Summary

A6NNJ1

Homolog: P0C7X0.
Function: Putative protein FAM90A24P.

Statistics

Total GO Annotation: 43
Unique PROST Go: 43
Unique BLAST Go: 0

Total Homologs: 43
Unique PROST Homologs: 24
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was P0C7X0 (Putative protein FAM90A24P) with a FATCAT P-Value: 1.65e-09 and RMSD of 5.79 angstrom. The sequence alignment identity is 97.6%.
Structural alignment shown in left. Query protein A6NNJ1 colored as red in alignment, homolog P0C7X0 colored as blue. Query protein A6NNJ1 is also shown in right top, homolog P0C7X0 showed in right bottom. They are colored based on secondary structures. 

  A6NNJ1 MMARRDPKSWAKRLVRAQTLQKQRRAPVGPRAPPPDEEDPRLKCKNCGAFGHTARSTRCPMKCWKAALVPATLGKKEGKENLKPWKPRVEANPGPLNKDK 100
  P0C7X0 MMARRDPTSWAKRLVRAQTLQKQRRAPVGPRAPPPDEEDPRLKCKNCGAFGHTARSTRCPMKCWKAALVPATLGKKEGKENLKPWKPRGEANPGPLNKDK 100

  A6NNJ1 GEKEERPRQQDPQRKALLHMFSGKPPEKPLPNGKGSTESSDHLRVASGPMPVHTTSKRPRVDPVLADRSAAEMSGRGSVLASLSPLRKASLSSSSSLGPK 200
  P0C7X0 GEKEERPRQQDPQRKALLHMFSGKPPEKPLPNGKGSTESSDYLRVASGPMPVHTTSKRPRLDPVLADRSATEMSGRGSVLASLSPLRKASLSSSSSLGPK 200

  A6NNJ1 ERQTGAAADMPQPAVRHQGREPLLVVKPTHSSPEGGCREVPQAASKTHGLLQAARPQAQDKRPAVTSQPCPPAATHSLGLGSNLSFGPGAKRPAQAPIQA 300
  P0C7X0 ERQTGAAADMPQPAVRHQGREPLLVVKPTHSRPEGGCREVPQAASKTHGLLQASRPQAQDKRPAVTPQPCPPAATHSLGLGSNLSFGPGAKRPAQAPIQA 300

  A6NNJ1 CLNFPKKPRLGPFQIPESAIQGGELGAPENLQPPPAATELGPSTSPQMGRRTPAQVPSVDRQPPHSTPCLPTAQACTMSHHSAASHDGAQPLRVLFRRLE 400
  P0C7X0 CLNFPKKPRLGPFQIPESAIQGGELGAPENLQPPPAATELGPSTSPQMGRRTPAQVPSVDRQPPHSRPCLPTAQACTMSHHSAAGHDGAQPLRVLFRRLE 400

  A6NNJ1 NGRWSSSLLAAPSFHSPEKPGTFLAQSPHVSEKSEAPCVRVPPSVLYEDLQVSSSSEDSDSDLE 464
  P0C7X0 NGRWSSSLLAAPSFHSPEKPGAFLAQSPHVSEKSEAPCVRVPPSVLYEDLQVSSSSEDSDSDLE 464

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0016591 RNA polymerase II, holoenzyme
2. P GO:0003682 chromatin binding
2. P GO:0016973 poly(A)+ mRNA export from nucleus
2. P GO:0005665 RNA polymerase II, core complex
2. P GO:0006334 nucleosome assembly
2. P GO:0007051 spindle organization
2. P GO:0005654 nucleoplasm
2. P GO:1903863 P granule assembly
2. P GO:0006333 chromatin assembly or disassembly
2. P GO:0042995 cell projection
2. P GO:0019901 protein kinase binding
2. P GO:0010847 regulation of chromatin assembly
2. P GO:0030849 autosome
2. P GO:0006281 DNA repair
2. P GO:0043486 histone exchange
2. P GO:0003729 mRNA binding
2. P GO:0060088 auditory receptor cell stereocilium organization
2. P GO:0007141 male meiosis I
2. P GO:0001042 RNA polymerase I core binding
2. P GO:0019902 phosphatase binding
2. P GO:1905168 positive regulation of double-strand break repair via homologous recombination
2. P GO:0005813 centrosome
2. P GO:0005652 nuclear lamina
2. P GO:0009792 embryo development ending in birth or egg hatching
2. P GO:0051308 male meiosis chromosome separation
2. P GO:0120044 stereocilium base
2. P GO:0006974 cellular response to DNA damage stimulus
2. P GO:0030870 Mre11 complex
2. P GO:0010212 response to ionizing radiation
2. P GO:0006355 regulation of transcription, DNA-templated
2. P GO:0051685 maintenance of ER location
2. P GO:2001032 regulation of double-strand break repair via nonhomologous end joining
2. P GO:0007095 mitotic G2 DNA damage checkpoint signaling
2. P GO:0071168 protein localization to chromatin
2. P GO:0007344 pronuclear fusion
2. P GO:0006997 nucleus organization
2. P GO:0005635 nuclear envelope
2. P GO:0120045 stereocilium maintenance
2. P GO:0032420 stereocilium
2. P GO:0005730 nucleolus
2. P GO:0045860 positive regulation of protein kinase activity
2. P GO:0042393 histone binding
2. P GO:0006878 cellular copper ion homeostasis

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A8MXJ8 Putative protein FAM90A5P 1.75e-06 1.32e-92 0.0
1. PB P0C7W9 Putative protein FAM90A14P 9.71e-06 6.53e-87 0.0
1. PB P0C7V4 Putative protein FAM90A15P 1.31e-06 3.75e-83 0.0
1. PB P0C7W8 Putative protein FAM90A13P 1.03e-06 2.22e-87 0.0
1. PB A6NIJ5 Putative protein FAM90A20P 7.03e-05 3.75e-87 0.0
1. PB A6NNJ1 Putative protein FAM90A9P 0 3.31e-144 0.0
1. PB A6NE21 Putative protein FAM90A18P/FAM90A19P 4.65e-07 1.32e-120 0.0
1. PB Q86YD7 Protein FAM90A1 2.26e-05 1.58e-63 0.0
1. PB A6NEW6 Putative protein FAM90A16P/FAM90A17P 1.82e-06 1.63e-96 0.0
1. PB A6NJQ4 Putative protein FAM90A8P 2.03e-08 2.80e-101 0.0
1. PB D6RGX4 Putative protein FAM90A26 2.22e-06 1.47e-79 0.0
1. PB A8MWA6 Putative protein FAM90A22P 4.36e-06 1.91e-82 0.0
1. PB A8MXZ1 Putative protein FAM90A23P 3.77e-07 6.80e-88 0.0
1. PB P0C7X0 Putative protein FAM90A24P 1.65e-09 5.86e-89 0.0
1. PB Q658T7 Putative protein FAM90A2P 5.21e-05 2.07e-45 0.0
1. PB A8MX19 Putative protein FAM90A12P 3.98e-04 1.39e-95 0.0
1. PB A6NNH2 Protein FAM90A27P 2.69e-02 9.13e-26 1.14e-42
1. PB A6NDY2 Putative protein FAM90A10P 2.81e-08 6.45e-111 0.0
1. PB A6NKC0 Putative protein FAM90A7P 4.75e-07 2.63e-110 0.0
2. P B4HMH2 Protein teflon 3.43e-01 4.39e-02 NA
2. P Q6NZF1 Zinc finger CCCH domain-containing protein 11A 6.15e-01 1.77e-02 NA
2. P Q8IMP6 Protein SPT2 homolog 1.21e-01 7.73e-05 NA
2. P Q9D1F5 MRN complex-interacting protein 1.66e-01 1.66e-02 NA
2. P Q5ZJJ1 Zinc finger CCCH domain-containing protein 11A 6.36e-01 4.95e-04 NA
2. P P20129 70 kDa protein NA 2.94e-02 NA
2. P Q5ZK13 Centrosomal protein kizuna 3.11e-01 8.81e-07 NA
2. P Q2M2Z5 Centrosomal protein kizuna 2.29e-01 3.52e-05 NA
2. P P25028 Mitosis initiation protein fs(1)Ya 3.10e-01 4.30e-03 NA
2. P D3YT16 Enlarged germline granules protein 1 3.84e-01 1.54e-03 NA
2. P O75152 Zinc finger CCCH domain-containing protein 11A 2.86e-01 1.19e-02 NA
2. P P0CAP2 DNA-directed RNA polymerase II subunit GRINL1A 3.83e-01 3.39e-02 NA
2. P Q68D10 Protein SPT2 homolog 7.88e-02 1.72e-02 NA
2. P A0A1B0GTU1 Zinc finger CCCH domain-containing protein 11B 7.78e-01 5.45e-03 NA
2. P Q6DGN6 Protein SPT2 homolog 3.14e-01 7.06e-04 NA
2. P Q3ZBG8 MRN complex-interacting protein 2.53e-01 1.85e-03 NA
2. P Q8TAL5 Uncharacterized protein C9orf43 4.14e-01 4.18e-03 NA
2. P Q4KMQ1 Taperin 2.82e-01 1.52e-02 NA
2. P Q92258 Protein GRISEA 4.54e-01 2.22e-02 NA
2. P Q5REG6 Zinc finger CCCH domain-containing protein 11A 6.74e-01 2.54e-02 NA
2. P Q6NTE8 MRN complex-interacting protein 1.70e-01 1.45e-04 NA
2. P Q3UXL4 Centrosomal protein kizuna 2.92e-01 8.17e-04 NA
2. P Q68FG3 Protein SPT2 homolog 1.27e-01 1.55e-02 NA
2. P Q32PP1 MRN complex-interacting protein 7.52e-02 8.22e-03 NA