Summary

A6NNP5

Homolog: Q8BXX9.
Function: Coiled-coil domain-containing protein 169.

Statistics

Total GO Annotation: 199
Unique PROST Go: 199
Unique BLAST Go: 0

Total Homologs: 195
Unique PROST Homologs: 192
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q8BXX9 (Coiled-coil domain-containing protein 169) with a FATCAT P-Value: 5.66e-15 and RMSD of 3.29 angstrom. The sequence alignment identity is 71.0%.
Structural alignment shown in left. Query protein A6NNP5 colored as red in alignment, homolog Q8BXX9 colored as blue. Query protein A6NNP5 is also shown in right top, homolog Q8BXX9 showed in right bottom. They are colored based on secondary structures. 

  A6NNP5 MKEERNYNFDGVSTNRLKQQLLEEVRKKDAVQLSIFELRHKITELEAKLNTDNEGSEWKTRYETQLELNDELEKQIVYLKEKVEKIHGNSSDRLSSIRVY 100
  Q8BXX9 MGEGHGDTFEGVSTDRLKLELLEEIHMKDVVQLSTLEIRHKIAELEANLNGDLAGSEWKTRYETQLELNDQLEKQIVSLKEKMEKMRGNPSDRLSSIRVY 100

  A6NNP5 ERMPVESLNTLLKQLEEEKKTLESQVKYYALKLEQESKAYQKINNERRTYLAEMSQGSGLHQVSKRQQVDQLPRMQENLVKTGRYNPAKQKTVSAKRGPV 200
  Q8BXX9 EKMPVESLNVLLKQLEKEKRSLESQVKEYAFRLEQESKAYHRTNNERRSYIAEMTQVSGSNQVSKRQQMDPLPRMKESPVKTGRHNSMNQKTTNAKKGPV 200

  A6NNP5 KKITRPNHLPELHP 214
  Q8BXX9 KKVPRSNHLPKLNP 214

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0060830 ciliary receptor clustering involved in smoothened signaling pathway
2. P GO:0008090 retrograde axonal transport
2. P GO:0070530 K63-linked polyubiquitin modification-dependent protein binding
2. P GO:1901970 positive regulation of mitotic sister chromatid separation
2. P GO:0007094 mitotic spindle assembly checkpoint signaling
2. P GO:0051081 nuclear membrane disassembly
2. P GO:0051028 mRNA transport
2. P GO:0019904 protein domain specific binding
2. P GO:0007080 mitotic metaphase plate congression
2. P GO:0005881 cytoplasmic microtubule
2. P GO:0030951 establishment or maintenance of microtubule cytoskeleton polarity
2. P GO:0007060 male meiosis chromosome segregation
2. P GO:0005874 microtubule
2. P GO:1905561 positive regulation of kinetochore assembly
2. P GO:0036286 eisosome filament
2. P GO:0006937 regulation of muscle contraction
2. P GO:0008286 insulin receptor signaling pathway
2. P GO:0047496 vesicle transport along microtubule
2. P GO:0035020 regulation of Rac protein signal transduction
2. P GO:0007399 nervous system development
2. P GO:0000132 establishment of mitotic spindle orientation
2. P GO:0034451 centriolar satellite
2. P GO:0031902 late endosome membrane
2. P GO:0051495 positive regulation of cytoskeleton organization
2. P GO:0043162 ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
2. P GO:0023035 CD40 signaling pathway
2. P GO:0031021 interphase microtubule organizing center
2. P GO:0051647 nucleus localization
2. P GO:0009903 chloroplast avoidance movement
2. P GO:0140059 dendrite arborization
2. P GO:0110026 regulation of DNA strand resection involved in replication fork processing
2. P GO:0007030 Golgi organization
2. P GO:0004860 protein kinase inhibitor activity
2. P GO:0008017 microtubule binding
2. P GO:0005929 cilium
2. P GO:0007020 microtubule nucleation
2. P GO:0008021 synaptic vesicle
2. P GO:0051311 meiotic metaphase plate congression
2. P GO:0007405 neuroblast proliferation
2. P GO:1900029 positive regulation of ruffle assembly
2. P GO:0098535 de novo centriole assembly involved in multi-ciliated epithelial cell differentiation
2. P GO:0042110 T cell activation
2. P GO:0048487 beta-tubulin binding
2. P GO:0033566 gamma-tubulin complex localization
2. P GO:0070012 oligopeptidase activity
2. P GO:0050871 positive regulation of B cell activation
2. P GO:0007097 nuclear migration
2. P GO:0007059 chromosome segregation
2. P GO:0090630 activation of GTPase activity
2. P GO:0005815 microtubule organizing center
2. P GO:0051301 cell division
2. P GO:0060053 neurofilament cytoskeleton
2. P GO:0002756 MyD88-independent toll-like receptor signaling pathway
2. P GO:0051642 centrosome localization
2. P GO:0010977 negative regulation of neuron projection development
2. P GO:0005861 troponin complex
2. P GO:0010569 regulation of double-strand break repair via homologous recombination
2. P GO:0031616 spindle pole centrosome
2. P GO:0001833 inner cell mass cell proliferation
2. P GO:0033157 regulation of intracellular protein transport
2. P GO:0031023 microtubule organizing center organization
2. P GO:0007098 centrosome cycle
2. P GO:0080009 mRNA methylation
2. P GO:0060048 cardiac muscle contraction
2. P GO:0070498 interleukin-1-mediated signaling pathway
2. P GO:1990758 mitotic sister chromatid biorientation
2. P GO:0034134 toll-like receptor 2 signaling pathway
2. P GO:0000922 spindle pole
2. P GO:0043231 intracellular membrane-bounded organelle
2. P GO:0048309 endoplasmic reticulum inheritance
2. P GO:0044565 dendritic cell proliferation
2. P GO:0010696 positive regulation of mitotic spindle pole body separation
2. P GO:0014883 transition between fast and slow fiber
2. P GO:0099070 static microtubule bundle
2. P GO:0031252 cell leading edge
2. P GO:0007288 sperm axoneme assembly
2. P GO:0055107 Golgi to secretory granule transport
2. P GO:0005886 plasma membrane
2. P GO:0006936 muscle contraction
2. P GO:0043001 Golgi to plasma membrane protein transport
2. P GO:0045098 type III intermediate filament
2. P GO:0034162 toll-like receptor 9 signaling pathway
2. P GO:0051649 establishment of localization in cell
2. P GO:0010975 regulation of neuron projection development
2. P GO:0021687 cerebellar molecular layer morphogenesis
2. P GO:0051298 centrosome duplication
2. P GO:0007130 synaptonemal complex assembly
2. P GO:0005816 spindle pole body
2. P GO:0070732 spindle envelope
2. P GO:0071222 cellular response to lipopolysaccharide
2. P GO:0005912 adherens junction
2. P GO:0032580 Golgi cisterna membrane
2. P GO:0000801 central element
2. P GO:0031024 interphase microtubule organizing center assembly
2. P GO:0097545 axonemal outer doublet
2. P GO:0032154 cleavage furrow
2. P GO:2000352 negative regulation of endothelial cell apoptotic process
2. P GO:0043547 positive regulation of GTPase activity
2. P GO:0036126 sperm flagellum
2. P GO:0008608 attachment of spindle microtubules to kinetochore
2. P GO:0003382 epithelial cell morphogenesis
2. P GO:0005876 spindle microtubule
2. P GO:0016477 cell migration
2. P GO:0007100 mitotic centrosome separation
2. P GO:1990138 neuron projection extension
2. P GO:0034501 protein localization to kinetochore
2. P GO:0021955 central nervous system neuron axonogenesis
2. P GO:0005819 spindle
2. P GO:0021799 cerebral cortex radially oriented cell migration
2. P GO:0009904 chloroplast accumulation movement
2. P GO:0007249 I-kappaB kinase/NF-kappaB signaling
2. P GO:0000813 ESCRT I complex
2. P GO:0048680 positive regulation of axon regeneration
2. P GO:0007026 negative regulation of microtubule depolymerization
2. P GO:0010091 trichome branching
2. P GO:0043515 kinetochore binding
2. P GO:0000086 G2/M transition of mitotic cell cycle
2. P GO:0007533 mating type switching
2. P GO:2000145 regulation of cell motility
2. P GO:0061099 negative regulation of protein tyrosine kinase activity
2. P GO:0000212 meiotic spindle organization
2. P GO:0010796 regulation of multivesicular body size
2. P GO:0005634 nucleus
2. P GO:0031593 polyubiquitin modification-dependent protein binding
2. P GO:0036064 ciliary basal body
2. P GO:0007099 centriole replication
2. P GO:0043203 axon hillock
2. P GO:0090268 activation of mitotic cell cycle spindle assembly checkpoint
2. P GO:0007010 cytoskeleton organization
2. P GO:0005789 endoplasmic reticulum membrane
2. P GO:1901214 regulation of neuron death
2. P GO:0000723 telomere maintenance
2. P GO:0044732 mitotic spindle pole body
2. P GO:0046983 protein dimerization activity
2. P GO:0000070 mitotic sister chromatid segregation
2. P GO:0000381 regulation of alternative mRNA splicing, via spliceosome
2. P GO:0019899 enzyme binding
2. P GO:0043014 alpha-tubulin binding
2. P GO:0051303 establishment of chromosome localization
2. P GO:0001764 neuron migration
2. P GO:0090724 central region of growth cone
2. P GO:0030154 cell differentiation
2. P GO:1902405 mitotic actomyosin contractile ring localization
2. P GO:0097028 dendritic cell differentiation
2. P GO:0034138 toll-like receptor 3 signaling pathway
2. P GO:0098536 deuterosome
2. P GO:0005814 centriole
2. P GO:0060997 dendritic spine morphogenesis
2. P GO:0007079 mitotic chromosome movement towards spindle pole
2. P GO:1903445 protein transport from ciliary membrane to plasma membrane
2. P GO:2000574 obsolete regulation of microtubule motor activity
2. P GO:0055010 ventricular cardiac muscle tissue morphogenesis
2. P GO:0005871 kinesin complex
2. P GO:0070097 delta-catenin binding
2. P GO:1990537 mitotic spindle polar microtubule
2. P GO:0070941 eisosome assembly
2. P GO:0000278 mitotic cell cycle
2. P GO:0016021 integral component of membrane
2. P GO:1904115 axon cytoplasm
2. P GO:0045931 positive regulation of mitotic cell cycle
2. P GO:0060271 cilium assembly
2. P GO:0021987 cerebral cortex development
2. P GO:0003009 skeletal muscle contraction
2. P GO:0042729 DASH complex
2. P GO:0030989 dynein-driven meiotic oscillatory nuclear movement
2. P GO:1905824 positive regulation of mitotic sister chromatid arm separation
2. P GO:0005875 microtubule associated complex
2. P GO:0032418 lysosome localization
2. P GO:0031262 Ndc80 complex
2. P GO:1902423 regulation of attachment of mitotic spindle microtubules to kinetochore
2. P GO:0000940 outer kinetochore
2. P GO:0005813 centrosome
2. P GO:0015630 microtubule cytoskeleton
2. P GO:0005829 cytosol
2. P GO:0005637 nuclear inner membrane
2. P GO:0000795 synaptonemal complex
2. P GO:0006623 protein targeting to vacuole
2. P GO:0021822 negative regulation of cell motility involved in cerebral cortex radial glia guided migration
2. P GO:0036396 RNA N6-methyladenosine methyltransferase complex
2. P GO:0035735 intraciliary transport involved in cilium assembly
2. P GO:0000137 Golgi cis cisterna
2. P GO:0044458 motile cilium assembly
2. P GO:0045599 negative regulation of fat cell differentiation
2. P GO:0003779 actin binding
2. P GO:0005801 cis-Golgi network
2. P GO:0005882 intermediate filament
2. P GO:0032118 horsetail-astral microtubule organization
2. P GO:0000776 kinetochore
2. P GO:0043032 positive regulation of macrophage activation
2. P GO:0090443 FAR/SIN/STRIPAK complex
2. P GO:0030900 forebrain development
2. P GO:0060052 neurofilament cytoskeleton organization
2. P GO:0070307 lens fiber cell development
2. P GO:0042802 identical protein binding
2. P GO:0048714 positive regulation of oligodendrocyte differentiation
2. P GO:0045773 positive regulation of axon extension
2. P GO:0005635 nuclear envelope
2. P GO:1905342 positive regulation of protein localization to kinetochore
2. P GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q3KPT0 Coiled-coil domain-containing protein 169 2.06e-10 1.27e-41 1.55e-54
1. PB A6NNP5 Coiled-coil domain-containing protein 169 0 9.71e-167 1.84e-155
1. PB Q8BXX9 Coiled-coil domain-containing protein 169 5.66e-15 5.16e-63 6.60e-105
2. P Q5U465 Coiled-coil domain-containing protein 125 3.45e-05 1.55e-02 NA
2. P Q66IZ7 Nuclear distribution protein nudE-like 1-B 1.12e-07 5.63e-07 NA
2. P Q6QZQ4 Vimentin-type intermediate filament-associated coiled-coil protein 3.86e-06 1.58e-02 NA
2. P F4I878 Protein BRANCHLESS TRICHOME 1.63e-06 9.42e-06 NA
2. P Q5ZMC9 Nuclear distribution protein nudE homolog 1 1.45e-07 4.94e-04 NA
2. P O76878 RILP-like protein homolog 3.83e-05 5.22e-06 NA
2. P C7GY13 SWI5-dependent HO expression protein 3 1.05e-05 4.23e-06 NA
2. P D3YZP9 Coiled-coil domain-containing protein 6 7.07e-05 3.09e-07 NA
2. P Q28CJ6 Nuclear distribution protein nudE-like 1 1.33e-06 7.97e-05 NA
2. P Q8R2X8 Golgin-45 1.91e-05 1.97e-02 NA
2. P B3DLE8 Protein Spindly 1.67e-04 1.78e-07 NA
2. P C5DLA5 SWI5-dependent HO expression protein 3 1.20e-06 2.50e-08 NA
2. P Q08C53 Basal body-orientation factor 1 2.56e-05 3.99e-05 NA
2. P P48672 Vimentin A2 (Fragment) 5.40e-08 2.63e-05 NA
2. P Q9VM65 FGFR1 oncogene partner 2 homolog 7.01e-06 3.75e-02 NA
2. P Q9JJC6 RILP-like protein 1 1.76e-06 4.60e-05 NA
2. P Q5M9N0 Coiled-coil domain-containing protein 158 8.57e-03 5.20e-03 NA
2. P O46480 Nuclear distribution protein nudE-like 1 2.93e-07 7.70e-05 NA
2. P Q6ZUS5 Coiled-coil domain-containing protein 121 5.40e-08 7.01e-05 NA
2. P Q8BG89 Protein ZNF365 3.40e-06 6.36e-06 NA
2. P Q9Y2D8 Afadin- and alpha-actinin-binding protein 1.11e-04 4.26e-03 NA
2. P Q0VFX2 Cilia- and flagella-associated protein 157 1.58e-06 1.13e-03 NA
2. P Q06671 Autophagy-related protein 23 5.72e-05 1.38e-02 NA
2. P Q99JG7 TNFAIP3-interacting protein 2 2.94e-05 2.91e-04 NA
2. P B3LW62 Kinetochore protein Spc25 2.16e-05 3.90e-02 NA
2. P A0PJP4 RILP-like protein 1 5.32e-06 5.98e-06 NA
2. P Q6ZUS6 Coiled-coil domain-containing protein 149 4.68e-05 1.28e-04 NA
2. P B0BN18 Prefoldin subunit 2 1.47e-04 3.68e-02 NA
2. P Q96KP6 TNFAIP3-interacting protein 3 1.18e-06 9.75e-16 NA
2. P Q02435 Filensin (Fragment) 4.17e-04 9.17e-05 NA
2. P Q5U584 SH3 domain-binding protein 5-like 7.89e-07 4.21e-03 NA
2. P O14128 Probable sphingolipid long chain base-responsive protein pil2 2.16e-05 8.64e-03 NA
2. P Q9ER69 Pre-mRNA-splicing regulator WTAP 1.61e-06 1.30e-06 NA
2. P Q9USP7 Uncharacterized protein C902.06 1.04e-02 1.09e-03 NA
2. P Q86XG9 Putative neuroblastoma breakpoint family member 5 4.86e-05 2.79e-03 NA
2. P O43805 Sjoegren syndrome nuclear autoantigen 1 6.67e-08 3.94e-02 NA
2. P Q8N6Q1 Transmembrane and coiled-coil domain-containing protein 5A 9.94e-08 2.23e-06 NA
2. P Q6PDY0 Coiled-coil domain-containing protein 85B 1.42e-06 3.05e-04 NA
2. P A0JMK8 BICD family-like cargo adapter 2 2.75e-07 4.66e-02 NA
2. P Q10PZ6 Microtubule-associated protein 70-4 1.32e-04 6.23e-04 NA
2. P Q5R562 bMERB domain-containing protein 1 7.19e-06 2.03e-04 NA
2. P Q3KR99 Protein Spindly 5.29e-05 3.37e-09 NA
2. P Q95K40 Coiled-coil domain-containing protein 83 5.88e-05 2.54e-05 NA
2. P Q8R1Y2 bMERB domain-containing protein 1 6.22e-06 3.99e-05 NA
2. P Q6DK98 Nuclear distribution protein nudE-like 1-A 5.52e-06 5.35e-06 NA
2. P B7ZAP0 Rab GTPase-activating protein 1-like, isoform 10 6.52e-10 3.71e-05 NA
2. P Q9CPR7 Suppressor of IKBKE 1 7.87e-10 6.96e-04 NA
2. P Q810N9 Coiled-coil domain-containing protein 172 2.18e-07 2.21e-03 NA
2. P Q6P4K5 Pre-mRNA-splicing regulator WTAP 5.68e-07 1.83e-02 NA
2. P Q8CGZ2 Afadin- and alpha-actinin-binding protein 1.38e-03 5.46e-04 NA
2. P Q32L59 Transmembrane and coiled-coil domain-containing protein 5B 1.09e-07 2.38e-04 NA
2. P F8WBI6 Golgin subfamily A member 8N 8.11e-06 1.33e-02 NA
2. P P32448 Anti-silencing protein 2 1.67e-04 7.35e-05 NA
2. P Q5EBL4 RILP-like protein 1 6.18e-07 1.69e-06 NA
2. P Q28XY0 Pre-mRNA-splicing regulator female-lethal(2)D 4.27e-04 2.09e-03 NA
2. P Q3SYW5 5-azacytidine-induced protein 2 4.54e-06 9.79e-08 NA
2. P Q9QYP6 5-azacytidine-induced protein 2 1.13e-05 2.98e-06 NA
2. P Q12262 Inner kinetochore subunit MCM16 7.27e-06 1.21e-04 NA
2. P Q6CQV5 Biogenesis of lysosome-related organelles complex 1 subunit VAB2 2.48e-04 4.48e-02 NA
2. P D3UEM3 SWI5-dependent HO expression protein 3 7.91e-07 1.63e-05 NA
2. P Q32LC2 Neuroblastoma breakpoint family member 6-like protein 6.30e-05 6.17e-04 NA
2. P Q6CL89 Spindle pole body component SPC42 1.07e-05 4.97e-06 NA
2. P Q6P926 Spermatogenesis-associated protein 24 2.52e-10 1.87e-04 NA
2. P O45717 Protein nud-2 1.36e-09 1.20e-03 NA
2. P Q6NRJ5 Nuclear distribution protein nudE homolog 1-B 1.36e-07 5.68e-05 NA
2. P Q66GR8 Protein NETWORKED 3A 2.12e-04 3.61e-02 NA
2. P Q6NRW2 Protein Spindly-B 1.15e-04 1.03e-07 NA
2. P P13413 Troponin I, slow skeletal muscle 5.67e-05 3.38e-03 NA
2. P Q4KMA0 5-azacytidine-induced protein 2 2.78e-05 3.55e-06 NA
2. P Q0VCP9 Coiled-coil domain-containing protein 149 2.75e-05 1.47e-06 NA
2. P Q6PHN1 Coiled-coil domain-containing protein 57 4.44e-03 2.07e-03 NA
2. P Q8IWF9 Coiled-coil domain-containing protein 83 3.01e-06 9.69e-04 NA
2. P Q75EN7 SWI5-dependent HO expression protein 3 6.99e-05 3.14e-02 NA
2. P Q2TBH8 ZW10 interactor 4.06e-08 5.83e-06 NA
2. P Q5R8T7 Nuclear distribution protein nudE-like 1 4.79e-06 1.16e-04 NA
2. P Q10336 Meiotic coiled-coil protein 6 6.95e-08 9.97e-03 NA
2. P Q96EA4 Protein Spindly 6.10e-05 2.47e-10 NA
2. P Q5UNU6 Uncharacterized protein L683 NA 3.37e-02 NA
2. P Q5XJA2 Coiled-coil domain-containing protein 149-A 8.25e-05 2.67e-03 NA
2. P Q9SX73 Kinase-interacting family protein 3.05e-07 2.79e-07 NA
2. P Q8N0S2 Synaptonemal complex central element protein 1 8.01e-07 5.71e-04 NA
2. P Q15834 Coiled-coil domain-containing protein 85B 4.75e-06 3.08e-04 NA
2. P Q4R7I4 Spermatogenesis-associated protein 24 2.87e-08 4.67e-06 NA
2. P B5VE90 SWI5-dependent HO expression protein 3 4.42e-07 1.29e-05 NA
2. P Q2YDE5 Putative coiled-coil domain-containing protein 196 4.68e-04 9.92e-09 NA
2. P Q84TD8 Protein FLX-like 2 6.23e-06 2.53e-03 NA
2. P Q4R7J8 Synaptonemal complex central element protein 1 2.20e-07 3.87e-03 NA
2. P Q96MC5 bMERB domain-containing protein 1 1.47e-05 1.07e-04 NA
2. P Q32L17 Spermatogenic leucine zipper protein 1 1.45e-06 1.44e-08 NA
2. P Q78PB6 Nuclear distribution protein nudE-like 1 1.46e-06 6.93e-05 NA
2. P A8MYB1 Transmembrane and coiled-coil domain-containing protein 5B 9.86e-09 1.40e-02 NA
2. P Q5ZKH4 Nuclear distribution protein nudE-like 1 1.64e-07 4.62e-04 NA
2. P Q9H6S1 5-azacytidine-induced protein 2 3.55e-06 2.54e-11 NA
2. P Q9UTJ3 Meiotic expression up-regulated protein 1/2 6.12e-04 3.27e-02 NA
2. P P38272 SWI5-dependent HO expression protein 3 3.30e-06 6.05e-06 NA
2. P Q08DR9 Protein Spindly 6.36e-06 1.05e-10 NA
2. P Q66J96 Nuclear distribution protein nudE homolog 1-A 1.38e-07 3.29e-06 NA
2. P Q6PIF2 Synaptonemal complex central element protein 2 3.95e-06 1.68e-02 NA
2. P Q803Q2 Nuclear distribution protein nudE-like 1-B 3.93e-08 1.97e-05 NA
2. P Q5ND29 Rab-interacting lysosomal protein 2.65e-06 3.19e-04 NA
2. P Q8BGY3 Leucine zipper protein 2 1.28e-07 6.33e-03 NA
2. P Q06568 Nuclear distribution protein nudE homolog 1 2.27e-05 1.12e-09 NA
2. P Q53HC0 Coiled-coil domain-containing protein 92 2.25e-07 1.01e-05 NA
2. P Q9NXR1 Nuclear distribution protein nudE homolog 1 4.56e-07 6.69e-05 NA
2. P Q4R7Y8 Basal body-orientation factor 1 2.67e-07 5.89e-03 NA
2. P Q5PQS2 Protein ZNF365 1.53e-05 2.12e-05 NA
2. P Q5R9L2 Protein ZNF365 1.71e-06 8.23e-06 NA
2. P Q5XVC7 WEB family protein At2g40480 1.12e-04 4.26e-03 NA
2. P Q9P7J4 THO complex subunit mft1 3.01e-07 5.77e-03 NA
2. P B3LN26 SWI5-dependent HO expression protein 3 7.78e-07 1.63e-05 NA
2. P Q4PT37 Nuclear envelope-associated protein 3 1.10e-08 2.93e-02 NA
2. P Q86TE4 Leucine zipper protein 2 4.70e-07 1.72e-03 NA
2. P Q9D9D5 Transmembrane and coiled-coil domain-containing protein 5A 3.42e-08 3.69e-06 NA
2. P Q9GZM8 Nuclear distribution protein nudE-like 1 3.75e-07 2.27e-04 NA
2. P Q5PYI0 Troponin I, cardiac muscle 3.09e-06 4.80e-02 NA
2. P Q8CCX5 Keratin-like protein KRT222 1.02e-07 5.83e-06 NA
2. P Q2TA00 Coiled-coil domain-containing protein 83 6.41e-05 1.04e-05 NA
2. P A0A1B0GTZ2 Putative coiled-coil domain-containing protein 196 3.79e-08 1.13e-10 NA
2. P Q0IHE5 RILP-like protein 1 6.61e-07 1.57e-06 NA
2. P Q70YC5 Protein ZNF365 5.49e-06 1.04e-05 NA
2. P Q86W54 Spermatogenesis-associated protein 24 1.64e-07 3.22e-07 NA
2. P A6NCC3 Golgin subfamily A member 8O 2.37e-04 2.93e-02 NA
2. P P53267 DASH complex subunit DAM1 9.49e-04 4.08e-04 NA
2. P Q8N4L8 Coiled-coil domain-containing protein 24 6.37e-05 1.08e-02 NA
2. P Q9ES39 Nuclear distribution protein nudE homolog 1 5.65e-07 3.30e-07 NA
2. P F4K1B4 Nuclear envelope-associated protein 2 1.77e-06 8.12e-03 NA
2. P Q9VT70 Nuclear distribution protein nudE homolog 2.10e-07 3.99e-05 NA
2. P M1V4Y8 Cilia- and flagella-associated protein 73 2.00e-07 1.36e-04 NA
2. P Q66JL0 Nuclear distribution protein nudE homolog 1 2.87e-08 8.86e-06 NA
2. P Q96E40 Sperm acrosome-associated protein 9 5.56e-03 2.49e-04 NA
2. P A7E2F4 Golgin subfamily A member 8A 2.25e-04 1.87e-02 NA
2. P A2CEM9 Coiled-coil domain-containing protein 85B 6.10e-08 1.94e-06 NA
2. P Q8L7S4 Microtubule-associated protein 70-2 1.38e-04 1.73e-02 NA
2. P Q9C9N6 Protein PLASTID MOVEMENT IMPAIRED 2 1.27e-04 4.08e-03 NA
2. P Q4R4S6 Nuclear distribution protein nudE-like 1 3.23e-08 1.75e-04 NA
2. P Q5RD40 5-azacytidine-induced protein 2 1.13e-06 1.16e-07 NA
2. P A2BDR7 Cilia- and flagella-associated protein 157 5.10e-06 1.96e-04 NA
2. P Q810I0 Vacuolar protein sorting-associated protein 37D 2.62e-06 4.99e-04 NA
2. P Q6BWK6 DASH complex subunit DAM1 1.87e-04 5.42e-03 NA
2. P Q6DF11 FGFR1 oncogene partner 2 homolog 1.52e-08 9.97e-03 NA
2. P Q923A2 Protein Spindly 1.70e-05 1.41e-10 NA
2. P Q6CRH4 SWI5-dependent HO expression protein 3 9.34e-07 2.44e-07 NA
2. P A0A125S9M6 Cytotardin 2.59e-05 3.76e-05 NA
2. P Q3V079 Basal body-orientation factor 1 2.00e-06 2.38e-03 NA
2. P Q21194 Guanine nucleotide exchange factor rei-2 4.66e-05 1.83e-02 NA
2. P D3ZUQ0 RILP-like protein 1 1.83e-05 3.80e-05 NA
2. P Q5R8Y4 Leucine zipper protein 2 4.50e-08 2.83e-05 NA
2. P I6L899 Golgin subfamily A member 8R 2.68e-04 1.95e-02 NA
2. P Q9SCT6 WEB family protein At3g51720 1.46e-06 1.87e-04 NA
2. P Q8VDS7 Centrosomal protein CEP57L1 2.69e-06 7.61e-05 NA
2. P Q17695 Spindly-like protein spdl-1 1.08e-06 3.17e-13 NA
2. P A2IDD5 Coiled-coil domain-containing protein 78 1.44e-05 4.13e-04 NA
2. P Q7SXI6 Nuclear distribution protein nudE-like 1-A 2.26e-07 1.02e-04 NA
2. P H3BV12 Golgin subfamily A member 8Q 2.08e-04 1.61e-02 NA
2. P Q9ZUA3 Microtubule-associated protein 70-3 5.56e-04 1.88e-03 NA
2. P A0PJT0 RILP-like protein 1 1.61e-05 4.37e-08 NA
2. P A6ZL74 SWI5-dependent HO expression protein 3 4.48e-06 4.23e-06 NA
2. P Q15007 Pre-mRNA-splicing regulator WTAP 9.32e-07 6.68e-06 NA
2. P Q4PJT6 Spermatogenesis-associated protein 24 2.19e-10 5.09e-06 NA
2. P Q0VFN8 Cilia- and flagella-associated protein 157 4.43e-06 1.12e-03 NA
2. P F4IMQ0 Protein FLC EXPRESSOR 5.96e-08 9.65e-09 NA
2. P A4IH82 SH3 domain-binding protein 5-like 5.56e-06 2.85e-03 NA
2. P Q8NFZ5 TNFAIP3-interacting protein 2 8.88e-06 1.19e-03 NA
2. P Q8N1A0 Keratin-like protein KRT222 5.86e-07 6.89e-04 NA
2. P C5DUI8 SWI5-dependent HO expression protein 3 2.87e-05 1.56e-03 NA
2. P Q5R561 FGFR1 oncogene partner 2 homolog 2.00e-09 3.83e-02 NA
2. P O95229 ZW10 interactor 1.78e-07 2.05e-02 NA
2. P Q9ERR1 Nuclear distribution protein nudE-like 1 1.56e-07 6.93e-05 NA
2. P Q16204 Coiled-coil domain-containing protein 6 2.53e-05 3.30e-05 NA
2. P Q2KI75 Keratin-like protein KRT222 2.90e-07 6.93e-05 NA
2. P Q8VDN4 Coiled-coil domain-containing protein 92 1.91e-07 4.66e-02 NA
2. P A7TJJ7 SWI5-dependent HO expression protein 3 2.04e-05 2.00e-05 NA
2. P Q6FMH8 SWI5-dependent HO expression protein 3 4.27e-07 1.10e-04 NA
2. P A7MD70 Protein Spindly 8.81e-05 2.90e-07 NA
2. P Q8VC66 Afadin- and alpha-actinin-binding protein 8.12e-05 1.05e-02 NA
2. P Q2TAC2 Coiled-coil domain-containing protein 57 6.57e-04 9.77e-03 NA
2. P Q4R7H3 Protein Spindly 7.55e-05 8.70e-12 NA
2. P Q86XT2 Vacuolar protein sorting-associated protein 37D 4.16e-05 5.83e-06 NA
2. P B4G5J0 Kinetochore protein Spc25 1.86e-06 3.79e-02 NA
2. P Q9CZA6 Nuclear distribution protein nudE homolog 1 6.26e-06 2.33e-08 NA
2. P Q5BIX7 Protein Spindly-A 1.54e-04 5.14e-08 NA
2. P Q5FWT9 Suppressor of IKBKE 1 2.02e-08 1.74e-03 NA
2. P Q9WUZ5 Troponin I, slow skeletal muscle 5.29e-05 6.40e-03 NA
2. P P21651 Recombination protein 107 4.24e-07 7.63e-03 NA
2. P Q5FVJ5 bMERB domain-containing protein 1 2.62e-05 1.26e-05 NA
2. P Q6AYB8 Golgin-45 2.91e-06 1.56e-03 NA
2. P Q17QG3 RILP-like protein 1 2.28e-06 7.10e-06 NA
2. P Q4R3X1 5-azacytidine-induced protein 2 2.74e-06 4.41e-09 NA
2. P Q3V2A7 Glutamine-rich protein 2 6.85e-04 3.37e-02 NA
2. P Q6C5P0 Mediator of RNA polymerase II transcription subunit 10 1.72e-03 2.13e-02 NA
2. P C5E4H7 Spindle pole body component SPC42 9.68e-06 2.43e-02 NA
2. P A8MT33 Synaptonemal complex central element protein 1-like 9.13e-08 2.18e-02 NA