Summary

A6NKN8

Homolog: A8R4Q8.
Function: Purkinje cell protein 4-like protein 1.

Statistics

Total GO Annotation: 16
Unique PROST Go: 1
Unique BLAST Go: 0

Total Homologs: 8
Unique PROST Homologs: 1
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was A8R4Q8 (Purkinje cell protein 4-like protein 1) with a FATCAT P-Value: 7.96e-07 and RMSD of 3.25 angstrom. The sequence alignment identity is 91.3%.
Structural alignment shown in left. Query protein A6NKN8 colored as red in alignment, homolog A8R4Q8 colored as blue. Query protein A6NKN8 is also shown in right top, homolog A8R4Q8 showed in right bottom. They are colored based on secondary structures. 

  A6NKN8 MSELNTKTSPATNQAAGQEEKGKAGNVKKAE-EEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDPSS 68
  A8R4Q8 MSELNTKTSPATNQAPGPEEKGKAGSAKKTEDEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDPSS 69

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0043524 negative regulation of neuron apoptotic process
1. PB GO:0005509 calcium ion binding
1. PB GO:0045666 positive regulation of neuron differentiation
1. PB GO:0006469 negative regulation of protein kinase activity
1. PB GO:1904009 cellular response to monosodium glutamate
1. PB GO:0032991 protein-containing complex
1. PB GO:0099004 calmodulin dependent kinase signaling pathway
1. PB GO:0033603 positive regulation of dopamine secretion
1. PB GO:0006970 response to osmotic stress
1. PB GO:0001649 osteoblast differentiation
1. PB GO:0005516 calmodulin binding
1. PB GO:0043005 neuron projection
1. PB GO:0005883 neurofilament
1. PB GO:0010976 positive regulation of neuron projection development
1. PB GO:0030424 axon
2. P GO:0005102 signaling receptor binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A8R4Q8 Purkinje cell protein 4-like protein 1 7.96e-07 1.80e-85 1.66e-28
1. PB P63055 Calmodulin regulator protein PCP4 7.93e-04 1.82e-37 3.13e-09
1. PB A6NKN8 Purkinje cell protein 4-like protein 1 0 5.98e-134 1.27e-42
1. PB Q6W8Q3 Purkinje cell protein 4-like protein 1 4.93e-05 3.79e-71 8.12e-27
1. PB P63054 Calmodulin regulator protein PCP4 1.88e-03 1.82e-37 3.13e-09
1. PB Q148C4 Calmodulin regulator protein PCP4 1.34e-03 1.29e-36 4.54e-09
1. PB P48539 Calmodulin regulator protein PCP4 1.41e-03 9.05e-34 3.89e-09
2. P Q5H9J7 Protein BEX5 5.25e-03 6.00e-04 NA