Summary

A6NMK8

Homolog: Q6GQV1.
Function: INSYN2B protein.

Statistics

Total GO Annotation: 125
Unique PROST Go: 123
Unique BLAST Go: 0

Total Homologs: 77
Unique PROST Homologs: 73
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q6GQV1 (INSYN2B protein) with a FATCAT P-Value: 0.000337 and RMSD of 4.41 angstrom. The sequence alignment identity is 78.1%.
Structural alignment shown in left. Query protein A6NMK8 colored as red in alignment, homolog Q6GQV1 colored as blue. Query protein A6NMK8 is also shown in right top, homolog Q6GQV1 showed in right bottom. They are colored based on secondary structures. 

  A6NMK8 MAQQNMKVRPVLLKRNSLESVEFVKQPHHRRSKSQQVRFKEDGTTKNPTGLAEVDVQTPEDPAVMGKTQATRHHLPPTYSLSFPRSQKAGGFRNIAIQTS 100
  Q6GQV1 MAQQSMKVRPVLLKRSSLESVELVKQPHHRRSKSQQVRFKEDGNIKNPTGVTEVNTQTPEDPGVMGKAQASRHHHPTTYSLSFPRSHKAGGFRSISIQTS 100

  A6NMK8 PSLRKHFPVFKRKRLTASKSLVEMPTASQSAIQVNGNLSEQDIVSSDLAYLRLAQHLEDGPRRVKVSHAFLPRVPKVQSNGPVSICLEAGTWRSLEKATA 200
  Q6GQV1 PSLRKHFPVFKRKKLTTSKSLVEMPTASPSAIQVNGNLSEQDIVSSDLAFLRLAQHLEDGPRRLKIPHPFLPRMPKVQSNGPVSFCLESGTWMSSEKATA 200

  A6NMK8 AIQVPDDIYHSPSWEARESALSPDRSAEVSNSIHP-LDDTRPGDGRRV-TPLDSEKSTSCLNATSVASHTPGTEELKPELLLPKDNSDDKDLGSL-SSQS 297
  Q6GQV1 AIQVPDDICHSPTWEARESALSPESSAEESNSI-PALISMCPGDGQRVMTS-ELERMPPCSNTNSSASNMPGTEKLTPELLLPKDNPDDKDLG-LPSSQS 297

  A6NMK8 KETCVPSSPRTHSSPSQGSHSQPAHPGRASDCPSSSNNHQNLVSLKTNSASKSAPGCQEQTANNPTESDTLEFPNCPGSNHLPSSLSRSETKLQSNREIS 397
  Q6GQV1 KKMCVPSPPRTHSSPEPGSRSQPVHLGRSSDCPASGDNHQDLESLRSSSASKSVPVCWEHVTKLPSQSDTPELQTGVGSEQLPASIPRQENRAQSSREIG 397

  A6NMK8 DINQIHLARGELCDLQGRLQSVEESLHSNQEKIKVLLNVIQDLEKARALTEGRNFYRTGQDLNNCSTCQNTACIIYSVEYDFRQQEGRFHEVLQSLEEAE 497
  Q6GQV1 GSNHSHLAQGELCDLQGRLQSVEESLHSNQEKIKVLLNVIQDLEKAHALTEGRNFYRTGQDLNNCSTCQNTACIIYSVEYDFRQQEGRFHEVLQSLEEAE 497

  A6NMK8 PVEEASPPPKSPAEPPAPEKQDLRRKTKKVKKKCFWWI 535
  Q6GQV1 PTEEAPSPPKSPAEAPVPEKQDLRRKSKKVKKKCFWWI 535

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0060080 inhibitory postsynaptic potential
1. PB GO:0014069 postsynaptic density
2. P GO:0007015 actin filament organization
2. P GO:0010389 regulation of G2/M transition of mitotic cell cycle
2. P GO:2001243 negative regulation of intrinsic apoptotic signaling pathway
2. P GO:0032886 regulation of microtubule-based process
2. P GO:0042994 cytoplasmic sequestering of transcription factor
2. P GO:1900273 positive regulation of long-term synaptic potentiation
2. P GO:0043296 apical junction complex
2. P GO:0005874 microtubule
2. P GO:0099078 BORC complex
2. P GO:0034501 protein localization to kinetochore
2. P GO:0071469 cellular response to alkaline pH
2. P GO:1903394 protein localization to kinetochore involved in kinetochore assembly
2. P GO:0045892 negative regulation of transcription, DNA-templated
2. P GO:0035254 glutamate receptor binding
2. P GO:0007091 metaphase/anaphase transition of mitotic cell cycle
2. P GO:0046599 regulation of centriole replication
2. P GO:0030953 astral microtubule organization
2. P GO:0051285 cell cortex of cell tip
2. P GO:0038202 TORC1 signaling
2. P GO:0007399 nervous system development
2. P GO:0032456 endocytic recycling
2. P GO:0048511 rhythmic process
2. P GO:0090173 regulation of synaptonemal complex assembly
2. P GO:0044615 nuclear pore nuclear basket
2. P GO:0055037 recycling endosome
2. P GO:0005078 MAP-kinase scaffold activity
2. P GO:0044294 dendritic growth cone
2. P GO:0008432 JUN kinase binding
2. P GO:0030424 axon
2. P GO:0034451 centriolar satellite
2. P GO:0030346 protein phosphatase 2B binding
2. P GO:0031965 nuclear membrane
2. P GO:0030056 hemidesmosome
2. P GO:0007141 male meiosis I
2. P GO:0032126 eisosome
2. P GO:0010342 endosperm cellularization
2. P GO:0030275 LRR domain binding
2. P GO:0034237 protein kinase A regulatory subunit binding
2. P GO:0031274 positive regulation of pseudopodium assembly
2. P GO:0051321 meiotic cell cycle
2. P GO:0030425 dendrite
2. P GO:0062040 fungal biofilm matrix
2. P GO:0039697 negative stranded viral RNA transcription
2. P GO:0030496 midbody
2. P GO:0000054 ribosomal subunit export from nucleus
2. P GO:0000212 meiotic spindle organization
2. P GO:0043631 RNA polyadenylation
2. P GO:1990918 double-strand break repair involved in meiotic recombination
2. P GO:0030476 ascospore wall assembly
2. P GO:0032120 ascospore-type prospore membrane formation
2. P GO:0044302 dentate gyrus mossy fiber
2. P GO:0031031 positive regulation of septation initiation signaling
2. P GO:0036064 ciliary basal body
2. P GO:0000226 microtubule cytoskeleton organization
2. P GO:0008017 microtubule binding
2. P GO:0051382 kinetochore assembly
2. P GO:0031410 cytoplasmic vesicle
2. P GO:0006997 nucleus organization
2. P GO:0030904 retromer complex
2. P GO:0044613 nuclear pore central transport channel
2. P GO:0031435 mitogen-activated protein kinase kinase kinase binding
2. P GO:0007194 negative regulation of adenylate cyclase activity
2. P GO:0022027 interkinetic nuclear migration
2. P GO:0007144 female meiosis I
2. P GO:1903566 positive regulation of protein localization to cilium
2. P GO:0043009 chordate embryonic development
2. P GO:0032465 regulation of cytokinesis
2. P GO:0046328 regulation of JNK cascade
2. P GO:0071472 cellular response to salt stress
2. P GO:0009960 endosperm development
2. P GO:0051301 cell division
2. P GO:1905758 positive regulation of primary cell septum biogenesis
2. P GO:0005628 prospore membrane
2. P GO:0006357 regulation of transcription by RNA polymerase II
2. P GO:0009504 cell plate
2. P GO:0016324 apical plasma membrane
2. P GO:0051018 protein kinase A binding
2. P GO:0006405 RNA export from nucleus
2. P GO:0030308 negative regulation of cell growth
2. P GO:0031097 medial cortex
2. P GO:0098837 postsynaptic recycling endosome
2. P GO:1905751 positive regulation of endosome to plasma membrane protein transport
2. P GO:0007258 JUN phosphorylation
2. P GO:0051307 meiotic chromosome separation
2. P GO:0035091 phosphatidylinositol binding
2. P GO:0070941 eisosome assembly
2. P GO:0043508 negative regulation of JUN kinase activity
2. P GO:1902850 microtubule cytoskeleton organization involved in mitosis
2. P GO:0050811 GABA receptor binding
2. P GO:0010738 regulation of protein kinase A signaling
2. P GO:0008179 adenylate cyclase binding
2. P GO:0042754 negative regulation of circadian rhythm
2. P GO:2000564 regulation of CD8-positive, alpha-beta T cell proliferation
2. P GO:0051017 actin filament bundle assembly
2. P GO:0005813 centrosome
2. P GO:0045762 positive regulation of adenylate cyclase activity
2. P GO:0000940 outer kinetochore
2. P GO:0015630 microtubule cytoskeleton
2. P GO:0030030 cell projection organization
2. P GO:0031931 TORC1 complex
2. P GO:0001578 microtubule bundle formation
2. P GO:0006970 response to osmotic stress
2. P GO:0005694 chromosome
2. P GO:0005880 nuclear microtubule
2. P GO:0043060 meiotic metaphase I plate congression
2. P GO:0031105 septin complex
2. P GO:0045159 myosin II binding
2. P GO:0030864 cortical actin cytoskeleton
2. P GO:0060236 regulation of mitotic spindle organization
2. P GO:0043666 regulation of phosphoprotein phosphatase activity
2. P GO:0000164 protein phosphatase type 1 complex
2. P GO:0005912 adherens junction
2. P GO:0035493 SNARE complex assembly
2. P GO:0000776 kinetochore
2. P GO:0045724 positive regulation of cilium assembly
2. P GO:0031698 beta-2 adrenergic receptor binding
2. P GO:0031434 mitogen-activated protein kinase kinase binding
2. P GO:1902412 regulation of mitotic cytokinesis
2. P GO:0051225 spindle assembly
2. P GO:0005635 nuclear envelope
2. P GO:1905342 positive regulation of protein localization to kinetochore
2. P GO:0048316 seed development
2. P GO:0060261 positive regulation of transcription initiation from RNA polymerase II promoter

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q6ZSG2 Inhibitory synaptic factor 2A 1.65e-02 9.10e-20 4.36e-24
1. PB Q3USH1 Inhibitory synaptic factor 2A 4.10e-03 2.75e-10 1.13e-14
1. PB Q6GQV1 INSYN2B protein 3.37e-04 4.45e-68 0.0
1. PB A6NMK8 Protein INSYN2B 0 1.42e-152 0.0
2. P F4HSD5 Protein TRM32 3.63e-01 1.54e-02 NA
2. P Q1RMS0 Serine-rich coiled-coil domain-containing protein 1 9.34e-02 2.24e-06 NA
2. P Q96C92 Endosome-associated-trafficking regulator 1 1.15e-01 2.91e-08 NA
2. P F4INP9 QWRF motif-containing protein 4 9.85e-03 1.60e-06 NA
2. P G5EEK3 Non-centrosomal microtubule array protein 1 3.83e-02 3.65e-03 NA
2. P O15049 NEDD4-binding protein 3 8.33e-02 1.89e-05 NA
2. P Q96BT1 Putative uncharacterized protein C3orf49 9.49e-02 3.46e-02 NA
2. P P39734 Protein HPH2 1.95e-01 7.99e-04 NA
2. P O55778 Phosphoprotein NA 7.65e-04 NA
2. P Q9Y3Q8 TSC22 domain family protein 4 1.32e-01 1.82e-04 NA
2. P Q8C4M7 Centromere protein U 1.21e-02 3.49e-02 NA
2. P Q66H43 BLOC-1-related complex subunit 6 4.18e-02 9.05e-03 NA
2. P P87299 Meiotically up-regulated gene 74 protein 2.06e-01 6.26e-05 NA
2. P Q9SUH5 AUGMIN subunit 8 3.87e-02 5.73e-06 NA
2. P Q3V036 Coiled-coil domain-containing protein 27 1.52e-01 4.62e-02 NA
2. P Q04279 Eisosome protein SEG1 3.84e-01 2.17e-03 NA
2. P Q94AI1 QWRF motif-containing protein 2 3.25e-02 2.91e-02 NA
2. P B9G5N1 Meiosis-specific protein PAIR3 1.34e-01 4.40e-03 NA
2. P Q99332 Protein HPH1 4.37e-02 8.69e-07 NA
2. P Q922C1 Uncharacterized protein C19orf44 homolog 3.23e-02 2.96e-07 NA
2. P Q5R8C5 CLOCK-interacting pacemaker 5.00e-02 2.99e-04 NA
2. P Q71F23 Centromere protein U 1.05e-03 1.53e-03 NA
2. P Q6DIA7 Break repair meiotic recombinase recruitment factor 1 5.78e-02 3.93e-03 NA
2. P A2AIW0 Endosome-associated-trafficking regulator 1 6.20e-02 4.55e-06 NA
2. P Q0WR66 Meiosis-specific protein ASY3 2.80e-02 8.14e-05 NA
2. P O74428 Target of rapamycin complex 1 subunit tco89 4.26e-02 2.29e-07 NA
2. P Q3B8N7 TSC22 domain family protein 4 3.63e-01 1.28e-03 NA
2. P Q6FY22 Protein transport protein SEC9 6.38e-02 4.57e-02 NA
2. P P40020 Factor interacting with REF2 3.81e-01 7.78e-03 NA
2. P Q9EQN3 TSC22 domain family protein 4 9.80e-02 9.77e-05 NA
2. P Q8TEQ0 Sorting nexin-29 3.61e-02 3.49e-02 NA
2. P Q9C0C6 CLOCK-interacting pacemaker 1.40e-01 2.79e-06 NA
2. P P38280 Spore-specific protein YSW1 2.00e-01 2.21e-02 NA
2. P Q5SX79 Protein Shroom1 1.14e-01 1.09e-13 NA
2. P Q9JJ11 Transforming acidic coiled-coil-containing protein 3 7.55e-02 3.30e-02 NA
2. P P38229 GLC7-interacting protein 1 2.18e-01 1.36e-02 NA
2. P F4K4M0 QWRF motif-containing protein 9 1.97e-01 1.07e-05 NA
2. P Q5ZLT3 NEDD4-binding protein 3 homolog 7.14e-02 2.66e-02 NA
2. P Q6NRH7 CLOCK-interacting pacemaker 5.79e-02 8.33e-05 NA
2. P Q9UTR4 Septation protein etd1 6.30e-02 4.44e-02 NA
2. P Q8S8I1 QWRF motif-containing protein 3 4.52e-02 1.24e-02 NA
2. P Q9H6X5 Uncharacterized protein C19orf44 4.01e-02 3.48e-06 NA
2. P P34303 Zinc finger transcription factor family protein 30 5.84e-02 4.36e-02 NA
2. P Q3UHI0 Serine-rich coiled-coil domain-containing protein 2 4.76e-02 9.33e-08 NA
2. P Q9H7U1 Serine-rich coiled-coil domain-containing protein 2 2.67e-01 1.47e-07 NA
2. P O75157 TSC22 domain family protein 2 5.71e-02 4.24e-02 NA
2. P Q8C0C4 Serine-rich coiled-coil domain-containing protein 1 4.91e-02 1.97e-03 NA
2. P Q8C7U1 NEDD4-binding protein 3 3.14e-01 2.62e-05 NA
2. P P33306 Protein BCK2 2.31e-01 3.47e-03 NA
2. P P24588 A-kinase anchor protein 5 4.92e-02 1.57e-02 NA
2. P Q8GXD9 Protein SNOWY COTYLEDON 3 2.03e-01 3.64e-05 NA
2. P Q10168 Nucleoporin nsp1 1.65e-01 6.10e-03 NA
2. P Q94AV5 WPP domain-interacting protein 3 2.63e-02 2.23e-05 NA
2. P Q9Y608 Leucine-rich repeat flightless-interacting protein 2 1.52e-01 1.24e-03 NA
2. P Q91W92 Cdc42 effector protein 1 1.82e-01 1.42e-02 NA
2. P Q9NWN3 F-box only protein 34 1.37e-01 1.16e-02 NA
2. P Q2M3G4 Protein Shroom1 5.28e-02 3.82e-14 NA
2. P D2J0Y4 (E2-independent) E3 ubiquitin-conjugating enzyme FATS 1.35e-02 1.20e-02 NA
2. P Q8R0W1 CLOCK-interacting pacemaker 9.86e-02 2.13e-06 NA
2. P Q3TJM4 Centromere protein T 4.52e-02 1.72e-03 NA
2. P O80588 Protein ENDOSPERM DEFECTIVE 1 1.07e-01 3.17e-02 NA
2. P Q8GXA4 WPP domain-interacting protein 1 2.21e-02 1.05e-02 NA
2. P Q9D3S3 Sorting nexin-29 6.20e-02 5.98e-03 NA
2. P Q08DX0 Sorting nexin-29 2.46e-01 3.33e-02 NA
2. P A0A140LFM6 Major intrinsically disordered Notch2-binding receptor 1 2.67e-01 1.51e-02 NA
2. P Q3LUD3 Nedd4 binding protein 3 6.95e-02 3.19e-06 NA
2. P Q6AXP1 Uncharacterized protein C19orf44 homolog 2.96e-02 1.48e-12 NA
2. P Q9WVI9 C-Jun-amino-terminal kinase-interacting protein 1 1.74e-01 2.85e-02 NA
2. P O60104 Mediator of RNA polymerase II transcription subunit 7 3.47e-01 1.80e-02 NA
2. P Q75C80 Protein FYV8 2.43e-01 9.15e-03 NA
2. P Q9IK91 Phosphoprotein NA 2.29e-04 NA
2. P P34278 Kinetochore null protein 1 3.15e-01 4.49e-02 NA
2. P Q0VDD7 Break repair meiotic recombinase recruitment factor 1 1.12e-01 3.05e-02 NA