuA	8.65e-02	1.74e-03	NA
2. P	Q9BUH8	Brain-enriched guanylate kinase-associated protein	1.02e-01	2.82e-02	NA
2. P	O43559	Fibroblast growth factor receptor substrate 3	2.47e-01	1.54e-03	NA
2. P	G4NF05	Cell pattern formation-associated protein STU1	3.20e-01	9.75e-03	NA
2. P	A2WW87	Transcription factor GAMYB	3.23e-01	1.33e-02	NA
2. P	Q3TPJ7	Midnolin	3.80e-01	4.87e-02	NA
2. P	Q68EF6	Brain-enriched guanylate kinase-associated protein	1.05e-01	4.48e-03	NA
2. P	P49757	Protein numb homolog	6.09e-01	2.54e-03	NA
2. P	Q18PE0	Protein Dok-7	2.61e-01	5.11e-03	NA
2. P	Q6P4Y6	Insulin receptor substrate 1	8.09e-02	2.20e-04	NA
2. P	A6ZRR2	Signal transduction protein MDG1	2.87e-01	2.81e-07	NA
2. P	Q2WGN9	GRB2-associated-binding protein 4	6.60e-02	5.40e-04	NA
2. P	A7KAM4	Autophagy-related protein 13	2.70e-01	4.47e-02	NA
2. P	Q52RG8	Fibroblast growth factor receptor substrate 3	1.87e-01	2.60e-05	NA
2. P	Q9XTN2	Insulin receptor substrate 1	3.30e-01	1.63e-02	NA
2. P	P47160	Epsin-3	4.27e-01	2.93e-02	NA
2. P	P38845	Cruciform DNA-recognizing protein 1	6.05e-02	1.89e-02	NA
2. P	C7GJZ2	Cruciform DNA-recognizing protein 1	5.43e-02	2.01e-02	NA
2. P	C8Z9U3	Cruciform DNA-recognizing protein 1	8.40e-02	2.71e-02	NA
2. P	Q0JIC2	Transcription factor GAMYB	1.89e-01	1.13e-02	NA
2. P	Q8NKF5	Cell pattern formation-associated protein stuA	7.92e-02	4.25e-03	NA
2. P	Q91WJ0	Fibroblast growth factor receptor substrate 3	6.37e-01	1.01e-04	NA
2. P	A5DQA8	Autophagy-related protein 13	1.82e-01	7.15e-04	NA
2. P	C8ZG55	Signal transduction protein MDG1	1.06e-01	2.21e-07	NA
2. P	Q0U086	Cell pattern formation-associated protein StuA	3.39e-01	3.61e-03	NA
2. P	B3LP25	Signal transduction protein MDG1	1.10e-01	3.32e-07	NA
2. P	Q9QZS3	Protein numb homolog	2.23e-01	6.70e-04	NA
2. P	Q1E891	Autophagy-related protein 13	5.54e-01	1.59e-03	NA
2. P	N1PJ97	Cell pattern formation-associated protein stuA	7.40e-02	4.14e-02	NA
2. P	A7KAJ8	Autophagy-related protein 13	5.46e-01	3.26e-02	NA
2. P	O08919	Numb-like protein	1.99e-01	4.25e-04	NA
2. P	A6ZT54	Cruciform DNA-recognizing protein 1	2.76e-01	1.89e-02	NA
2. P	Q6CWK2	Autophagy-related protein 13	2.08e-01	1.13e-02	NA
2. P	E7NIP0	Cruciform DNA-recognizing protein 1	6.64e-02	2.61e-02	NA
2. P	E7KDM2	Cruciform DNA-recognizing protein 1	5.46e-02	3.87e-02	NA
2. P	P53885	Signal transduction protein MDG1	1.33e-01	2.21e-07	NA
2. P	P36011	Cell pattern formation-associated protein stuA	6.75e-01	5.49e-03	NA
2. P	Q9XTY6	Numb-related protein 1	4.06e-01	2.79e-02	NA
2. P	A8JPF9	Cell pattern formation-associated protein STUA	3.64e-01	3.35e-02	NA
2. P	Q9SJF3	mRNA-decapping enzyme-like protein	5.81e-02	6.33e-03	NA
2. P	A1L1I3	Numb-like protein	6.84e-01	2.41e-02	NA
2. P	Q2LC84	Protein numb homolog	1.12e-01	3.13e-02	NA
2. P	Q8C180	Fibroblast growth factor receptor substrate 2	5.77e-02	9.85e-04	NA
2. P	C7GTE8	Signal transduction protein MDG1	1.69e-01	4.28e-07	NA
2. P	Q9Y6R0	Numb-like protein	6.32e-01	4.51e-02	NA
2. P	Q4R1B9	Cell pattern formation-associated protein MSTU1	8.62e-02	9.75e-03	NA
2. P	E7KPJ0	Cruciform DNA-recognizing protein 1	4.01e-02	2.71e-02	NA
2. P	P16554	Protein numb	4.60e-01	2.37e-02	NA
2. P	Q4X228	Cell pattern formation-associated protein stuA	1.65e-01	2.46e-04	NA
3. B	P16333	Cytoplasmic protein NCK1	5.93e-03	NA	2.68e-05
3. B	Q08012	Growth factor receptor-bound protein 2	2.04e-04	NA	1.06e-04
3. B	Q90687	Tyrosine-protein phosphatase non-receptor type 11	4.34e-01	NA	0.005
3. B	P10686	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1	4.65e-01	NA	0.031
3. B	Q92569	Phosphatidylinositol 3-kinase regulatory subunit gamma	3.60e-03	NA	0.003
3. B	P27447	Tyrosine-protein kinase Yes	7.49e-02	NA	2.82e-07
3. B	Q14451	Growth factor receptor-bound protein 7	1.13e-02	NA	0.007
3. B	P05480	Neuronal proto-oncogene tyrosine-protein kinase Src	9.82e-02	NA	6.58e-04
3. B	P41239	Tyrosine-protein kinase CSK	4.82e-02	NA	0.002
3. B	Q63788	Phosphatidylinositol 3-kinase regulatory subunit beta	2.14e-02	NA	1.31e-04
3. B	Q99M51	Cytoplasmic protein NCK1	5.45e-03	NA	2.71e-05
3. B	P10447	Tyrosine-protein kinase transforming protein Abl	NA	NA	5.08e-05
3. B	Q62077	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1	5.63e-01	NA	0.031
3. B	Q24708	Tyrosine-protein phosphatase corkscrew (Fragment)	4.72e-02	NA	2.69e-06
3. B	Q54U31	Dual specificity protein kinase shkD	5.84e-01	NA	0.001
3. B	Q0VBZ0	Tyrosine-protein kinase CSK	1.94e-02	NA	0.002
3. B	P46109	Crk-like protein	4.84e-03	NA	2.00e-05
3. B	Q9QZC5	Growth factor receptor-bound protein 7	4.98e-03	NA	0.009
3. B	P26450	Phosphatidylinositol 3-kinase regulatory subunit alpha	4.96e-02	NA	0.003
3. B	Q5U2U2	Crk-like protein	6.29e-03	NA	2.35e-05
3. B	P13115	Tyrosine-protein kinase Src-1	1.02e-01	NA	0.007
3. B	Q9TYT3	SHC-transforming protein homolog 1	1.14e-02	NA	0.023
3. B	Q96IW2	SH2 domain-containing adapter protein D	2.86e-03	NA	4.44e-04
3. B	Q60898	Src-like-adapter	3.38e-02	NA	0.008
3. B	A8WZ92	Spermatocyte protein spe-8	8.05e-02	NA	3.45e-04
3. B	Q64143	Phosphatidylinositol 3-kinase regulatory subunit gamma	3.65e-03	NA	0.004
3. B	Q8CG80	SH2 domain-containing adapter protein F	1.99e-04	NA	1.30e-07
3. B	P23726	Phosphatidylinositol 3-kinase regulatory subunit beta	2.18e-02	NA	4.11e-04
3. B	P31693	Tyrosine-protein kinase transforming protein Src	NA	NA	0.007
3. B	O89100	GRB2-related adaptor protein 2	2.26e-03	NA	1.08e-05
3. B	A6X942	SH2 domain-containing protein 4B	2.38e-04	NA	1.19e-13
3. B	Q6YKA8	Protein E(sev)2B	1.19e-04	NA	1.06e-04
3. B	Q03160	Growth factor receptor-bound protein 7	5.60e-03	NA	0.013
3. B	F1N9Y5	Tyrosine-protein kinase SYK	4.88e-02	NA	3.27e-05
3. B	Q9QXK9	SH2 domain-containing protein 2A	2.98e-04	NA	2.12e-25
3. B	Q08CX2	SH2 domain-containing protein 4A	4.98e-04	NA	9.95e-16
3. B	P35235	Tyrosine-protein phosphatase non-receptor type 11	8.55e-02	NA	0.006
3. B	Q15464	SH2 domain-containing adapter protein B	3.54e-01	NA	0.003
3. B	P00522	Tyrosine-protein kinase Abl	8.68e-01	NA	3.91e-05
3. B	P29349	Tyrosine-protein phosphatase corkscrew	1.40e-01	NA	4.95e-07
3. B	Q9H788	SH2 domain-containing protein 4A	6.19e-05	NA	4.05e-17
3. B	Q6PD21	SH2 domain-containing adapter protein B	5.42e-03	NA	0.005
3. B	G5ECJ6	Tyrosine-protein kinase csk-1	2.49e-02	NA	3.05e-04
3. B	Q9D7V1	SH2 domain-containing protein 4A	3.39e-04	NA	1.17e-17
3. B	P08487	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1	4.69e-01	NA	0.028
3. B	Q4JIM5	Tyrosine-protein kinase ABL2	3.26e-01	NA	3.05e-07
3. B	P59622	Src-like-adapter	3.70e-02	NA	0.009
3. B	P25020	Tyrosine-protein kinase transforming protein Src	NA	NA	8.78e-04
3. B	P41240	Tyrosine-protein kinase CSK	4.47e-02	NA	0.001
3. B	P00526	Tyrosine-protein kinase transforming protein Src	NA	NA	0.003
3. B	P47941	Crk-like protein	2.37e-02	NA	7.66e-06
3. B	P00521	Tyrosine-protein kinase transforming protein Abl	NA	NA	2.47e-06
3. B	P16885	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2	3.79e-01	NA	3.97e-04
3. B	P14085	Tyrosine-protein kinase transforming protein Src	NA	NA	6.81e-04
3. B	P43403	Tyrosine-protein kinase ZAP-70	3.09e-02	NA	0.005
3. B	P19174	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1	5.16e-01	NA	0.031
3. B	Q9WUD9	Proto-oncogene tyrosine-protein kinase Src	1.04e-01	NA	6.70e-04
3. B	Q22146	Fer-related kinase 1	7.81e-02	NA	0.043
3. B	O75791	GRB2-related adapter protein 2	3.54e-03	NA	4.81e-05
3. B	P00530	Tyrosine-protein kinase transforming protein Fps	NA	NA	0.026
3. B	P00525	Tyrosine-protein kinase transforming protein Src	NA	NA	8.71e-04
3. B	Q64725	Tyrosine-protein kinase SYK	6.88e-02	NA	5.75e-04
3. B	P87378	Adapter molecule crk	2.32e-02	NA	0.044
3. B	P42690	Tyrosine-protein kinase isoform SRK4	8.01e-02	NA	9.19e-05
3. B	P43404	Tyrosine-protein kinase ZAP-70	4.35e-02	NA	0.004
3. B	Q8UUU2	Phosphatidylinositol 3-kinase regulatory subunit alpha	3.48e-02	NA	5.13e-05
3. B	Q7M4L6	SH2 domain-containing adapter protein F	2.79e-03	NA	1.16e-07
3. B	P00519	Tyrosine-protein kinase ABL1	3.22e-01	NA	1.55e-06
3. B	O00459	Phosphatidylinositol 3-kinase regulatory subunit beta	2.20e-02	NA	4.41e-04
3. B	Q8BSD5	SH2 domain-containing adapter protein E	4.33e-01	NA	1.74e-08
3. B	Q5VZ18	SH2 domain-containing adapter protein E	4.60e-01	NA	2.09e-07
3. B	P42684	Tyrosine-protein kinase ABL2	4.55e-01	NA	5.54e-07
3. B	Q1RMW5	Growth factor receptor-bound protein 7	6.95e-03	NA	5.28e-04
3. B	P27986	Phosphatidylinositol 3-kinase regulatory subunit alpha	5.06e-02	NA	0.003
3. B	Q9BRG2	SH2 domain-containing protein 3A	6.38e-03	NA	0.044
3. B	P23727	Phosphatidylinositol 3-kinase regulatory subunit alpha	1.80e-02	NA	0.003
3. B	P48025	Tyrosine-protein kinase SYK	7.59e-02	NA	7.81e-05
3. B	Q5R685	Phosphatidylinositol 3-kinase regulatory subunit alpha	2.00e-02	NA	0.004
3. B	P20936	Ras GTPase-activating protein 1	3.29e-01	NA	0.003
3. B	P00541	Tyrosine-protein kinase transforming protein Fps	NA	NA	0.001
3. B	P43405	Tyrosine-protein kinase SYK	5.74e-02	NA	5.35e-05
3. B	Q54BD4	Signal transducer and activator of transcription C	4.95e-01	NA	0.004
3. B	O46404	Phosphatidylinositol 3-kinase regulatory subunit gamma	3.65e-03	NA	0.024
3. B	Q6AYC8	SH2 domain-containing protein 4A	1.79e-04	NA	3.47e-18
3. B	Q5SQS7	SH2 domain-containing protein 4B	1.02e-05	NA	5.42e-13
3. B	P41241	Tyrosine-protein kinase CSK	4.36e-02	NA	0.002
3. B	P00524	Tyrosine-protein kinase transforming protein Src	NA	NA	8.71e-04
3. B	Q13588	GRB2-related adapter protein	1.93e-04	NA	0.027
3. B	P41499	Tyrosine-protein phosphatase non-receptor type 11	9.12e-02	NA	0.008
3. B	P14084	Tyrosine-protein kinase transforming protein Src	NA	NA	4.04e-04
3. B	P03949	Tyrosine-protein kinase abl-1	4.38e-01	NA	1.17e-06
3. B	O88834	SH2 domain-containing adapter protein D	4.14e-03	NA	1.08e-06
3. B	P24135	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2	5.05e-01	NA	5.84e-04
3. B	P52735	Guanine nucleotide exchange factor VAV2	3.96e-01	NA	1.16e-04
3. B	P63185	Tyrosine-protein kinase transforming protein Src	NA	NA	8.12e-04
3. B	P00520	Tyrosine-protein kinase ABL1	2.33e-01	NA	1.50e-06
3. B	Q13239	Src-like-adapter	7.75e-03	NA	0.005
3. B	P50904	Ras GTPase-activating protein 1	2.66e-01	NA	0.003
3. B	Q63787	Phosphatidylinositol 3-kinase regulatory subunit alpha	4.36e-02	NA	0.003
3. B	Q06124	Tyrosine-protein phosphatase non-receptor type 11	2.31e-01	NA	0.006
3. B	P00523	Proto-oncogene tyrosine-protein kinase Src	9.89e-02	NA	8.38e-04
3. B	P32577	Tyrosine-protein kinase CSK	1.71e-02	NA	0.002
3. B	Q91ZM2	SH2B adapter protein 1	2.38e-02	NA	0.039
3. B	Q8CIH5	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2	4.15e-01	NA	3.58e-04
3. B	Q00655	Tyrosine-protein kinase SYK	2.48e-02	NA	2.12e-04
3. B	P15054	Tyrosine-protein kinase transforming protein Src	NA	NA	7.08e-04
3. B	P09851	Ras GTPase-activating protein 1	3.22e-01	NA	0.003
3. B	Q60992	Guanine nucleotide exchange factor VAV2	3.98e-01	NA	1.50e-04
3. B	O08908	Phosphatidylinositol 3-kinase regulatory subunit beta	2.15e-02	NA	9.10e-05
3. B	P12931	Proto-oncogene tyrosine-protein kinase Src	9.76e-02	NA	7.31e-04